LaIT6: A Novel Insect-Selective K+-Channel Toxin from Liocheles australasiae Scorpion Venom
Abstract
1. Introduction
2. Results
2.1. Identification of α-KTx Peptides in L. australasiae Venom
2.2. Bioactivity Evaluation
2.3. Structure–Activity Relationship
2.4. Effect of LaIT6 on K+ Channels
3. Discussion
4. Materials and Methods
4.1. Materials
4.2. Peptide Synthesis
4.3. Folding Reaction
4.4. Mass Spectrometry
4.5. Bioassay
4.6. Prediction of Mature Structure
4.7. Electrophysiological Recordings
4.8. Three-Dimensional Structure Prediction
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
| NaTx | toxin acting on voltage-gated Na+ channels |
| KTx | toxin acting on voltage-gated K+ channels |
| CS α/β | cystine-stabilized α-helix and β-sheet |
| HATU | 1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo [4,5-b]pyridinium 3-oxide hexafluorophosphate |
| HOBt | 1-hydroxybenzotriazole |
| DIC | N,N′-diisopropylcarbodiimide |
| Fmoc | 9-fluorenylmethyloxycarbonyl |
| SPPS | solid phase peptide synthesis |
| DMF | N,N-dimethylformamide |
| DIEA | N,N-diisopropylethylamine |
| TFA | trifluoroacetic acid |
| LD50 | dose required to induce death in half of animals |
| IC50 | half maximal inhibitory concentration |
| CI | confidence interval |
References
- Tobassum, S.; Tahir, H.M.; Arshad, M.; Zahid, M.T.; Ali, S.; Ahsan, M.M. Nature and applications of scorpion venom: An overview. Toxin Rev. 2020, 39, 214–225. [Google Scholar] [CrossRef]
- Bermúdez-Guzmán, M.D.; Buenrostro-Nava, M.T.; Valdez-Velázquez, L.L.; Lino-López, G.J.; García-Villalvazo, P.E.; Orozco-Santos, M.; Michel-López, C.Y. Scorpion venom insectotoxins: A sustainable alternative for pest control in agriculture. Phytoparasitica 2024, 52, 83. [Google Scholar] [CrossRef]
- Diochot, S. Pain-related toxins in scorpion and spider venoms: A face to face with ion channels. J. Venom. Anim. Toxins 2021, 27, e20210026. [Google Scholar] [CrossRef] [PubMed]
- Ahmadi, S.; Knerr, J.M.; Argemi, L.; Bordon, K.C.F.; Pucca, M.B.; Cerni, F.A.; Arantes, E.C.; Caliskan, F.; Laustsen, A.H. Scorpion venom: Detriments and benefits. Biomedicines 2020, 8, 118. [Google Scholar] [CrossRef] [PubMed]
- Mendes, L.C.; Viana, G.M.M.; Nencioni, A.L.A.; Pimenta, D.C.; Beraldo-Neto, E. Scorpion peptides and ion channels: An insightful review of mechanisms and drug development. Toxins 2023, 15, 238. [Google Scholar] [CrossRef]
- Ortiz, E.; Possani, L.D. The unfulfilled promises of scorpion insectotoxins. J. Venom. Anim. Toxins 2015, 21, 16. [Google Scholar] [CrossRef]
- Dutertre, S.; Lewis, R.J. Use of venom peptides to probe ion channel structure and function. J. Biol. Chem. 2010, 285, 13315–13320. [Google Scholar] [CrossRef]
- Sunagar, K.; Undheim, E.A.B.; Chan, A.H.C.; Koludarov, I.; Muñoz-Gómez, S.A.; Antunes, A.; Fry, B.G. Evolution stings: The origin and diversification of scorpion toxin peptide scaffolds. Toxins 2013, 5, 2456–2487. [Google Scholar] [CrossRef]
- Wang, X.T.; Luo, H.; Peng, X.Z.; Chen, J.J. Spider and scorpion knottins targeting voltage-gated sodium ion channels in pain signaling. Biochem. Pharmacol. 2024, 227, 116465. [Google Scholar] [CrossRef]
- Quintero-Hernandez, V.; Jimenez-Vargas, J.M.; Gurrola, G.B.; Valdivia, H.H.; Possani, L.D. Scorpion venom components that affect ion-channels function. Toxicon 2013, 76, 328–342. [Google Scholar] [CrossRef]
- Pedraza Escalona, M.; Possani, L.D. Scorpion beta-toxins and voltage-gated sodium channels: Interactions and effects. Front. Biosci. 2013, 18, 572–587. [Google Scholar] [CrossRef] [PubMed]
- Zhao, Y.; Chen, Z.; Cao, Z.; Li, W.; Wu, Y. Diverse structural features of potassium channels characterized by scorpion toxins as molecular probes. Molecules 2019, 24, 2045. [Google Scholar] [CrossRef] [PubMed]
- Jimenez-Vargas, J.M.; Possani, L.D.; Luna-Ramirez, K. Arthropod toxins acting on neuronal potassium channels. Neuropharmacology 2017, 127, 139–160. [Google Scholar] [CrossRef] [PubMed]
- Shakeel, K.; Olamendi-Portugal, T.; Naseem, M.U.; Becerril, B.; Zamudio, F.Z.; Delgado-Prudencio, G.; Possani, L.D.; Panyi, G. Of seven new K channel inhibitor peptides of Centruroides bonito, α-KTx 2.24 has a picomolar affinity for Kv1.2. Toxins 2023, 15, 506. [Google Scholar] [CrossRef]
- Kuzmenkov, A.I.; Vassilevski, A.A.; Kudryashova, K.S.; Nekrasova, O.V.; Peigneur, S.; Tytgat, J.; Feofanov, A.V.; Kirpichnikov, M.P.; Grishin, E.V. Variability of potassium channel blockers in Mesobuthus eupeus scorpion venom with focus on Kv1.1: An integrated transcriptomic and proteomic study. J. Biol. Chem. 2015, 290, 12195–12209. [Google Scholar] [CrossRef]
- Juichi, H.; Miyashita, M.; Nakagawa, Y.; Miyagawa, H. Isolation and characterization of the insecticidal, two-domain toxin LaIT3 from the Liocheles australasiae scorpion venom. Biosci. Biotechnol. Biochem. 2019, 83, 2183–2189. [Google Scholar] [CrossRef]
- Matsushita, N.; Miyashita, M.; Ichiki, Y.; Ogura, T.; Sakuradani, E.; Nakagawa, Y.; Shimizu, S.; Miyagawa, H. Purification and cDNA cloning of LaIT2, a novel insecticidal toxin from venom of the scorpion Liocheles australasiae. Biosci. Biotechnol. Biochem. 2009, 73, 2769–2772. [Google Scholar] [CrossRef][Green Version]
- Miyashita, M.; Mitani, N.; Iwamoto, F.; Hirota, M.; Nakagawa, Y. Discovery of a novel insecticidal peptide with a cystine-stabilized α-helix/α-helix motif from the venom of scorpion Liocheles australasiae. Molecules 2025, 30, 32. [Google Scholar] [CrossRef]
- Miyashita, M.; Mitani, N.; Kitanaka, A.; Yakio, M.; Chen, M.; Nishimoto, S.; Uchiyama, H.; Sue, M.; Hotta, H.; Nakagawa, Y.; et al. Identification of an antiviral component from the venom of the scorpion Liocheles australasiae using transcriptomic and mass spectrometric analyses. Toxicon 2021, 191, 25–37. [Google Scholar] [CrossRef]
- Horita, S.; Matsushita, N.; Kawachi, T.; Ayabe, R.; Miyashita, M.; Miyakawa, T.; Nakagawa, Y.; Nagata, K.; Miyagawa, H.; Tanokura, M. Solution structure of a short-chain insecticidal toxin LaIT1 from the venom of scorpion Liocheles australasiae. Biochem. Biophys. Res. Commun. 2011, 411, 738–744. [Google Scholar] [CrossRef]
- Sakai, S.; Fujita, Y.; Juichi, H.; Nakagawa, Y.; Miyashita, M. Chemical synthesis and functional characterization of LaIT3, an insecticidal two-domain peptide in Liocheles australasiae venom. Toxicon 2024, 238, 107564. [Google Scholar] [CrossRef]
- Fajloun, Z.; Carlier, E.; Lecomte, C.; Geib, S.; di Luccio, E.; Bichet, D.; Mabrouk, K.; Rochat, H.; De Waard, M.; Sabatier, J.M. Chemical synthesis and characterization of Pi1, a scorpion toxin from Pandinus imperator active on K+ channels. Eur. J. Biochem. 2000, 267, 5149–5155. [Google Scholar] [CrossRef] [PubMed]
- Mouhat, S.; De Waard, M.; Sabatier, J.M. Contribution of the functional dyad of animal toxins acting on voltage-gated Kv1-type channels. J. Pept. Sci. 2005, 11, 65–68. [Google Scholar] [CrossRef]
- Chen, Z.Y.; Zeng, D.Y.; Hu, Y.T.; He, Y.W.; Pan, N.; Ding, J.P.; Cao, Z.J.; Liu, M.L.; Li, W.X.; Yi, H.; et al. Structural and Functional Diversity of Acidic Scorpion Potassium Channel Toxins. PLoS ONE 2012, 7, e35154. [Google Scholar] [CrossRef] [PubMed]
- Abramson, J.; Adler, J.; Dunger, J.; Evans, R.; Green, T.; Pritzel, A.; Ronneberger, O.; Willmore, L.; Ballard, A.J.; Bambrick, J.; et al. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature 2024, 630, 493–500. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.L.; Umetsu, Y.; Gao, B.; Ohki, S.; Zhu, S.Y. Mesomartoxin, a new Kv1.2-selective scorpion toxin interacting with the channel selectivity filter. Biochem. Pharmacol. 2015, 93, 232–239. [Google Scholar] [CrossRef]
- Kominsky-Atias, A.; Somech, E.; Zilberberg, N. Isolation of the first toxin from the scorpion Buthus occitanus israelis showing preference for Shaker potassium channels. FEBS Lett. 2007, 581, 2478–2484. [Google Scholar] [CrossRef]
- Garcia, M.L.; Garciacalvo, M.; Hidalgo, P.; Lee, A.; Mackinnon, R. Purification and characterization of 3 inhibitors of noltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry 1994, 33, 6834–6839. [Google Scholar] [CrossRef]
- Hidalgo, P.; Mackinnon, R. Revealing the architecture of a K+ channel pore through mutant cycles with a peptide inhibitor. Science 1995, 268, 307–310. [Google Scholar] [CrossRef]
- Mouhat, S.; Mosbah, A.; Visan, V.; Wulff, H.; Delepierre, M.; Darbon, H.; Grissmer, S.; De Waard, M.; Sabatier, J.M. The ‘functional’ dyad of scorpion toxin Pi1 is not itself a prerequisite for toxin binding to the voltage-gated Kv1.2 potassium channels. Biochem. J. 2004, 377, 25–36. [Google Scholar] [CrossRef]
- Luna-Ramírez, K.; Bartok, A.; Restano-Cassulini, R.; Quintero-Hernández, V.; Coronas, F.I.V.; Christensen, J.; Wright, C.E.; Panyi, G.; Possani, L.D. Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the of the Australian scorpion Urodacus yaschenkoi. Mol. Pharmacol. 2014, 86, 28–41. [Google Scholar] [CrossRef]
- Schwartz, E.F.; Bartok, A.; Schwartz, C.A.; Papp, F.; Gomez-Lagunas, F.; Panyi, G.; Possani, L.D. OcyKTx2, a new K+- channel toxin characterized from the venom of the scorpion Opisthacanthus cayaporum. Peptides 2013, 46, 40–46. [Google Scholar] [CrossRef] [PubMed]
- Yin, S.J.; Jiang, L.; Yi, H.; Han, S.; Yang, D.W.; Liu, M.L.; Liu, H.; Cao, Z.J.; Wu, Y.L.; Li, W.X. Different residues in channel turret determining the selectivity of ADWX-1 inhibitor peptide between Kv1.1 and Kv1.3 channels. J. Proteome Res. 2008, 7, 4890–4897. [Google Scholar] [CrossRef] [PubMed]
- Wu, Y.Y.; Yan, Y.Y.; Yang, Y.S.; Bian, S.M.; Rivetta, A.; Allen, K.; Sigworth, F.J. CryoEM structures of Kv1.2 potassium channels, conducting and non-conducting. eLife 2025, 12, RP89459. [Google Scholar] [CrossRef] [PubMed]
- Tan, X.F.; Bae, C.; Stix, R.; Fernandez-Marino, A.I.; Huffer, K.; Chang, T.H.; Jiang, J.S.; Faraldo-Gómez, J.D.; Swartz, K.J. Structure of the Shaker Kv channel and mechanism of slow C-type inactivation. Sci. Adv. 2022, 8, eabm7814. [Google Scholar] [CrossRef]
- Miyashita, M.; Otsuki, J.; Hanai, Y.; Nakagawa, Y.; Miyagawa, H. Characterization of peptide components in the venom of the scorpion Liocheles australasiae (Hemiscorpiidae). Toxicon 2007, 50, 428–437. [Google Scholar] [CrossRef]
- Almagro Armenteros, J.J.; Tsirigos, K.D.; Sonderby, C.K.; Petersen, T.N.; Winther, O.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat. Biotechnol. 2019, 37, 420–423. [Google Scholar] [CrossRef]
- Liman, E.R.; Tytgat, J.; Hess, P. Subunit stoichiometry of a mammalian K+ channel determined by construction of multimeric cDNAs. Neuron 1992, 9, 861–871. [Google Scholar] [CrossRef]






| Precursor | Sequence 1 | Monoisotopic Molecular Mass of Predicted Mature Structure | |
|---|---|---|---|
| Calcd. | Obsd. 2 | ||
| La-αKTx1 | MNAKFIYILLLTAVMFALYEASVPPNIPCQVTNQCPKPCREATGRPNSKCINGRCKCYG | 4053.88 | 4053.88 |
| La-αKTx2 | MNTKFVFLLLVISTLMPTFDASAEDISCSSSKECYDPCEEETGCSSAKCVGGWCKCYGCRG | 4150.53 | 4150.53 |
| La-αKTx3 | MNRNFVFLLLLIVTLMPMLDAATEDINCDNWRDCLKPCKDETGCPNSKCEEGNCLCYGCNRLTV | 4803.93 | 4803.92 |
| La-αKTx4 | MNKKFIFLLLVVTTLMPMFDAATEAISCSNPNDCREPCKKQTGCSGGKCMNRKCKCHRCNG | 4250.78 | 4250.77 |
| La-αKTx5 | MNAKLVCIVLLTAVMFAPDEASLPPIRIPCYVSKDCRKPCLYLTGTPRSKCINRRCKCYG | 4423.23 | ND |
| La-αKTx6 | MNKPFCAIFLVVLIMFAVSVLPAESTGGCPVDSLCKSYCKSNKFGTEGKCDGTSCKCAIG | 3482.49 | ND |
| La-αKTx7 | MNKLACYILICVMVSCLFKVPVAEGISAGCPLTAKLCTIYCKKHRFGREGKCIGPTRFRCKCYV | 4400.19 | 4400.18 |
| La-αKTx8 | MRLVIILLLMTTLVLAVGAPLGGAKCSSSTQCTRPCRYAGGTHGKCMNGRCRCYG | 3772.62 | ND |
| La-αKTx9 | MELKYLLVLLAVTCLVSCQDNSLLPSGSCSRTGICMESCAPFLYQPKYHRRCPAGYVCCTLIY | 5024.25 | ND |
| Peptide | Structure 1 | LD50 (nmol/g) 2 |
|---|---|---|
| mLa-αKTx1 (LaIT6) | ![]() | 16 (13–19) |
| mLa-αKTx2 | ![]() | >100 |
| mLa-αKTx3 | ![]() | >100 |
| mLa-αKTx4 | ![]() | >100 |
| mLa-αKTx7 | ![]() | >100 |
| Peptide | Sequence 1 | LD50 (nmol/g) 2 |
|---|---|---|
| LaIT6 | SVPPNIPCQVTNQCPKPCREATGRPNSKCINGRCKCY | 16 (13–19) |
| LaIT6(K16A) | SVPPNIPCQVTNQCPAPCREATGRPNSKCINGRCKCY | 13 (12–16) |
| LaIT6(R19A) | SVPPNIPCQVTNQCPKPCAEATGRPNSKCINGRCKCY | 14 (13–15) |
| LaIT6(E20A) | SVPPNIPCQVTNQCPKPCRAATGRPNSKCINGRCKCY | 25 (25) |
| LaIT6(R24A) | SVPPNIPCQVTNQCPKPCREATGAPNSKCINGRCKCY | 20 (12–36) |
| LaIT6(K28A) | SVPPNIPCQVTNQCPKPCREATGRPNSACINGRCKCY | >100 |
| LaIT6(R33A) | SVPPNIPCQVTNQCPKPCREATGRPNSKCINGACKCY | 12 (4–33) |
| LaIT6(K35A) | SVPPNIPCQVTNQCPKPCREATGRPNSKCINGRCACY | 95 (50–180) |
| LaIT6(Y37A) | SVPPNIPCQVTNQCPKPCREATGRPNSKCINGRCKCA | >100 |
| LaIT6(COOH) | SVPPNIPCQVTNQCPKPCREATGRPNSKCINGRCKCY | 19 (14–25) |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Kumagai, K.; Kishimoto, T.; Carleer, K.; Butatsu, N.; Teramoto, T.; Mitani, N.; Tytgat, J.; Nakagawa, Y.; Miyashita, M. LaIT6: A Novel Insect-Selective K+-Channel Toxin from Liocheles australasiae Scorpion Venom. Molecules 2025, 30, 3346. https://doi.org/10.3390/molecules30163346
Kumagai K, Kishimoto T, Carleer K, Butatsu N, Teramoto T, Mitani N, Tytgat J, Nakagawa Y, Miyashita M. LaIT6: A Novel Insect-Selective K+-Channel Toxin from Liocheles australasiae Scorpion Venom. Molecules. 2025; 30(16):3346. https://doi.org/10.3390/molecules30163346
Chicago/Turabian StyleKumagai, Konoka, Takumi Kishimoto, Kathleen Carleer, Nana Butatsu, Tsubasa Teramoto, Naoya Mitani, Jan Tytgat, Yoshiaki Nakagawa, and Masahiro Miyashita. 2025. "LaIT6: A Novel Insect-Selective K+-Channel Toxin from Liocheles australasiae Scorpion Venom" Molecules 30, no. 16: 3346. https://doi.org/10.3390/molecules30163346
APA StyleKumagai, K., Kishimoto, T., Carleer, K., Butatsu, N., Teramoto, T., Mitani, N., Tytgat, J., Nakagawa, Y., & Miyashita, M. (2025). LaIT6: A Novel Insect-Selective K+-Channel Toxin from Liocheles australasiae Scorpion Venom. Molecules, 30(16), 3346. https://doi.org/10.3390/molecules30163346






