Next Article in Journal
Investigation of the Efficacy of Benzylidene-3-methyl-2-thioxothiazolidin-4-one Analogs with Antioxidant Activities on the Inhibition of Mushroom and Mammal Tyrosinases
Next Article in Special Issue
Colistin: Lights and Shadows of an Older Antibiotic
Previous Article in Journal
Structural, Biophysical, and Computational Studies of a Murine Light Chain Dimer
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Antibacterial Properties of Peptide and Protein Fractions from Cornu aspersum Mucus

by
Lyudmila Velkova
1,*,
Aleksandar Dolashki
1,
Ventsislava Petrova
2,
Emiliya Pisareva
2,
Dimitar Kaynarov
1,
Momchil Kermedchiev
1,
Maria Todorova
1,3 and
Pavlina Dolashka
1,*
1
Institute of Organic Chemistry with Centre of Phytochemistry, Bulgarian Academy of Sciences, Acad. G. Bonchev Str., bl. 9, 1113 Sofia, Bulgaria
2
Faculty of Biology, Sofia University, 8 Dragan Tzankov blvd., 1164 Sofia, Bulgaria
3
Businesslab Ltd., Acad. G. Bonchev Str., bl. 4A, 1113 Sofia, Bulgaria
*
Authors to whom correspondence should be addressed.
Molecules 2024, 29(12), 2886; https://doi.org/10.3390/molecules29122886
Submission received: 26 April 2024 / Revised: 28 May 2024 / Accepted: 11 June 2024 / Published: 18 June 2024

Abstract

The discovery and investigation of new natural compounds with antimicrobial activity are new potential strategies to reduce the spread of antimicrobial resistance. The presented study reveals, for the first time, the promising antibacterial potential of two fractions from Cornu aspersum mucus with an MW < 20 kDa and an MW > 20 kDa against five bacterial pathogens—Bacillus cereus 1085, Propionibacterium acnes 1897, Salmonella enterica 8691, Enterococcus faecalis 3915, and Enterococcus faecium 8754. Using de novo sequencing, 16 novel peptides with potential antibacterial activity were identified in a fraction with an MW < 20 kDa. Some bioactive compounds in a mucus fraction with an MW > 20 kDa were determined via a proteomic analysis on 12% sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS–PAGE) and bioinformatics. High homology with proteins and glycoproteins was found, with potential antibacterial activity in mucus proteins named aspernin, hemocyanins, H-lectins, and L-amino acid oxidase-like protein, as well as mucins (mucin-5AC, mucin-5B, mucin-2, and mucin-17). We hypothesize that the synergy between the bioactive components determined in the composition of the fraction > 20 kDa are responsible for the high antibacterial activity against the tested pathogens in concentrations between 32 and 128 µg/mL, which is comparable to vancomycin, but without cytotoxic effects on model eukaryotic cells of Saccharomyces cerevisiae. Additionally, a positive effect, by reducing the levels of intracellular oxidative damage and increasing antioxidant capacity, on S. cerevisiae cells was found for both mucus extract fractions of C. aspersum. These findings may serve as a basis for further studies to develop a new antibacterial agent preventing the development of antibiotic resistance.

1. Introduction

The World Health Organization (WHO) has reported an alarming increase in the number of bacterial strains resistant to conventional antibiotics, which is a threat to public health safety [1]. Additionally, antibiotic resistance (AR) is a global problem with important economic impacts [2,3]. The causes of AR are multifactorial, with the indiscriminate and prolonged use of antibiotics in both human and veterinary medicine as well as agriculture being paramount to the development and spread of drug-resistant microorganisms [4,5].
Bacteria are complex organisms and the effect of antibiotics on bacterial DNA is weak, but may provoke new acquired resistance mechanisms [6]. AR is a public health problem, spreading through humans, animals (domestic and wild), and the environment (water and air) [4]. Antibiotic resistance is therefore a silent pandemic that requires global health solutions [7]. The problem of antibiotic resistance necessitates an urgent search for alternatives to conventional antibiotics, with new modes of action and less susceptibility to bacterial resistance.
Antimicrobial peptides (AMPs) may be one of the solutions with which to address this problem. These evolutionarily conserved peptides display a remarkable structural and functional diversity, and have been found in virtually all organisms, ranging from simple prokaryotes to complex eukaryotes, including humans [8,9]. AMPs are an important part of the innate immune systems of various organisms, providing a first line of defense against pathogenic invasion [10]. In contrast to antibiotics, AMPs have been shown to act on multiple targets on the plasma membranes of pathogenic bacteria as well as intracellular targets, and some of them have potent activity on drug-resistant bacteria [11]. AMPs from both synthetic and natural sources demonstrate broad-spectrum antimicrobial activity with high specificity and low toxicity; therefore, they are excellent candidates with which to overcome antibiotic resistance [11]. Studies reveal that cationic AMPs exert antibacterial activity by interacting with negatively charged bacterial membranes, resulting in increased membrane permeability, which leads to cell membrane damage, lysis, and cell content release, eventually resulting in cell death [11]. α-helical and β-sheet AMPs possess different binding mechanisms to bacterial membranes and can cause specific dynamic changes in membrane structures [12]. Furthermore, depending on peptide–lipid ratios, AMPs can be either vertically or parallel-oriented in membranes, causing membrane fragmentation or membrane pore formation, respectively [11]. Unlike cationic AMPs, the modes of action of anionic AMPs are not yet well understood, but it has been suggested that the antibacterial action of maximin H5 against Staphylococcus aureus is also related to membrane disruption [13]. Some AMPs at low concentrations can kill bacteria without changing membrane integrity [14]. Instead of directly interacting with the membrane, these AMPs kill bacteria by inhibiting important pathways inside a cell, such as DNA replication and protein synthesis, enzyme activity and cell wall synthesis, or by promoting the release of lyases to destroy cell structures [11,14].
AMPs play a crucial role against various infections in invertebrate species, which, unlike vertebrates, do not have an adaptive immune system, and, therefore, rely solely on innate defense mechanisms [15]. Invertebrate organisms of the phylum Mollusca represent one of the largest reservoirs of pharmacologically active compounds due to their great diversity (surpassed only by arthropods) and their ability to adapt to almost all types of habitats [16,17]. Bioactive compounds from hemolymph and mucus from gastropods have been shown to be powerful bioactive combinations with potential applications in combating pathogenic bacteria [18,19,20,21,22,23,24,25,26].
In the last decade, several studies reported antibacterial and antioxidant properties, as well as healing potential in treating wounds on the mucus of some land snails [18,21,22,23,26,27,28,29]. The antimicrobial activity of land snail mucus is known to be related not only to the presence of AMPs but also to some antibacterial proteins and glycoproteins [30,31]. A number of studies have reported that some proteins and glycoproteins in the mucus of various land snails (Achatina fulica, H. aspersa, Cryptozona bistrialis, Lissachatina fulica, and Hemiplecta differenta) are responsible for the antimicrobial properties of extracts from these snails [22,23,26,30,31,32,33,34].
The presented analyses in the current study are on new natural compounds with antimicrobial activity that upgrade our previous studies on the antibacterial activity of Cornu aspersum snail mucus. New information is provided on the antibacterial activity of two mucus fractions with an MW < 20 and an MW > 20 kDa from C. aspersum against five pathogenic bacteria (Bacillus cereus 1085, Propionibacterium acnes 1897, Salmonella enterica 8691, Enterococcus faecalis 3915, and Enterococcus faecium 8754) in addition to the identified important mucus components associated with antimicrobial activity.

2. Results

2.1. Preparation of Snail Mucus Extracts

The mucus was collected from C. aspersum snails growing on Bulgarian eco-farms using patented technology, without disturbing the biological functions of snails [19,21]. The resulting crude mucus extract was homogenized and centrifuged to remove coarse impurities. The purified native mucus extract was separated into two major fractions via ultrafiltration under pressure with polyethersulfone membrane filters with pore sizes of 20 kDa (Microdyn Nadir™ from the STERLITECH Corporation, Goleta, CA, USA).

2.2. Analysis and Characteristics of the Isolated Mucus Fraction with an MW < 20 kDa

After purification via RP-HPLC on a BioSill C18 HL 90–10 column, the molecular masses of the bioactive compounds in the fraction with an MW < 20 kDa (Figure 1) were identified by mass spectrometry.

2.2.1. Molecular Mass Analysis and De Novo Sequencing of Peptides by Mass Spectrometry

A thorough characterization of a fraction with an MW < 20 kDa is presented via matrix-assisted laser desorption/ionization time-of-flight mass spectrometry analyses (MADI-TOF-MS analyses) up to 3 kDa (Figure 2) and a range between 3 and 20 kDa (Figure 3). The MS spectrum presented in Figure 2 shows that the mucus fraction with an MW < 3 kDa contained various peptides with different masses in the region between 900 and 3011 Da. Peptides determined as protonated molecule ions [M+H]+ at m/z 1376 Da, 1438 Da, 1738 Da, 1796 Da, 1909 Da, 1966 Da, and 2292 Da dominate the MS spectrum (Figure 2).
Peptides and polypeptides with higher molecular weights detected in the fraction with an MW < 20 kDa are presented on the MS spectrum in Figure 3, as molecular protonated ions [M + H]+ at m/z 5573.742 Da, 6429.681 Da, 7337.199 Da, 11,143.605 Da, 12,464.216 Da, 15,059.328 Da, and 18,005.169 Da, as well as various other ions with lower intensities. The determined ions [M+H]+ at m/z 12.464 Da, 15,059.328 Da, and 18,005.169 Da are in good agreement with similar proteins in the snail mucus of C. aspersum [26,35], Helix pomatia [36], and A. fulica [37], reported previously.
The amino acid sequences (AASs) of low-molecular-weight peptides (with an MW < 3 kDa) were identified by de novo sequencing experiments (MS/MS analyses) of the [M+H]+ ions. Following b- and y-fragmentation ions in the MS/MS spectrum of peptide [M+H]+ at m/z 1966.11, the amino acid sequence LLLDNKGGGLVGGLLGGGGKGGG was identified (Figure 4).
Thus, the amino acid sequences of 16 new peptides with molecular masses below 3000 Da were identified, and the AASs of another 6 peptides were confirmed (Table 1). The determined physicochemical characteristics of the identified peptides, such as isoelectric points (pIs), the grand average of hydropathicity (GRAVY), and net charge by the ExPASy MW/pI tool program and ExPASy ProtParam tool are presented in Table 1. The analysis showed the presence of both cationic and anionic, as well as neutral, amphipathic peptide structures.
The analysis showed the presence of cationic, anionic, and neutral amphipathic peptide structures with generally hydrophobic surfaces, but nine hydrophilic peptides were also identified (nos. 1, 6–10, 12, and 15, Table 1). Based on the found primary structures of peptides (Table 1), their antimicrobial activity was predicted using iAMPpred software (http://cabgrid.res.in:8080/amppred) (accessed on 6 March 2024), an extensive database [41]. The results showed that peptides nos. 3, 7, 8, 13, 17, 18, 20, and 21–23 had the highest prognostic, antibacterial, and antifungal activities, while peptides 8 and 17 had the highest prognostic antiviral activities.
The alignment of the AASs of peptides shown in Table 1 with database AMPs via CAMPSing software (http://campsign.bicnirrh.res.in/, accessed on 24 March 2024) revealed similarity with known antimicrobial peptides (presented in Supplementary Materials, SIS1). Peptides nos. 10, 13, 17, 18, 20, 21, 22, and 23 show high homology with glycine-rich antimicrobial peptides, procambarin, holotricin, microcin B, acanthoscurrin and ctenidin; with the Gly/Leu-rich antimicrobial peptide leptoglycin; and glycine-rich protein GWK, while peptides nos. 7, 8, 12, and 15 revealed homology with defensin-like protein 196, glycine-rich protein GWK, crustin-like antimicrobial peptide, and different forms of gallinacin as well as shepherin (presented in Supplementary Materials, SIS1).
The presented evidence confirmed that identified mucus peptides belong to the AMP family. Furthermore, the obtained results can be considered as basic information in the study of bioactive peptides from the C. aspersum mucus extract and for their potential biomedical applications.

2.2.2. Characterization of the Mucus Extract Fraction with an MW > 20 kDa via Electrophoretic and MALDI-Tof-MS Analyses

The electrophoretic profile determined by 12% SDS-PAGE of the mucus extract fraction from C. aspersum with an MW > 20 kDa (at a concentration of 1.4 mg/mL) clearly shows various protein bands with MWs primarily in the region between 20 and 200 kDa (Figure 5a). The highest expression was observed for proteins with an MW of 17.6 kDa, 26.71 kDa, 29–32 kDa, 39.115 kDa, between 48 and 60 kDa, 97.0 kDa, and over 100 kDa (Figure 5a). Proteins with an MW of 20.5 kDa, 23.6 kDa, 29.1 kDa, 35.93 kDa, 70.89 kDa, and 84.77 kDa are also present in the composition of the fraction with an MW > 20 kDa, although with a lower expression.
A more accurate analysis of molecular masses and protein intensities in the mucus fraction with an MW > 20 kDa was obtained by ImageQuantTM TL v8.2.0 software, after the scanning of 12% SDS-PAGE (Figure 5b,c). Based on the performed analysis, 18 protein bands were identified, most of which had an MW between 23 and 200 kDa. The obtained results presented in Figure 5c are in good agreement with the results of the MALDI-Tof-MS analysis in the 20–80 kDa region of fresh extract from C. aspersum mucus [29].

2.2.3. Identification of Bioactive Compounds in the Mucus Extract Fraction with an MW > 20 kDa from C. aspersum Snails

Proteins in the fraction with an MW > 20 kDa from a mucus extract were determined after a search was performed in the UniProt database (https://www.uniprot.org, 3 March 2024) for proteins in molluscs and gastropods, as well as in published data for mucus proteins in snails with an MW corresponding to an electrophoretic analysis (Figure 5c). Based on the conducted search, it was found that the protein presented at protein band 17.565 kDa corresponded well with the mucus protein [C. aspersum, QEG59314] detected at 17.5 kDa in [26]. Detected proteins in the range 20–31 kDa probably belong to families of glutathione peroxidase (GPx) and glutathione transferases (GSTs) because several studies have confirmed the antioxidant properties (glutathione transferase activity) of C. aspersum mucus [27,28,29].
Results from the UniProt database show that the following proteins were detected in this region: glutathione peroxidases from Biomphalaria glabrata with an MW of 21.252 kDa (A0A2C9L5T6), an MW of 22.812 kDa (A0A2C9JW73), and an MW of 24.101 kDa (A0A2C9JBG3); peroxiredoxin-5 from P. canaliculata (A0A2T7NZ99, MW of 20.751 kDa); glutathione S-transferases with an MW of 27.978 kDa (from P. canaliculata, A0A2T7PWN7), with an MW of 27.599 kDa (from B. glabrata, A0A9U8DVA0), and with an MW of 27.774 kDa (from Haliotis rubra, XM_025244070.1); and probable glutathione S-transferase with an MW of 23.092 kDa (from Aplysia californica, XM_035968272.1). The proteins with an MW between 30 and 40 kDa are in good agreement with the identified proteins in [26], which suggests that some of them are lectins and are also related to the antimicrobial properties of mucus. Recently, Cerullo et al. reported a new protein class, termed conserved anterior mollusk proteins (CAMPs), detected in the mucus of C. aspersum with an MW < 40 kDa via a proteomic analysis on SDS-PAGE [34].
Some of the proteins expressed in protein bands between 48 and 59 kDa probably correspond to functional units or polypeptides of N-glycosylated C. aspersum hemocyanin resulting from proteolytic processes. The presence of different forms of hemocyanin in the mucus of land snails has been reported in several studies in recent years [23,31,32].
The protein at 84–85 kDa probably corresponded to epiphragmin, identified in the adhesive mucus secretion of H. aspersa, H. pomatia, and Cernuella virgata land snails [42,43,44,45].
The electrophoretic analysis also showed proteins with an MW above 100 kDa, which most likely represent different types of mucins, proteoglycans, and collagen, which were confirmed in recent studies on the mucus proteins of C. aspersum [34,43], A. fulica [31,32], and H. lucorum [29] land snails through integrative “omics” approach.

2.2.4. Characterization of the Mucus Fraction with an MW > 20 kDa by Tandem Mass Spectrometrical Analyses of 12% SDS-PAGE

In order to identify some of these hypothesized proteins, the protein bands from 12% SDS-PAGE were excised from the gel. After trypsin digestion, the extracted peptides were analyzed via tandem mass spectrometry and bioinformatics. The amino acid sequences (AASs) of extracted peptides from each protein band were determined by MS/MS analyses, because the identification of proteins by only a Mascot search of the experimental peptide masses of [M+H]+ did not lead to satisfactory results.
Limited proteomic information on gastropods in the NCBI database probably caused this unsuccessful protein identification. In Figure 6, the MALDI-MS/MS spectrum of peptide [M+H]+ at m/z 1670.93 extracted from the protein band at 48.75 ± 1.5 kDa is presented.
The determined amino acid sequence HGSPIGVPYWDWTR shows 100% identity (E = 2 × 10−9) with hemocyanin alpha-N from C. aspersum (AYO86684.1).
In this way, the rest of the proteins were also determined (Table 2). Most of the presented hits demonstrate identities above 60% and E-values between 1 × 10−13 and 2 (Table 2; Supplementary Materials, SIS2). It is known that the lower the E-value, the more “significant” the match is, suggesting a higher probability that the sequences share a common evolutionary origin.
The results shown in Table 2 confirm the presence of mucus protein [QEG59314, from C. aspersum]; NADH dehydrogenase subunit 6 [Albinaria caerulea]; glutathione S-transferase omega-1 [P. canaliculata]; H-type lectins, including H. aspersa agglutinin; mucus protein with an MW of 39.115 kDa [QEG59312 from C. aspersum], which is probably homologous with von Willebrand factor A domain-containing protein 3B; functional unit βC-d of C. aspersum hemocyanin; L-amino-acid oxidase-like protein (as Achacin from L. fulica); FMRFamide-activated amiloride-sensitive sodium channel; zinc finger protein; elastin-like protein; several types of collagen (collagen alpha-1, collagen α-4, and collagen alpha-6); and mucins (mucin-5AC-, mucin-5B-, mucin-2-, and mucin-17-like proteins). Most of the detected proteins can be associated with antimicrobial and antioxidant properties of this protein mucus fraction.

2.3. Antimicrobial Effect of Two Fractions Isolated from C. aspersum Mucus

The antibacterial activity of both mucus extract fractions with an MW < 20 kDa and an MW > 20 kDa from C. aspersum snails was determined against different bacterial strains via a minimum inhibitory concentration (MIC) analysis. Two strains of Gram-positive pathogenic bacterial isolates (Bacillus cereus 1085, Propionibacterium acnes 1897) and three strains of Gram-negative ones (Salmonella enterica 8691, Enterococcus faecalis 3915, and Enterococcus faecium 8754) were used as test microorganisms. The obtained results showed a different degree of effectiveness of the investigated substances.
The MIC values presented in Figure 7(a1–b2) show a higher antimicrobial potential of the fraction with an MW > 20 kDa of C. aspersum mucus compared to the fraction with an MW < 20 kDa, inhibiting at concentrations of 32–128 µg/mL more than 90% of the microbial growth of Gram-positive pathogenic bacterial isolates Bacillus cereus 1085 and Propionibacterium acnes 1897. Furthermore, the effect against Gram-positive microorganisms of the bioactive compounds in this fraction was observed even at low concentrations (2–4 µg/mL), having values higher than the IC50.
The antimicrobial activity of the mucus fraction with an MW > 20 kDa against Gram-negative bacteria—S. enterica 8691, E. faecalis 3915, and E. faecium 8754—is also well expressed. Even at concentrations of 8 µg/mL, more than 70% inhibition of bacterial growth was achieved (Figure 8a,b). An analysis of the peptide fraction with an MW < 20 kDa from C. aspersum mucus also showed the presence of a well-expressed antibacterial effect (Figure 8a). Still, the reported IC50 values were lower than those of the protein fraction with an MW > 20 kDa. They range between IC50 and IC80 against Gram-positive bacteria and have a maximum IC70 against Gram-negative strains at the highest mucus concentrations tested. The weakest effect was reported for S. enterica 8691. Interestingly, the antimicrobial activity of both investigated fractions of C. aspersum mucus is comparable to that of the antibiotic vancomycin, but only when higher concentrations are used. When peptide and protein mucus fractions are added to the culture medium in concentrations of 8 μg/mL, their effect is greatly reduced.

2.4. Studying the In Vitro and In Vivo Effects of Snail Mucus on Eukaryotic Cells

The yeast S. cerevisiae has been used as a model system for eukaryotic cell biology to assess the effect of both isolated bioactive fractions of C. aspersum mucus on eukaryotic cell metabolism. A time–kill kinetics test was performed, which revealed that the viability of mucus-treated S. cerevisiae cells was not significantly different from the not-treated ones (Figure 9).
Even at 24 h of cultivation, some growth stimulation effect has been observed, showing a 3–30% increase in the cellular biomass when snail mucus has been added to nutrient media. Moreover, the observed improvement in cell growth did not depend significantly on either the added snail mucus concentration or the bioactive fraction type–with an MW < 20 kDa or with an MW > 20 kDa.
Next, the possible cytotoxic effect of the isolated bioactive snail mucus fractions on eukaryotic cells has been studied. The S. cerevisiae cells were treated with concentrations of both fractions exceeding those used in characterizing their antibacterial activity. Then, the alternation in the levels of intracellularly generated ROS and carbonylated proteins was evaluated (Figure 10). It was revealed that in the cells treated with 256 μg/mL snail mucus with either an MW < 20 kDa or with an MW > 20 kDa, ROS generation was decreased by 29% to 38%, respectively, compared to the untreated cells (Figure 10a). Simultaneously, the intracellular levels of oxidized proteins were not significantly different between treated and untreated cells, ranging between 18.37 ± 0.98 and 19.06 ± 0.87 μmol/mg of protein (Figure 10b).
To evaluate the possible mechanism involved in the growth-stimulating and cytoprotective effect of C. aspersum snail extracts on S. cerevisiae eukaryotic cells, intracellular GSH levels and TAC were evaluated (Figure 11). It was shown that exposure to both mucus fractions with an MW < 20 kDa and an MW > 20 kDa leads to an increase in the cytoplasmic GSH level of 35% and 25%, respectively (Figure 11a). The same tendency was observed when TAC was assessed. The exposure of S. cerevisiae cells to the action of snail BACs causes an increase in the total antioxidant capacity of the cell (Figure 11b).

3. Discussion

The antibacterial active substances from natural sources are promising for obtaining a new type of antimicrobial agent with reduced or even absent toxicity for humans, but highly effective against pathogenic microorganisms [20]. Most gastropods have high potential as sources of antimicrobial peptides and proteins. Several studies have demonstrated the presence of highly effective peptides and proteins in the mucus of terrestrial snails [21,22,23,24,25,26,32], as well as freshwater [43,46] and marine snails [19,20,47]. The mucus secretions of snails and slugs play a pivotal role in the survival of these organisms in interaction with the environment. It is crucial to continue identifying the natural antimicrobial potential of snail mucus because the rise in drug-resistant bacterial species continues to develop. To date, there are still few studies on the antimicrobial properties of the mucus of terrestrial molluscs, and most of them have focused on the land snail A. fulica [26].
The data obtained in the present study showed a strong antibacterial effect of the two mucus extract fractions from C. aspersum snails against two Gram-positive pathogenic bacterial stains (B. cereus 1085 and P. acnes 1897) and three strains of Gram-negative ones (S. enterica 8691, E. faecalis 3915, and E. faecium 8754). The results of the in vitro study showed that high concentrations (128 μg/mL and 64 μg/mL) of both fractions with an MW < 20 kDa and an MW > 20 kDa from the native mucus extract exhibited antimicrobial activity against tested pathogenic bacterial strains comparable to antibiotic VCM.
The obtained data are in accordance with the results of other studies, which prove the presence of specific oligo- and polypeptides with antibacterial action in the mucus of land snails [21,22,23,25,26,39]. Our previous studies demonstrate that the fraction with an MW < 20 kDa shows strong antibacterial activity against P. aureofaciens AP9 in deep inoculation of the bacterium, while the fraction with an MW between 10 and 30 kDa exhibits the highest antibacterial activity using surface inoculation of the bacterial strain E. coli NBIMCC 8785 [21]. The mucus extract fraction with an MW > 20 kDa was also found to be most effective against the bacterial strain C. perfringens in deep anaerobic cultivation [21]. The observed differences in the antimicrobial activities against the tested pathogens are due to the difference in the active components of the two fractions.
The characterization of both fractions from the native mucus extract showed that their antimicrobial properties are due to different biocomponents, mainly antimicrobial peptides and polypeptides in the fraction with an MW < 20 kDa and proteins as well as glycoproteins with potential antibacterial properties in the fraction with an MW > 20 kDa.
The peptide fraction with an MW < 20 kDa from C. aspersum mucus contains mostly various peptides < 3 kD with antimicrobial and antioxidant properties, as well as some metabolites such as amino acids, allantoin, glycolic acid, γGSH, and others [48]. In the current study, 16 newly antimicrobial peptides (shown in Table 1) were identified, as were several peptides with higher molecular weights between 3 and 10 kDa and some proteins detected as [M+H]+ at m/z between 10 and 20 kDa. The identified peptides (Table 1) contain high levels of glycine, leucine, valine, and proline amino acid residues, as well as the presence of tryptophan, aspartic acid, phenylalanine, and arginine, which are associated with their antimicrobial activity and antioxidant properties. An amino acid sequence alignment comparison of C. aspersum mucus peptides by CAMPSing software (http://www.campsign.bicnirrh.res.in/, accessed on 24 March 2024) revealed high identity (more than 70%) with known AMPs (SIS1). The structural characteristics of the peptides with the highest prognostic antibacterial and antifungal activity (nos. 17, 18, 21, 22, and 23, Table 1) show high levels of glycine, leucine, valine, and proline residues, indicating that they belong to a new class of antimicrobial peptides, rich in Gly and Gly/Leu, which demonstrate broad-spectrum antibacterial activity [49].
Previous studies have also shown that the presence of peptides with similar amino acid sequences revealed homology with mostly leptoglycin, acanthoscurrin, and ctenidin [21,38,39,40]. In addition, most peptides with high predictive therapeutic values are cationic and/or neutral (with one or two positively charged residues that are neutralized with negatively charged ones). Most of the identified peptides (Table 1) are hydrophobic, which is a known prerequisite for their antimicrobial activity because hydrophobicity not only modulates the peptide–membrane interaction but also affects cellular selectivity and is positively correlated with cytotoxic activity [46,50]. AMPs are known to kill microbes through mechanisms that primarily involve interactions between the charged amino acid residues of the peptide and components of the bacterial membranes. There are several mechanism models with which to explain the actions of these peptides, including the toroidal pore model, the barrel model, and membrane interaction according to the Shai–Huang–Matsazuki carpet model [50,51,52,53]. These interactions can lead to a number of effects, including membrane permeabilization, depolarization, leakage, or lysis, leading to cell death.
In a fraction with an MW < 20 kDa, some peptides with higher molecular masses between 10 and 20 kDa were also identified. They probably contribute to the antibacterial activity against the tested bacterial pathogens, because they are in accordance with known proteins and glycoproteins with antibacterial activity in the snail mucus of C. aspersum [26,35], Helix pomatia [36], and A. fulica [37]. For example, the polypeptide determined at 12.464 kDa (Figure 2) is probably a lectin previously found in a study by Pietrzyk et al., in the mucus of C. aspersum [35]. A similar protein with biological activity against Streptococcus mutans and Aggregatibacter actinomycetemcomitans was also found in A. fulica mucus with 11.45 kDa in [54]. The protein detected by us at m/z 18.005 kDa in a fraction with an MW < 20 kDa using a MALDI-MS analysis (Figure 2) probably corresponds to the anti-Pseudomonas aeruginosa protein (MW of 17.5 kDa) described in a study by Pitt et al. (2019) [26].
Several studies have shown that mucus from C. aspersum snails also demonstrates antimicrobial activity due to one or more proteins with molecular masses between 30 and 100 kDa [21,22,26,54]. Based on the results of the electrophoretic analysis and proteomic analysis on SDS-PAGE of a mucus fraction with an MW > 20 kDa, high homology was found with some proteins and glycoproteins (N-glycosylated proteins, lectins, and mucins) with potential antibacterial activity. Surprisingly, a protein at 17.5 kDa was detected upon an SDS-PAGE analysis of the fraction with an MW > 20 kDa. The alignment of AASs obtained by MALDI-TOF-MS/MS showed homology to mucus protein from C. aspersum snails (ID QEG59314.1), identified by Pitt et al., as a lectin with potential antimicrobial activity against strains of Ps. aeruginosa. Some lectins have pathogen-recognition receptor properties, which may contribute to their antimicrobial activity. Natural lectins have powerful antibacterial properties because they bind to carbohydrates on microbial surfaces [55].
The results of the proteomic analysis show that peptides extracted from the protein band at 26 kDa are homologous on H-type lectin from B. glabrata and agglutinin from H. aspersa (HAA) as well as H. pomatia (HPA), which also play a role in the defense of the snail against pathogens. H-type lectins represent a new group of lectins that have been identified in invertebrates. In snails, H-type lectins (e.g., HPA, HAA) protect fertilized eggs from bacteria because they are secreted by snail protein glands as a component of the perivitelline fluid [56,57]. Lectins are involved in many biological processes, including cell recognition, viral and bacterial pathogenesis, and inflammation [56]. Some studies have shown that high-molecular-weight lectin isolated from the mucus of the giant African snail A. fulica induces agglutination of Gram-positive and Gram-negative bacteria, although it does not inhibit bacterial growth [58]. In addition, H-type lectins recognize glycans present in the cell wall of pathogenic bacteria; for example, group C Streptococcus sp. Agglutinins are glycoproteins in nature and play a fundamental role in the innate immune responses in invertebrates [59].
The AASs of several peptides extracted from the protein band at 39.115 kDa (Table 2) show high homology with antibacterial mucus protein with an MW of ~37.5 kDa (QEG59312.1, C. aspersum, named “Aspernin”), active against different strains of Ps. aeruginosa [26]. According to Pitt et al., the protein “Aspernin”, which is probably glycosylated, shares homology with proteins in another species of snail—Biomphalaria glabrata—such as H-type lectin domain-containing protein [26]. Our results also showed that some peptides derived from this protein band matched domains of the von Willebrand factor A superfamily. The proteins with an MW between 30 and 40 kDa found in the fraction with an MW > 20 kDa are in full agreement with the recently detected proteins by Pitt et al., which suggests that these proteins are lectins and are also related to the antimicrobial properties of the mucus [26].
Another identified protein in the mucus fraction with an MW > 20 kDa with antibacterial activity is hemocyanin. Our results (presented in Figure 5 and Table 2) revealed that the intensive band in the range of 48.75 ± 1.5 kDa to 97.0 ± 1 kDa is composed of proteins demonstrating high homology with hemocyanin functional units and subunits. The high protein expression of different forms of hemocyanin can explain observed antibacterial activity against tested bacterial pathogens (Figure 8(b1,b2) and Figure 9(b1–b3)). Previous studies have also demonstrated that molluscan hemocyanin possesses antibiotic activity [60,61,62], which supports our hypothesis. Interest in hemocyanin as a bioactive molecule against pathogenic microorganisms is relatively recent [60,63,64]. Information about the antibiofilm and antiviral activity of hemocyanin from land snails is still very scarce [23]. Moreover, hemocyanin-derived polypeptides (detected at 40, 60, and 80 kDa) with possible antimicrobial properties were previously reported by Suárez et al. (2021) [23]. Furthermore, Dolashka et al. (2016) reported the antimicrobial activity of the βc-HaH structural subunit of H. aspersa (also named C. aspersum), which demonstrated strong selective antimicrobial activity against S. aureus, Streptococcus epidermidis, and Escherichia coli, while Ps. aeruginosa and E. faecium developed unconditionally with its presence [18]. Therefore, the observed antibacterial activity of fractions with an MW > 20 kDa against B. cereus 1085, P. acnes 1897, S. enterica 8691, E. faecalis 3915, and E. faecium 8754 cannot be fully explained only by the identification of hemocyanin.
In addition, on the protein band at 52.89 ± 1.0 kDa, another protein was found to be homological with the C. aspersum mucus protein (QEG59312.1) and an unnamed protein from Candidula unifasciata snails (CAG5131631.1 and CAG5131621.1). This protein is likely related to the antimicrobial activity of the fraction with an MW > 20 kDa. The study by Pitt et al. [26] also mentioned a glycoprotein with an MW at ~50 kDa with potential antimicrobial activity against Ps. aeruginosa. Furthermore, we found that the protein detected at the range 56.94–59.04 kDa shared homology with proteins with L-amino acid oxidase activity, such as achacin, which is established as an antibacterial N-glycosylated protein in the mucus of L. fulica and A. fulica snails. Several studies have associated the broad spectrum of the antimicrobial properties of the mucus of the giant African snail A. fulica against Gram-positive bacteria (Bacillus subtilis and Staphylococcus aureus) and Gram-negative strains (Escherichia coli and Ps. aeruginosa) mainly with the presence of achacin.
In another study [23] it was shown that the activity against the biofilm-forming bacteria S. aureus was found to be mainly due to the action of two glycoproteins—hemocyanin and “achacin”, as well as their fragments resulting from proteolysis processes. Indeed, N-glycosylated achacin, in addition to inhibiting bacterial growth, also appears to attack bacterial plasma membranes [33]. It was found that the antibacterial activity of achacin depends on the production of H2O2, which is obtained from the oxidative deamination reaction. These data indicate that achacin can also attack pathogens during other growth phases by increasing the local H2O2 concentration to not harm neighboring host cells [32,65].
Extracellular matrix proteins constitute 40–50% of the mucus proteins of C. aspersum [30]. Our results have proven the presence of homologous proteins on mucin-5AC-, mucin-5B-, mucin-2-, and mucin-17-like proteins, as well as collagens. Mucins, included in snail mucus, can play roles for several biological functions, including adhesion, lubrication, and microbial protection [66,67]. Mucins are among the largest macromolecules, characterized by a protein core and branching glycan chain. The structural diversity of mucins allows for their extensive biological diversity and unique physical characteristics. A tandem repeat domain located in the center of the protein backbone, rich in serine, threonine, and proline, serves as an anchor for glycosylation. Mucin glycans are predominantly O-linked, but minor amounts of N-linked glycans can also be present [66,68]. It appears that mucins, which are an important component of snail mucus, play an important role as the first line of defense against bacterial infections; however, how the glycoprotein mucin—which makes up the mucus—interacts with the bacteria is still not fully understood [69]. For example, the MUC2 mucin established in the mucus fraction, but also found in the human colon, is capable of aggregating Gram-protein bacteria such as Bacillus subtilis and E. faecalis by binding to the peptidoglycan present in the cell wall, thereby inhibiting epithelial cell penetration. Furthermore, both mucins MUC5AC and MUC5B have been shown to inhibit up to 85% of the Pseudomonas aeruginosa isolated from the sputum of patients with a chronic infection [69]. The antimicrobial potentials of mucus mucins from different species of giant African land snails on some typed culture pathogenic bacteria were studied by Okeniyi et al. (2022) [70]. It was found that the snail mucus extract had antimicrobial effects on Gram-positive and Gram-negative bacteria, but mucus mucins seem to lose their antibacterial potential with time [70]. A. marginata’s mucus secretions had stronger antibacterial activity against B. subtilis when compared to mucus from A. achatina and A. fulica [24].
Several studies show that polysaccharides such as glycosaminoglycans (GAGs) were also found in the mucus of land snails [30,31,71,72,73]. Deng et al. (2023) showed that sulfated glycosaminoglycan in the mucus of A. fulica and H. lucorum effectively promoted chronic wound healing in a diabetic rat model by improving skin incision adhesion as well as accelerating granulation tissue regeneration, angiogenesis, and collagen deposition [31]. Recently, Kodchakorn et al. (2023) reported that heparin-like sulfated glycosaminoglycan (named acharan sulfate) found in the mucus of A. fulica has promising potential for the preparation of sulfated polysaccharides as an alternative to heparin and shows antiviral properties [71]; however, there is still no information about the antibacterial action of the mucus glycosaminoglycans.
We hypothesize that the synergy between the bioactive components, their composition determined mainly by proteins and glycoproteins, such as a mucus protein named aspernin, N-glycosylated C. aspersum hemocyanin, lectins, L-amino acid oxidase-like protein, and mucins, is responsible for the high antibacterial effect of the mucus fraction > 20 kDa compared to vancomycin against tested bacterial pathogens.
Moreover, the performed study demonstrates that both isolated fractions from the mucus extract of C. aspersum with an MW < 20 kD and an MW > 20 kDa are not cytotoxic to tested eukaryotic cells of S. cerevisiae, but are characterized by growth-promoting potential. Bearing in mind that microorganisms and various Mollusca frequently form symbiotic relationships that are crucial to the ecology and evolution of species [74], it could be suggested that mucus from C. aspersum is used by S. cerevisiae as a supplementary substrate for its growth. Adding both mucus fractions to the nutrient media further leads to a substantial reduction in ROS levels. ROS generated during cell growth are involved in the roughly 60 distinct pathways that lead to protein oxidation, which includes carbonylation causing an unbalanced cellular proteome and malfunctions [75]. The obtained results suggested that C. aspersum mucus possesses ROS scavenging properties, which automatically reflect their ability to reduce the level of carbonylated proteins in eukaryotic organisms while combating pathogenic bacterial strains. Thus, the two isolated bioactive fractions from C. aspersum can not only be used effectively to treat antibiotic-resistant pathogens, but their administration also has additional beneficial effects related to the reduction in oxidative stress in a host organism’s cells. In fact, other authors confirmed the radical scavenging activity of snail mucus, showing that P. canaliculata and L. fulica mucus have pro-oxidant capacity [76]. Furthermore, the same authors observed that L. fulica mucus exhibited higher antioxidant capacity, similar to those we found for the C. aspersum low- and high-molecular-weight mucus fractions. According to Wang et al. (2010) [77], low-molecular-weight components found in snail mucus, including uronic acid, phenolic compounds, vitamins C and E, and uric acid, determine their antioxidant qualities.
The specific characteristics of the many mucus peptides, such as their hydrophobicity, molecular mass, and AASs, are also related to their antioxidant capacity [78]. The determined composition of the fraction with an MW > 20 kDa is consistent with its antioxidant and cytoprotective properties, which are probably due to the complex synergistic actions of the specific compounds found in it. Several studies in recent years have also confirmed the antioxidant properties of C. aspersum mucus [27,28,29].

4. Materials and Methods

4.1. Preparation of Mucus Extract

The mucus was collected from C. aspersa snails, grown on Bulgarian eco-farms by patented technology without disturbing their biological functions [21,79]. The method for collecting native extracts from garden snails based on electrical stimulation with a low voltage was used and can be used repeatedly to extract mucus. Thus, obtained crude mucus extracts were homogenized and centrifugated to remove coarse impurities. The supernatant was subjected to several cycles of filtration, using filters of decreasing pore size for each subsequent filtration. The protein concentration in the native mucus extract was determined by a Bradford assay [80]. The obtained crude mucus extract was divided into two fractions by ultrafiltration, using membranes with pore sizes of 20 kDa (polyethersulfone, Microdyn Nadir™ from STERLITECH Corporation, Go-leta, CA, USA, respectively): a peptide fraction with an MW below 20 kDa and a fraction containing compounds with an MW above 20 kDa.
The peptide fraction with an MW < 20 kDa was additionally separated into three fractions using Amicon® Ultra-15 centrifugal tube filters with 3 and 10 kDa membranes. Finally, the following samples were obtained: sample 1—a fraction with compounds with an MW < 3 kDa; sample 2—a fraction with compounds with an MW of 3–10 kDa; and sample 3—a fraction with compounds with an MW of 10–200 kDa.
The use of a noninvasive technique—ultrafiltration—ensured that we obtained fractions containing intact compounds.

4.2. HPLC Purification of Peptides from the Fraction below 20 kDa

Reverse-phase high-performance liquid chromatography (RP-HPLC) on a ZURA® HPLC system (KNAUER, Berlin, Germany) was used to purify the mucus fraction with an MW below 20 kDa after lyophilization on a BioSill C18 HL 90–10 column (250 mm × 10 mm, Bio-Rad Life Science Group, 1000 Alfred Nobel Drive, Hercules, CA 94547, USA) equilibrated with 0.1% trifluoroacetic acid (TFA, v/v) (solution A). Elution was performed by a gradient of water–acetonitrile formed by solution A (0.1% TFA/water) and solution B (100% acetonitrile in 0.1% TFA (v/v)) at a flow rate of 1.0 mL/min, for 70 min, as follows: to 10 min., A 100%; 11–20 min, A 90%; 21–50 min, A 40%; 51–60 min, A 0%; 61–63 min, A 0%; and 64–70 min, A 100%. Ultraviolet absorption was monitored at 216 nm.
The eluted fractions were collected and dried via vacuum concentration with a Speed-110 vac. The fractions were reconstituted in Milli Q water containing 0.10% TFA (v/v).

4.3. Molecular Mass Analysis and De Novo Sequencing of Peptides by Mass Spectrometry

The isolated peptide fraction with an MW < 3 kDa (sample 1) was lyophilized and analyzed via MALDI-TOF-TOF mass spectrometry on an AutoflexTM III High-Performance MALDI-TOF and TOF/TOF System (Bruker Daltonics, Bremen, Germany), which uses a 200 Hz frequency-tripled Nd–YAG laser operating at a wavelength of 355 nm. An analysis was carried out after mixing 2.0 μL of the sample with 2.0 μL of matrix solution (7 mg/mL of α-cyano-4-hydroxycinnamic acid (CHCA) in 50% ACN containing 0.1% TFA), but only 1.0 μL of the mixture was spotted on a stainless steel 192-well target plate. The samples were allowed to dry at room temperature before being analyzed. A total of 3500 shots were acquired in the MS mode, and a collision energy of 4200 was applied. A mixture of angiotensin I, Glu-1-fibrinopeptide B, ACTH (1–17), and ACTH was used for the calibration of the mass spectrometer.
The MS/MS spectra were carried out in reflector mode with external calibration using fragments of Glu-fibrino-peptide B. The amino acid sequences of peptides were identified via precursor ion fragmentation using MALDI-MS/MS analysis.

4.4. Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)

The eluted intravenous immunoglobulins were analyzed by one-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis (1D-SDS-PAGE) using 5% stacking gel and 12% resolving gel, according to the Laemmli method with modifications [81]. The samples were dissolved in a Laemmli sample buffer containing 10 mM DTT as the reducing agent. A staining Coomassie Brilliant Blue G-250 buffer was used for the visualization of proteins on the gel, as was a protein standard marker–mixture of proteins with molecular weights from 6.5 kDa to 200 kDa (SigmaMarkerTM, Sigma-Aldrich, Saint Louis, MO, USA).

4.5. Image Analysis of 10% SDS-PAGE by ImageQuant™ TL v8.2.0 Software

The obtained polyacrylamide gel (PAG) was captured on an Image Scanner III (GE Healthcare), and the image was opened within the ‘1D gel analysis’ utility of ImageQuant TL v8.2 software (GE Healthcare Bio-Sciences AB, Uppsala, Sweden), which is highly automated and easy-to-use image analysis software. The background was performed through the “image rectangle” setting to compensate for the intensity of the image background. All bands were identified manually, including those in the standard protein marker, with a pen tool, as the bandwidth was fixed at 54 pixels.
The molecular weight analysis of each band was performed using the protein data standard SigmaMarkerTM (Sigma-Aldrich, Saint Louis, MO, USA) in the range of 6500–200,000 Da. Automatically, horizontal bands were drawn to the individual bands of the MW marker and calculated with the cubic curve spline.
Based on the precalculated amount of bands at the marker, the amount of bands tested is determined [82].

4.6. Tryptic In-Gel Digestion and Peptide Extraction

Protease digestion was run according to the work of Rosenfeld et al. with a slight modification [20]. The target protein bands excised from the SDS-PAGE gels were washed twice with a 150 µL mixture of 50% acetonitrile (ACN) and 200 mM NH4HCO3 each for 20 min at 30 °C to decolorize, as described previously in [83]. The digestion of proteins in gel was carried out with porcine trypsin (Promega, Madison, WI, USA). After drying the decolorized gels in a speed vac concentrator, a volume of 10 μL of digestion buffer (50 mM ammonium bicarbonate, pH 7.8, containing modified trypsin) was added to them, and the Eppendorf tubes were kept on ice for 45 min to allow the gel pieces to be completely soaked with the protease solution.
Digestion was performed overnight at 37 °C, the supernatants were recovered, and the resulting peptides were extracted twice with 35 μL of 60% ACN/0.1% HCOOH. The extracts were pooled and dried in the speed vac concentrator.

4.7. Antibacterial Activity Assay

The antibacterial activity of the two bioactive fractions from C. aspersum was tested against 2 Gram-positive and 3 Gram-negative pathogenic bacteria, listed below. The bacterial strains Bacillus cereus NBIMCC 1085, Propionibacterium acnes DSM 1897, Salmonella enterica NBIMCC 8691, Enterococcus faecalis NBIMCC 3915, and Enterococcus faecium NBIMMCC 8754 were obtained from the National Bank for Industrial Microorganisms and Cell Cultures (Sofia, Bulgaria). It has been determined according to the procedure for the minimum inhibitory concentrations (MICs) using the broth microdilution method according to Clinical Laboratory and Standards (CLSI) guidelines [84]. Briefly, the bacterial suspension cultured to the logarithmic phase was diluted to a 0.5 McFarland standard (approximately 1.5 × 108 CFU/mL) and then diluted 150 times to 1 × 106 CFU/mL using nutrient media. A 50 μL volume of undiluted and serial twofold dilutions of BACs with Mueller Hinton Broth (and Brain Heart Infusion Broth for P. acnes) was dispensed in 96-well microtiter plates. Subsequently, an equal volume of adjusted inoculum (1 × 106 CFU/mL) was added to each well of the microtiter plates up to a final volume of 100 μL. The nutrient media with a bacterial culture without bioactive fractions were used as a negative control, and in the positive control bioactive fractions were replaced by the glycopeptide antibiotic vancomycin (VCM) (stock solution 40 mg/mL). The MIC value is accepted as the lowest concentration of snail BACs at which bacterial growth is completely inhibited.
Bacteria StrainCausative Agents
Bacillus cereus NBIMCC 1085Foodborne disease
Propionibacterium acnes DSM 1897Skin condition of acne, chronic endophthalmitis, corneal ulcers, sarcoidosis, etc.
Salmonella enterica NBIMCC 8691Salmonellosis
Enterococcus faecalis NBIMCC 3915Endocarditis, sepsis, urinary tract infections (UTIs), meningitis, etc.
Enterococcus faecium NBIMMCC 8754Bloodstream infections, urinary tract infections (UTIs), and wound infections associated with catheters or surgery are the most common infections

4.8. In Vivo and In Vitro Effect on Eukaryotic Cell

The effect of both isolated fractions from the mucus of C. aspersum on eukaryotic cells was evaluated using Saccharomyces cerevisiae as a model organism.

4.8.1. Cell Treatment and Viability Assay

Saccharomyces cerevisiae NBIMCC 584 was obtained from the National Bank for Industrial Microorganisms and Cell Cultures (Sofia, Bulgaria). The cells were cultured in a standard YPD medium containing 2% glucose, 1% yeast extract, and 1% peptone (pH 6.5) at 30 °C. A time–kill kinetics test was performed, adding various concentrations of mucus fractions with an MW < 20 kDa and with an MW > 20 kDa to the growth media (0, 64, 128, and 256 μg/mL). Yeast growth was quantified after incubation for 0, 3, 6, 12, and 24 h. Absorbance was measured at 600 nm using a microplate reader.
For in vitro experiments, 1 g of S. cerevisiae biomass was treated with both mucus fractions at a final concentration of 256 μg/mL for 1 h at 25 °C, washed twice with distilled water and subjected to mechanical disruption according to the procedure described by [85]. Obtained cell-free extracts were further used for biochemical analysis.

4.8.2. Measurement of the Mucus Cytotoxic Effect

The cytotoxic effects of the two mucus extracts were evaluated by measuring the alternations in the intracellular levels of ROS and carbonylated proteins. The generation of ROS in the S. cerevisiae cells was examined using the nitroblue tetrazolium test (NBT) method described by Kostova et al. (2008) [86]. The levels of oxidized proteins were assessed following the procedure of Mesquita et al. (2014) [87].

4.8.3. Determination of Cytoprotective Effect

The reduced glutathione (GSH) levels in the cells were measured using Zhang’s method (2000) [88]. The total antioxidant capacity (TAC) has been evaluated using Kumaran and Karunakaran’s (2006) phosphomolybdenum method [89].

5. Conclusions

In summary, the study reveals, for the first time, promising antibacterial potential against various pathogenic bacterial strains of both fractions from C. aspersa mucus. The fraction with an MW > 20 kDa showed higher antimicrobial activity against B. cereus 1085, P. acnes 1897, S. enterica 8691, E. faecalis 3915, and E. faecium 8754 compared to vancomycin. Furthermore, both mucus fractions demonstrated noncytotoxic effects on model eukaryotic cells of S. cerevisiae. In addition, a positive effect by reducing the levels of intracellular oxidative damage and increasing the antioxidant capacity on S. cerevisiae cells were found for both mucus extract fractions of C. aspersum. The study showed 16 novel peptides with an MW between 1000–2900 Da identified by de novo sequencing in the mucus fraction with an MW < 20 kDa, with potential antibacterial activity. Some proteins and glycoproteins identified via a proteomic analysis with SDS-PAGE and bioinformatics are responsible for the antibacterial effect of the mucus fraction with an MW > 20 kDa. The results showed high homology with an antibacterial protein named aspernin, H-type lectins, N-glycosylated C. aspersum hemocyanin, L-amino acid oxidase-like protein, mucins (mucin-5AC-, mucin-5B-, mucin-2-, and mucin-17-like proteins), and glutathione S-transferase as well as NADH dehydrogenase.
Further studies are needed to reveal the antibacterial potential of both mucus fractions as new alternative therapeutics with a low risk for antimicrobial resistance.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/molecules29122886/s1, Supplementary Information S1 (SIS1): An alignment of amino acid sequences of some identified peptides from C. aspersum mucus with known antimicrobial peptides with database AMPs by CAMPSing, Matrix: BLOSUM 80 (http://www.campsign.bicnirrh.res.in/blast.php, accessed on 24 March 2024) and with proteins by BLAST (https://blast.ncbi.nlm.nih.gov, accessed on 24 March 2024); Supplementary Information S2 (SIS2): An alignment of amino acid sequences of some identified peptides from protein bands of the mucus fraction with an MW > 20 kDa with known proteins in Gastropoda (taxid: 6448), land snails (taxid: 6527), and Mollusca (taxid: 6447) with database nonredundant protein sequences (nr) and UniProtKB/Swiss-Prot, sequences algorithm blastp (protein–protein BLAST), filtered to match records with percent identity between 50% and 100% (https://blast.ncbi.nlm.nih.gov/Blast.cgi, accessed on 12 April 2024).

Author Contributions

Conceptualization, P.D. and L.V.; methodology, P.D., V.P. and L.V.; investigation, A.D., P.D., L.V., V.P., E.P., M.T. and M.K.; software, L.V., A.D, V.P. and D.K.; validation, L.V. and V.P.; resources, P.D. and A.D.; data curation V.P., E.P., M.T., M.K. and D.K.; writing—original draft preparation, L.V., V.P. and P.D.; writing—review and editing, L.V. and P.D.; visualization, L.V., A.D., V.P., E.P. and P.D. All authors have read and agreed to the published version of the manuscript.

Funding

This research was carried out with the support of project KP-06 PN61-8/2022, funded by the Bulgarian National Science Fund.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data are contained within the article and Supplementary Material.

Acknowledgments

Project BG05M2OP001-1.002-0019: “Clean Technologies for Sustainable Environment—Waters, Waste, Energy for a Circular Economy”.

Conflicts of Interest

The authors, including Maria Todorova, declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest. The funders had no role in the design of the study; in the collection, analysis, or interpretation of the data; in the writing of the manuscript; or in the decision to publish the results. This manuscript used the BG Utility model: Dolashka, P.; Atanasov, D. Device for Collecting Ex-tracts from Garden Snail. BG Utility model Application number 2656, 8 November 2013; Patent number 2097, 31 August 2015. Available online: https://portal.bpo.bg/bpo_online/-/bpo/utility-model-detail. (Accessed on 19 May 2024). P. Dolashka is both the inventor and the patent owner, but she is also a corresponding author in this article, so there is no conflict of interest.

References

  1. Garvey, M. Antimicrobial Peptides Demonstrate Activity against Resistant Bacterial Pathogens. Infect. Dis. Rep. 2023, 15, 454–469. [Google Scholar] [CrossRef] [Scilit]
  2. Hernando-Amado, S.; Coque, T.M.; Baquero, F.; Martínez, J.L. Antibiotic Resistance: Moving From Individual Health Norms to Social Norms in One Health and Global Health. Front. Microbiol. 2020, 11, 1914. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Final Report DRUG-RESISTANT INFECTIONS a Threat to Our Economic Future, March 2017; Jonas and World Bank Group Team: Washington, DC, USA, 2017; Available online: https://documents1.worldbank.org/curated/en/323311493396993758/pdf/final-report.pdf (accessed on 25 May 2024).
  4. Walsh, T.R.; Gales, A.C.; Laxminarayan, R.; Dodd, P.C. Antimicrobial Resistance: Addressing a Global Threat to Humanity. PLoS Med. 2023, 20, e1004264. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef] [Scilit]
  6. Orlek, A.; Anjum, M.F.; Mather, A.E.; Stoesser, N.; Walker, A.S. Factors associated with plasmid antibiotic resistance gene carriage revealed using large-scale multivariable analysis. Sci. Rep. 2023, 13, 2500. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Akram, F.; Imtiaz, M.; ul Haq, I. Emergent crisis of antibiotic resistance: A silent pandemic threat to 21st century. Microb. Pathog. 2023, 174, 105923. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Zhang, L.; Gallo, R.L. Antimicrobial peptides. Curr. Biol. 2016, 26, R14–R19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Mwangi, J.; Hao, X.; Lai, R.; Zhang, Z.Y. Antimicrobial peptides: New hope in the war against multidrug resistance. Zool. Res. 2019, 40, 488–505. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  10. Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial peptides: Promising alternatives in the post feeding antibiotic era. Med. Res. Rev. 2019, 39, 831–859. [Google Scholar] [CrossRef] [Scilit]
  11. Zhang, Q.Y.; Yan, Z.B.; Meng, Y.M.; Hong, X.Y.; Shao, G.; Ma, J.J.; Cheng, X.R.; Liu, J.; Kang, J.; Fu, C.Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [Scilit]
  12. Lee, T.H.; Hall, K.N.; Aguilar, M.I. Antimicrobial peptide structure and mechanism of action: A focus on the role of membrane structure. Curr. Top. Med. Chem. 2016, 16, 25–39. [Google Scholar] [CrossRef] [Scilit]
  13. Dennison, S.R.; Morton, L.H.; Harris, F.; Phoenix, D.A. Low pH enhances the action of maximin H5 against Staphylococcus aureus and helps mediate lysylated phosphatidylglycerol-induced resistance. Biochemistry 2016, 55, 3735–3751. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Bahar, A.A.; Ren, D. Antimicrobial peptides. Pharmaceuticals 2013, 6, 1543–1575. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Wang, L.; Qiu, L.; Zhou, Z.; Song, L. Research progress on the mollusc immunity in China. Dev. Comp. Immunol. 2013, 39, 2–10. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Li, H.; Parisi, M.G.; Parrinello, N.; Cammarata, M.; Roch, P. Molluscan antimicrobial peptides, a review from activity-based evidences to computer-assisted sequences. Invertebr. Surviv. J. 2011, 8, 85–97. [Google Scholar]
  17. Smith, V.J.; Desbois, A.P.; Dyrynda, E.A. Conventional and unconventional antimicrobials from fish, marine invertebrates and micro-algae. Mar. Drugs 2010, 8, 1213–1262. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Dolashka, P.; Dolashki, A.; Velkova, L.; Stevanovic, S.; Molin, L.; Traldi, P.; Velikova, R.; Voelter, W. Bioactive compounds isolated from garden Snails. J. BioSci. Biotechnol. 2015, 147–155. Available online: https://www.academia.edu/33473025/Bioactive_compounds_isolated_from_garden_snails (accessed on 19 May 2024).
  19. Dolashka, P.; Dolashki, A.; Van Beeumen, J.; Floetenmeyer, M.; Velkova, L.; Stevanovic, S.; Voelter, W. Antimicrobial Activity of Molluscan Hemocyanins from Helix and Rapana Snails. Curr. Pharm. Biotechnol. 2016, 17, 263–270. [Google Scholar] [CrossRef] [Scilit]
  20. Kirilova, M.; Topalova, Y.; Velkova, L.; Dolashki, A.; Kaynarov, D.; Daskalova, E.; Zheleva, N. Antibacterial Action of Protein Fraction Isolated from Rapana venosa Hemolymph against Escherichia coli NBIMCC 8785. Pharmaceuticals 2024, 17, 68. [Google Scholar] [CrossRef] [Scilit]
  21. Dolashki, A.; Velkova, L.; Daskalova, E.; Zheleva, N.; Topalova, Y.; Atanasov, V.; Voelter, W.; Dolashka, P. Antimicrobial Activities of Different Fractions from Mucus of the Garden Snail Cornu aspersum. Biomedicines 2020, 8, 315. [Google Scholar] [CrossRef] [Scilit]
  22. Pitt, S.; Graham, M.A.; Dedi, C.G.; Taylor-Harris, P.M.; Gunn, A. Antimicrobial properties of mucus from the brown garden snail Helix aspersa. Br. J. Biomed. Sci. 2015, 72, 174–181. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Suárez, L.; Pereira, A.; Hidalgo, W.; Uribe, N. Antibacterial, Antibiofilm and Anti-Virulence Activity of Biactive Fractions from Mucus Secretion of Giant African Snail Achatina fulica against Staphylococcus aureus Strains. Antibiotics 2021, 10, 1548. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Etim, L.B.; Aleruchi, C.; Obande, G.A. Antibacterial Properties of Snail Mucus on Bacteria Isolated from Patients with Wound Infection. Br. Microbiol. Res. J. 2016, 11, 1–9. [Google Scholar] [CrossRef] [Scilit]
  25. Santana, W.; Melo, C.; Cardoso, J.; Pereira-Filho, R.; Rabelo, A.; Reis, F.; Albuquerque, R.L.C. Assessment of antimicrobial activity and healing potential of mucous secretion of Achatina fulica. Int. J. Morphol. 2012, 30, 365–373. [Google Scholar] [CrossRef] [Scilit]
  26. Pitt, S.J.; Hawthorne, J.A.; Garcia-Maya, M.; Alexandrovich, A.; Symonds, R.C.; Gunn, A. Identification and characterisation of anti-Pseudomonas aeruginosa proteins in mucus of the brown garden snail, Cornu aspersum. Br. J. Biomed. Sci. 2019, 76, 129–136. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Brieva, A.; Philips, N.; Tejedor, R.; Guerrero, A.; Pivel, J.P.; Alonso-Lebrero, J.L.; Gonzalez, S. Molecular basis for the regenerative properties of a secretion of the mollusk Cryptomphalus aspersa. Ski. Pharmacol. Physiol. 2008, 21, 15–22. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  28. Kostadinova, N.; Voynikov, Y.; Dolashki, A.; Krumova, E.; Abrashev, R.; Kowalewski, D.; Stevanovic, S.; Velkova, L.; Velikova, R.; Dolashka, P. Antioxidative screening of fractions from the mucus of garden snail Cornu aspersum. Bulg. Chem. Commun. 2018, 50C, 176–183. [Google Scholar]
  29. Petrov, L.; Kachaunov, M.; Alexandrova, A.; Tsvetanova, E.; Georgieva, A.; Dolashki, A.; Velkova, L.; Dolashka, P. Snail Mucus Protective Effect on Ethanol-Induced Gastric Ulcers in Mice. Life 2022, 12, 1106. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Zhu, K.; Zhang, Z.; Li, G.; Sun, J.; Gu, T.; Ain, N.U.; Zhang, X.; Li, D. Extraction, structure, pharmacological activities and applications of polysaccharides and proteins isolated from snail mucus. Int. J. Biol. Macromol. 2024, 258 Pt 1, 128878. [Google Scholar] [CrossRef] [Scilit]
  31. Deng, T.; Gao, D.; Song, X.; Zhou, Z.; Zhou, L.; Tao, M.; Jiang, Z.; Yang, L.; Luo, L.; Zhou, A.; et al. A natural biological adhesive from snail mucus for wound repair. Nat. Commun. 2023, 14, 396. [Google Scholar] [CrossRef] [Scilit]
  32. Cilia, G.; Fratini, F. Antimicrobial properties of terrestrial snail and slug mucus. J. Complement. Integr. Med. 2018, 15, 20170168. [Google Scholar] [CrossRef] [Scilit]
  33. Ulagesan, S.; Kim, H.J. Antibacterial and Antifungal Activities of Proteins Extracted from Seven Different Snails. Appl. Sci. 2018, 8, 1362. [Google Scholar] [CrossRef] [Scilit]
  34. Cerullo, A.R.; McDermott, M.B.; Pepi, L.E.; Liu, Z.-L.; Barry, D.; Zhang, S.; Yang, X.; Chen, X.; Azadi, P.; Holford, M.; et al. Comparative mucomic analysis of three functionally distinct Cornu aspersum Secretions. Nat. Commun. 2023, 14, 5361. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Pietrzyk, A.; Bujacz, A.; Mak, P.; Potempa, B.; Niedziela, T. Structural studies of Helix aspersa agglutinin complexed with GalNAc: A lectin that serves as a diagnostic tool. Int. J. Biol. Macromol. 2015, 81, 1059–1068. [Google Scholar] [CrossRef] [Scilit]
  36. Greistorfer, S.; Klepal, W.; Cyran, N.; Gugumuck, A.; Rudoll, L.; Suppan, J.; von Byern, J. Snail mucus—Glandular origin and composition in Helix pomatia. Zoology 2017, 122, 126–138. [Google Scholar] [CrossRef] [Scilit]
  37. Herluinus Mafranenda, D.N.H.; Kriswandini, I.L.; Arijani, R.E. Antimicrobial proteins of Snail mucus (Achatina fulica) against Streptococcus mutans and Aggregatibacter actinomycetemcomitans. Dent. J. 2014, 47, 31–36. [Google Scholar] [CrossRef] [Scilit]
  38. Dolashki, A.; Nissimova, A.; Daskalova, E.; Velkova, L.; Topalova, Y.; Hristova, P.; Traldi, P.; Voelter, W.; Dolashka, P. Structure and antibacterial activity of isolated peptides from the mucus of garden snail Cornu aspersum. Bulg. Chem. Commun. 2018, 50C, 195–200. [Google Scholar]
  39. Topalova, Y.; Belouhova, M.; Velkova, L.; Dolashki, A.; Zheleva, N.; Daskalova, E.; Kaynarov, D.; Voelter, W.; Dolashka, P. Effect and Mechanisms of Antibacterial Peptide Fraction from Mucus of C. aspersum against Escherichia coli NBIMCC 8785. Biomedicines 2022, 10, 672. [Google Scholar] [CrossRef] [Scilit]
  40. Velkova, L.; Nissimova, A.; Dolashki, A.; Daskalova, E.; Dolashka, P.; Topalova, Y. Glycine-rich peptides from C. aspersum snail with antibacterial activity. Bulg. Chem. Commun. 2018, 50, 169–175. [Google Scholar]
  41. Meher, P.; Sahu, T.; Saini, V.; Rao, A.R. Predicting antimicrobial peptides with improved accuracy by incorporating the compositional, physico-chemical and structural features into Chou’s general PseAAC. Sci. Rep. 2017, 7, 42362. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  42. Pawlicki, J.M.; Pease, L.B.; Pierce, C.M.; Startz, T.P.; Zhang, Y.; Smith, A.M. The effect of molluscan glue proteins on gel mechanics. J. Exp. Biol. 2004, 207, 1127–1135. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Tachapuripunya, V.; Roytrakul, S.; Chumnanpuen, P.; E-kobon, T. Unveiling Putative Functions of Mucus Proteins and Their Tryptic Peptides in Seven Gastropod Species Using Comparative Proteomics and Machine Learning-Based Bioinformatics Predictions. Molecules 2021, 26, 3475. [Google Scholar] [CrossRef] [Scilit]
  44. Li, D.; Graham, L.D. Epiphragmin, the major protein of epiphragm mucus from the vineyard snail, Cernuella virgata. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2007, 148, 192–200. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Ballard, K.R.; Klein, A.H.; Hayes, R.A.; Wang, T.; Cummins, S.F. The protein and volatile components of trail mucus in the Common Garden Snail, Cornu aspersum. PLoS ONE 2021, 16, e0251565. [Google Scholar] [CrossRef] [Scilit]
  46. González García, M.; Rodríguez, A.; Alba, A.; Vázquez, A.A.; Morales Vicente, F.E.; Pérez-Erviti, J.; Spellerberg, B.; Stenger, S.; Grieshober, M.; Conzelmann, C.; et al. New Antibacterial Peptides from the Freshwater Mollusk Pomacea poeyana (Pilsbry, 1927). Biomolecules 2020, 10, 1473. [Google Scholar] [CrossRef] [Scilit]
  47. Ebou, A.; Koua, D.; Addablah, A.; Kakou-Ngazoa, S.; Dutertre, S. Combined Proteotranscriptomic-Based Strategy to Discover Novel Antimicrobial Peptides from Cone Snails. Biomedicines 2021, 9, 344. [Google Scholar] [CrossRef] [Scilit]
  48. Vassilev, N.G.; Simova, S.D.; Dangalov, M.; Velkova, L.; Atanasov, V.; Dolashki, A.; Dolashka, P. An 1H NMR- and MS-Based Study of Metabolites Profiling of Garden Snail Helix aspersa Mucus. Metabolites 2020, 10, 360. [Google Scholar] [CrossRef] [Scilit]
  49. Sousa, J.C.; Berto, R.F.; Gois, E.A.; Fontenele-Cardi, N.C.; Honório-Júnior, J.E.; Konno, K.; Richardson, M.; Rocha, M.F.; Camargo, A.A.; Pimenta, D.C.; et al. Leptoglycin: A new Glycine/Leucine-rich antimicrobial peptide isolated from the skin secretion of the South American frog Leptodactylus pentadactylus (Leptodactylidae). Toxicon 2009, 54, 23–32. [Google Scholar] [CrossRef] [Scilit]
  50. Matsuzaki, K. Control of cell selectivity of antimicrobial peptides. Biochim. Biophys. Acta. 2009, 1788, 1687–1692. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  51. Lei, J.; Sun, L.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q. The antimicrobial peptides and their potential clinical applications. Am. J. Transl. Res. 2019, 11, 3919–3931. [Google Scholar] [PubMed]
  52. Raheem, N.; Straus, S.K. Mechanisms of Action for Antimicrobial Peptides with Antibacterial and Antibiofilm Functions. Front. Microbiol. 2019, 10, 2866. [Google Scholar] [CrossRef] [Scilit]
  53. Chen, Y.; Guarnieri, M.T.; Vasil, A.I.; Vasil, M.L.; Mant, C.T.; Hodges, R.S. Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides. Antimicrob. Agents Chemother. 2007, 51, 1398–1406. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Zhong, J.; Wang, W.; Yang, X.; Yan, X.; Liu, R. A novel cysteine-rich antimicrobial peptide from the mucus of the snail of Achatina fulica. Peptides 2013, 39, 1–5. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Breitenbach Barroso Coelho, L.C.; Marcelino Dos Santos Silva, P.; Felix de Oliveira, W.; de Moura, M.C.; Viana Pontual, E.; Soares Gomes, F.; Guedes Paiva, P.M.; Napoleão, T.H.; Dos Santos Correia, M.T. Lectins as antimicrobial agents. J. Appl. Microbiol. 2018, 125, 1238–1252. [Google Scholar] [CrossRef] [Scilit]
  56. Pietrzyk-Brzezinska, A.J.; Bujacz, A. H-type lectins—Structural characteristics and their applications in diagnostics, analytics and drug delivery. Int. J. Biol. Macromol. 2020, 152, 735–747. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Prokop, O.; Uhlenbruck, G.; Köhler, W. A new source of antibody-like substances having anti-blood group specificity: A discussion on the specificity of Helix agglutinins. Vox Sang. 1968, 14, 321–333. [Google Scholar] [CrossRef] [Scilit]
  58. Ito, S.; Shimizu, M.; Nagatsuka, M.; Kitajima, S.; Honda, M.; Tsuchiya, T.; Kanzawa, N. High molecular weight lectin isolated from the mucus of the giant African snail Achatina fulica. Biosci. Biotechnol. Biochem. 2011, 75, 20–25. [Google Scholar] [CrossRef] [Scilit]
  59. Maji, S.; Datta, U.; Hembram, M.L. A new sperm agglutinin factor from marine snail Telescopium telescopium: An evaluation with goat (Capra hircus) cauda epididymal spermatozoa. Iran. J. Reprod. Med. 2010, 8, 10–17. [Google Scholar]
  60. Coates, C.J.; Nairn, J. Diverse immune functions of hemocyanins. Dev. Comp. Immunol. 2014, 45, 43–55. [Google Scholar] [CrossRef] [Scilit]
  61. Coates, C.J.; Costa-Paiva, E.M. Multifunctional Roles of Hemocyanins. Subcell. Biochem. 2020, 94, 233–250. [Google Scholar] [CrossRef] [Scilit]
  62. Jeyachandran, S.; Chellapandian, H.; Park, K.; Kwak, I.S. Exploring the Antimicrobial Potential and Biofilm Inhibitory Properties of Hemocyanin from Hemifusus pugilinus (Born, 1778). Int. J. Mol. Sci. 2023, 24, 11494. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Yang, S.; Huang, H.; Wang, F.; Aweya, J.J.; Zheng, Z.; Zhang, Y. Prediction and characterization of a novel hemocyanin-derived antimicrobial peptide from shrimp Litopenaeus vannamei. Amino Acids. 2018, 50, 995–1005. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Zhuang, J.; Coates, C.J.; Zhu, H.; Zhu, P.; Wu, Z.; Xie, L. Identification of candidate antimicrobial peptides derived from abalone hemocyanin. Dev. Comp. Immunol. 2015, 49, 96–102. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Ehara, T.; Kitajima, S.; Kanzawa, N.; Tamiya, T.; Tsuchiya, T. Antimicrobial action of achacin is mediated by L-amino acid oxidase activity. FEBS Lett. 2002, 531, 509–512. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. McDermott, M.; Cerullo, A.R.; Parziale, J.; Achrak, E.; Sultana, S.; Ferd, J.; Samad, S.; Deng, W.; Braunschweig, A.B.; Holford, M. Advancing discovery of snail mucins function and application. Front. Bioeng. Biotech. 2021, 9, 734023. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Rashad, M.; Sampò, S.; Cataldi, A.; Zara, S. Biological activities of gastropods secretions: Snail and slug slime. Nat. Prod. Bioprospect. 2023, 13, 42. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Corfield, A.P. Mucins: A Biologically Relevant Glycan Barrier in Mucosal protection. Biochim. Biophys. Acta 2015, 1850, 236–252. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Bakshani, C.R.; Morales-Garcia, A.L.; Althaus, M.; Wilcox, M.D.; Pearson, J.P.; Bythell, J.C.; Burgess, J.G. Evolutionary conservation of the antimicrobial function of mucus: A first defence against infection. NPJ Biofilms Microbiome 2018, 4, 14. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  70. Okeniyi, F.A.; Oghenochuko, O.M.; Olawoye, S.O.; Animashahun, R.A.; Adeyonu, A.G.; Akpor, O.B. Antimicrobial potentials of mucus mucin from different species of giant African land snails on some typed culture pathogenic bacteria. Asian J. Agric. Biol. 2022, 4, 202107294. [Google Scholar] [CrossRef] [Scilit]
  71. Kodchakorn, K.; Chokepaichitkool, T.; Kongtawelert, P. Purification and characterisation of heparin-like sulfated polysaccharides with potent anti-SARS-CoV-2 activity from snail mucus of Achatina fulica. Carbohydr. Res. 2023, 529, 108832. [Google Scholar] [CrossRef] [Scilit]
  72. Trapella, C.; Rizzo, R.; Gallo, S.; Alogna, A.; Bortolotti, D.; Casciano, F.; Zauli, G.; Secchiero, P.; Voltan, R. HelixComplex snail mucus exhibits pro-survival, proliferative and pro-migration effects on mammalian fibroblasts. Sci. Rep. 2018, 8, 17665. [Google Scholar] [CrossRef] [Scilit]
  73. Gentili, V.; Bortolotti, D.; Benedusi, M.; Alogna, A.; Fantinati, A.; Guiotto, A.; Turrin, G.; Cervellati, C.; Trapella, C.; Rizzo, R.; et al. HelixComplex snail mucus as a potential technology against O3 induced skin damage. PLoS ONE 2020, 15, e0229613. [Google Scholar] [CrossRef] [Scilit]
  74. Zhukova, N.V.; Eliseikina, M.G.; Balakirev, E.S.; Ayala, F.J. Multiple bacterial partners in symbiosis with the nudibranch mollusk Rostanga alisae. Sci. Rep. 2022, 12, 169. [Google Scholar] [CrossRef] [Scilit]
  75. Madian, A.G.; Regnier, F.E. Proteomic identification of carbonylated proteins and their oxidation sites. J. Proteome Res. 2010, 9, 3766–3780. [Google Scholar] [CrossRef] [Scilit]
  76. Phrompanya, P.; Suriyaruean, N.; Nantarat, N.; Saenphet, S.; Tragoolpua, Y.; Saenphet, K. Biological properties of mucus from land snails (Lissachatina fulica) and freshwater snails (Pomacea canaliculata) and histochemical study of mucous cells in their foot. Peer J. 2023, 11, e15827. [Google Scholar] [CrossRef] [Scilit]
  77. Wang, W.; Yi, J.; Ke, S.; Halmela, M. Gastropod Biological Fluid, Method of Making and Refining and Use. U.S. Patent 20100233111A1, 16 September 2010. Available online: https://patents.google.com/patent/US20100233111A1/en (accessed on 19 May 2024).
  78. Wang, L.; Yang, J.; Wang, Y.; Zhang, J.; Gao, Y.; Yuan, J.; Su, A.; Ju, X. Study on antioxidant activity and amino acid analysis of rapeseed protein hydrolysates. Int. J. Food Prop. 2016, 19, 1899–1911. [Google Scholar] [CrossRef] [Scilit]
  79. Dolashka, P.; Atanasov, D. Device for Collecting Extracts from Garden Snail. BG Utility Model Application Number 2656, 08.11.2013. Patent Number 2097, 31 August 2015. Available online: https://portal.bpo.bg/bpo_online/-/bpo/utility-model-detail (accessed on 19 May 2024).
  80. Bradford, M.M. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem. 1976, 72, 248–254. [Google Scholar] [CrossRef]
  81. Laemmli, U.K. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 1970, 227, 680–685. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  82. Lincz, L.F.; Scorgie, F.E.; Garg, M.B.; Gilbert, J.; Sakoff, J.A. A simplified method to calculate telomere length from Southern blot images of terminal restriction fragment lengths. Biotechniques 2020, 68, 28–34. [Google Scholar] [CrossRef] [Scilit]
  83. Rosenfeld, J.; Capdevielle, J.; Guillemot, J.C.; Ferrara, P. In-gel digestion of proteins for internal sequence analysis after one- or two-dimensional gel electrophoresis. Anal. Biochem. 1992, 203, 173–179. [Google Scholar] [CrossRef] [Scilit]
  84. CLSI. Performance Standards for Antimicrobial Susceptibility Testing, 34th ed.; CLSI Supplement M100; Clinical and Laboratory Standards Institute: Wayne, PA, USA, 2024; ISBN 978-1-68440-220-5. [Google Scholar]
  85. Daskalova, A.; Petrova, V.; Velkova, L.; Kujumdzieva, A.; Tomova, A.; Voelter, W.; Dolashka, P. Investigation of protein expression of Saccharomyces cerevisiae cells in quiescent and proliferating state before and after toxic stress. Biotechnol. Biotechnol. Equip. 2021, 35, 366–376. [Google Scholar] [CrossRef] [Scilit]
  86. Kostova, I.; Traykova, M.; Rastogi, V.K. New lanthanide complexes with antioxidant activity. Med. Chem. 2008, 4, 371–378. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  87. Mesquita, C.S.; Oliveira, R.; Bento, F.; Geraldo, D.; Rodrigues, J.V.; Marcos, J.C. Simplified 2,4-dinitrophenylhydrazine spectrophotometric assay for quantification of carbonyls in oxidized proteins. Anal. Biochem. 2014, 485, 69–71. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  88. Zhang, Y. Role of glutathione in the accumulation of anticarcinogenic isothiocyanates and their glutathione conjugates by murine hepatoma cells. Carcinogenesis 2000, 21, 1175–1182. [Google Scholar] [CrossRef] [Scilit]
  89. Kumaran, A.; Karunakaran, R.J. Anti-oxidant activity of polyphenols from Phyllanthus debilis Klein ex Willd. J. Nat. Remedies 2006, 6, 141–146. [Google Scholar]
Figure 1. Purification of RP-HPLC of the mucus fraction with an MW < 20 kDa on a BioSill C18 HL 90–10 column (250 mm × 10 mm) via a gradient of water–acetonitrile (with 0.1% TFA) for 70 min at a flow rate of 1.0 mL/min.
Figure 1. Purification of RP-HPLC of the mucus fraction with an MW < 20 kDa on a BioSill C18 HL 90–10 column (250 mm × 10 mm) via a gradient of water–acetonitrile (with 0.1% TFA) for 70 min at a flow rate of 1.0 mL/min.
Molecules 29 02886 g001
Figure 2. MALDI-Tof-MS spectrum of the fraction with an MW < 3 kDa. A standard peptide solution was used to calibrate the mass scale of an Autoflex™ III High-Performance MALDI-TOF and TOF/TOF system (Bruker Daltonics, Bremen, Germany).
Figure 2. MALDI-Tof-MS spectrum of the fraction with an MW < 3 kDa. A standard peptide solution was used to calibrate the mass scale of an Autoflex™ III High-Performance MALDI-TOF and TOF/TOF system (Bruker Daltonics, Bremen, Germany).
Molecules 29 02886 g002
Figure 3. MALDI-Tof-MS spectrum of the fraction with an MW < 20 kDa recorded in the range 3–20 kDa. A standard peptide solution was used to calibrate the mass scale of an Autoflex™ III High-Performance MALDI-TOF and TOF/TOF system (Bruker Daltonics, Bremen, Germany).
Figure 3. MALDI-Tof-MS spectrum of the fraction with an MW < 20 kDa recorded in the range 3–20 kDa. A standard peptide solution was used to calibrate the mass scale of an Autoflex™ III High-Performance MALDI-TOF and TOF/TOF system (Bruker Daltonics, Bremen, Germany).
Molecules 29 02886 g003
Figure 4. MALDI-MS/MS spectrum of peptide [M+H]+ at m/z 1966.11 Da and its amino acidic sequence LLLDNKGGGLVGGLLGGGGKGGG, determined by de novo sequencing.
Figure 4. MALDI-MS/MS spectrum of peptide [M+H]+ at m/z 1966.11 Da and its amino acidic sequence LLLDNKGGGLVGGLLGGGGKGGG, determined by de novo sequencing.
Molecules 29 02886 g004
Figure 5. An analysis of molecular masses and protein intensities of 12% SDS-PAGE, scanned with a high resolution, using ImageQuantTM TL v8.2.0 software. (a) Electrophoretic pathway: (1) standard protein marker with an MW between 200 and 6.5 kDa (SigmaMarkerTM, Sigma-Aldrich, Saint Louis, MO, USA); (2) mucus extract fraction from C. aspersum with an MW > 20 kDa. (b) Electrophoretic profile of a standard protein molecular marker (electrophoretic lane 2) analyzed by ImageQuantTM TL. (c) Analysis of the electrophoretic profile of the mucus extract fraction from C. aspersum with an MW > 20 kDa (electrophoretic lane 1), using ImageQuantTM TL.
Figure 5. An analysis of molecular masses and protein intensities of 12% SDS-PAGE, scanned with a high resolution, using ImageQuantTM TL v8.2.0 software. (a) Electrophoretic pathway: (1) standard protein marker with an MW between 200 and 6.5 kDa (SigmaMarkerTM, Sigma-Aldrich, Saint Louis, MO, USA); (2) mucus extract fraction from C. aspersum with an MW > 20 kDa. (b) Electrophoretic profile of a standard protein molecular marker (electrophoretic lane 2) analyzed by ImageQuantTM TL. (c) Analysis of the electrophoretic profile of the mucus extract fraction from C. aspersum with an MW > 20 kDa (electrophoretic lane 1), using ImageQuantTM TL.
Molecules 29 02886 g005
Figure 6. MS/MS spectrum of peptide [M+H]+ at m/z 1670.93 from the protein band at 48.75 kDa of the mucus extract fraction with an MW > 20 of C. aspersum mucus.
Figure 6. MS/MS spectrum of peptide [M+H]+ at m/z 1670.93 from the protein band at 48.75 kDa of the mucus extract fraction with an MW > 20 of C. aspersum mucus.
Molecules 29 02886 g006
Figure 7. Antibacterial activity of two mucus fractions from C. aspersum snails with an MW < 20 kDa (a1,a2) and an MW > 20 kDa (b1,b2) against selected Gram-positive pathogenic strains. As a positive control the antibiotic vancomycin (VCM) is used. The control (C) represents untreated cells. Treatments were carried out with concentrated (Conc) and diluted fractions of snail mucus.
Figure 7. Antibacterial activity of two mucus fractions from C. aspersum snails with an MW < 20 kDa (a1,a2) and an MW > 20 kDa (b1,b2) against selected Gram-positive pathogenic strains. As a positive control the antibiotic vancomycin (VCM) is used. The control (C) represents untreated cells. Treatments were carried out with concentrated (Conc) and diluted fractions of snail mucus.
Molecules 29 02886 g007
Figure 8. Antibacterial activity of both fractions extracted from the mucus of C. aspersum snails with an MW < 20 kDa (a1a3) and an MW > 20 kDa (b1b3) against selected Gram-negative pathogenic strains. As a positive control, the antibiotic vancomycin (VCM) is used. The control (C) represents untreated cells. Treatments were carried out with concentrated (Conc) and diluted fractions of snail mucus.
Figure 8. Antibacterial activity of both fractions extracted from the mucus of C. aspersum snails with an MW < 20 kDa (a1a3) and an MW > 20 kDa (b1b3) against selected Gram-negative pathogenic strains. As a positive control, the antibiotic vancomycin (VCM) is used. The control (C) represents untreated cells. Treatments were carried out with concentrated (Conc) and diluted fractions of snail mucus.
Molecules 29 02886 g008aMolecules 29 02886 g008b
Figure 9. Effect of the C. aspersum mucus fraction with an MW < 20 kDa (a) and an MW > 20 kDa (b) on S. cerevisiae NBMCC 584 growth.
Figure 9. Effect of the C. aspersum mucus fraction with an MW < 20 kDa (a) and an MW > 20 kDa (b) on S. cerevisiae NBMCC 584 growth.
Molecules 29 02886 g009
Figure 10. Intracellular ROS (a) and carbonylated protein (b) levels in S. cerevisiae NBMCC 584 cells grown in the presence of C. aspersum mucus fractions with an MW < 20 kDa and an MW > 20 kDa.
Figure 10. Intracellular ROS (a) and carbonylated protein (b) levels in S. cerevisiae NBMCC 584 cells grown in the presence of C. aspersum mucus fractions with an MW < 20 kDa and an MW > 20 kDa.
Molecules 29 02886 g010
Figure 11. Effect of C. aspersum mucus fractions with an MW < 20 kDa and an MW > 20 kDa on S. cerevisiae NBMCC 584 cellular reduced glutathione levels (GSH) (a) and total antioxidant capacity (TAC) (b).
Figure 11. Effect of C. aspersum mucus fractions with an MW < 20 kDa and an MW > 20 kDa on S. cerevisiae NBMCC 584 cellular reduced glutathione levels (GSH) (a) and total antioxidant capacity (TAC) (b).
Molecules 29 02886 g011
Table 1. The primary structures of peptides with an MW below 3 kDa, from a garden snail, C. aspersum, identified by de novo sequencing in MALDI-MS/MS.
Table 1. The primary structures of peptides with an MW below 3 kDa, from a garden snail, C. aspersum, identified by de novo sequencing in MALDI-MS/MS.
NoAmino Acid Sequence of Peptides[M+H]+
Da
Calcul.
Monois. Mass Da
pIGRAVYNet ChargePredicted by iAMPpred
Software
http://cabgrid.res.in:8080/amppred (accessed on 25 April 2024)
Antibacterial (%)Antiviral (%)Antifungal (%)
1LLPFKEPDL1071.601070.604.37−0.600−2/+1285119
2ACGATLQLENCG1179.771178.514.00+0.350−1/029.335.743.7
3LNLGGNGANGLVGG1212.761211.635.52+0.3210/074.043.174.3
4AGVGGAAGNPSTYVG1277.701276.605.57+0.2600/025.17.411.3
5GGGMVKEDGSCLGV1308.771307.584.37+0.207−2/+140.431.433.7
6 aMLGGGVNSLRPPK 1325.801324.7311.0−0.2620/+222.814.08.9
7CVGGAGGHGDSCAKGT1376.531375.566.73−0.106−1/+185.248.874.4
8 GGGGYHTWGEGGKF1409.481408.626.75−0.964−1/+169.062.872.6
9MLNVAVNKGEVKH1438.861437.788.37−0.138−1/+256.438.019.7
10 bNLVGGSGGGGRGGANPLG 1496.791495.759.75−0.2170/+166.033.748.2
11GTMSPAGGEMGPVTAGVG1576.041574.714.00+0.250−1/013.124.88.3
12GTKGCGPGSCPPGDTVAGVG1716.791715.765.82−0.100−1/+123.820.225.8
13 cACSLLLGGGGVGGGKGGGGHAG 1738.961737.868.27+0.4090/+182.649.567.0
14 aLLLDGFGGGLLVEHDPGS 1796.001794.924.02+0.439−3/0374510
15 dMGGWGGLGGGHNGGWMPPK 1852.961851.838.52−0.6110/+16956.057.0
16 cACLTPVDHFFAGMPCGGGP 1876.881875.815.08+0.542−1/032.442.620.1
17 cNGLFGGLGGGGHGGGGKGPGEGGG 1909.981908.886.75−0.487−1/+189.567.279.5
18LLLDNKGGGLVGGLLGGGGKGGG1966.111965.108.59+0.322−1/+2935681
19GMVLLHCSPALDFHKTPAV2036.092035.046.91+0.616−1/+1185314
20LPFLLGVGGLLGGSVGGGGGGGGAPL2136.242135.175.52+1.0230/0663336
21MVLDGKGGGGLLGGVLGGGKDAHLGG2292.322291.216.50+0.319−2/+284.359.071
22LLKDNGVGGLLGGGGAGGGGLVGGNLGGGAG2478.392477.305.84+0.439−1/+186.45466
23KTSKLMVYLAGGGGGLLGGVGGGGGGAGGGGP
GGL
2843.762842.489.70+0.3740/+2764767
The AASs of these peptides were identified previously by a Dolashki et al., 2018 [38]; b Dolashki et al., 2020 [21]; c Topalova et al., 2022 [39]; and d Velkova at al., 2018 [40].
Table 2. AASs of peptides, determined after the analysis of their MS/MS spectra. Proteins were identified after comparing AASs with a database of protein sequences by the Basic Local Alignment Search Tool (BLAST).
Table 2. AASs of peptides, determined after the analysis of their MS/MS spectra. Proteins were identified after comparing AASs with a database of protein sequences by the Basic Local Alignment Search Tool (BLAST).
Band
kDa
AAS of PeptideMass Exp. [M+H]+Protein NameUniProt IDIdentities
17.5TAAFTEDTSVVTGR1454.63Mucus protein [Cornu aspersum] QEG59314.186%, E = 8 × 10−5
FTAAFTEDTSVAEGR1601.74Mucus protein [C. aspersum] QEG59314.1100%, E = 2 × 10−9
GNVAFTAAFTEDTSVAEGR1942.91Mucus protein [C. aspersum] QEG59314.1100%, E = 4 × 10−13
GALNGNVAFTAAFTEDTSVAEGR2298.10Mucus protein [C. aspersum] QEG59314.1100%, E = 2 × 10−11
23.6GSCNWPMTILMLESLR1850.90NADH subunit 6 [Albinaria caerulea]P48922 78%, E = 0.005
QYLQITWPSPR1388.7H-type lectin domain-cont. protein B. glabrataKAI8776186.1100%, E = 0.041
26.7VPSDDPGR842.40Chain A, H. aspersa agglutinin [C. aspersum]4Q56_A100%, E = 0.003
DITFASPYCR1172.54Chain A, H. aspersa agglutinin C. aspersum4Q56_A90%, E = 1 × 10−4
NGGLVHPGPR 1003.54Uncharacterized protein [Pomacea canaliculata] XP_025078819.189%, E = 4.5
31.35DWTLYVNTPLAPAR1616.84Unnamed protein, partial [C. unifasciata]
mucin 18b [Plakobranchus ocellatus]
CAG5130849.1
GFO09821.1
78%, E = 0.33
75%, E = 2.7
FCPNAQRTR1092.54Glutathione S-transferase omega-1-like
[P. canaliculata]
Glutathione S-transferase omega-1 [Elysia marginata]
XP_025114871.1
GFR70608.1
89%, E = 0.31
89%, E = 0.31
NPVGSVPVLELDGK1423.78Glutathione S-transferase omega-1 [P. canaliculata]
Glutathione S-transferase omega-1-like [B.glabrata]
XP_025099831.1
KAI8762368.1
86%, E = 0.013
79%, E = 0.026
33.0GPCFTPHTYTNWSWLR 1965.91Unnamed protein [Candidula unifasciata] “Bacterial protein of unknown function” (HtrL_YibB) CAG5121511.163%, E = 4 × 10−4
DFLPPASLPDFAPSPPRVAER2279.18Unnamed protein product [C. unifasciata]CAG5136685.153%, E = 0.34
39.1AGYLQITWPSPR 1388.72Mucus protein [C. aspersum]
H-type lectin domain [Biomphalaria glabrata]
QEG59312.1
KAI8776186.1
100%, E = 1 × 10−8
100% E = 0.055
ASVTGDLSNK 991.51Mucus protein [C. aspersum] QEG59312.1100%, E = 8 × 10−4
ELLGNVYRAAFTEDTSVAEGR 2298.14Mucus protein [C. aspersum]QEG59314.177%, E = 3 × 10−8
VGSNGAR660.34Mucus protein [C. aspersum] QEG59312.1100%, E = 0.004
LPLYEDPKLDVSSLR1744.83Uncharacterized protein LOC101853718 [A. californica]XP_012941625.183%, E = 0.27
48.7FDANPFFSGR1157.59Hemocyanin, βC chain unit D [Helix pomatia]P12031.289%, E = 9 × 10−6
HGSPIGVPYWDWTR 1670.93Hemocyanin α N [C. aspersum]AYO86684.1100%, E = 2 × 10−9
LISEATYFNSR1300.71Hemocyanin β [C. aspersum]
βC chain unit D [H. pomatia]
AYO86685.1,
P12031.2
100%, E = 2 × 10−4
82%, E = 6 × 10−5
FDPNPFFSGR1183.5Hemocyanin, βC chain unit D [H. pomatia]P12031.2100%, E = 3 × 10−7
EVFEQVEHALLAR1540.81Hemocyanin β [C. aspersum]
Hemocyanin βC chain unit D [H. pomatia]
AYO86685.1
P12031.2
100%, E = 0.006
88%, E = 0.050
QYLQITWSPPR1388.73Fibrinogen-like protein A isoform [B. glabrata] XP_055864456.178%, E = 1.4
52.8TDVTSALLGARCNEGGTNTHSPLR2470.21Unnamed protein, partial [C. unifasciata]
Unnamed protein C. unifasciata
CAG5131631.1
CAG5131621.1
70%, E = 0.006
63%, E = 0.26
LTQHFNVGSNGAR 1400.70Mucus protein [C. aspersum]
Unnamed protein [C. unifasciata]
Unnamed protein partial [C. unifasciata]
QEG59312.1
CAG5131621.1
CAG5131631.1
92%, E = 0.001
77%, E = 0.094
75%, E= 0.38
MPDYDCGCCNGSNGSYGSGGGGGGGR2384.84Unnamed protein, partial [C.unifasciata]
Unnamed protein product [C. unifasciata]
CAG5126455.1
CAG5131834.1
80%, E = 0.23
63% E = 0.23
56.9DGMSAAPQAENAFALK1620.77Achacin; flags: precursor [L. fulica]
L-amino-acid oxidase (Escapin) [A. californica]
P35903.1
Q6IWZ0.1
71%, E = 3 × 10−4
63%, E = 0.95
SGFPTTSKDR 1095.54L-amino-acid oxidase (Escapin) [A. californica]Q6IWZ0.1100%, E = 0.080
VGGGPSGVELDEFEARVELK2088.0Achacin; flags: precursor [Lissachatina fulica]P35903.141% E = 0.40
AELKGDMQYTYADSEKVR2104.00Fibrillin-3, partial [Biomphalaria pfeifferi]
Fibrillin-3, partial [B. glabrata]
KAK0048148.1
KAK6970092.1
48%, E = 0.22
48%, E = 0.22
70.8AKVQVIGVPDDRLLLR1792.08Acyl-CoA synthetase family member 2, mitochondrial-like, partial [Pomacea canaliculata]
Unnamed protein product [C. unifasciata]
XP_025086706.1
CAG5136482
91%, E = 0.005
91%, E = 0.005
HGGGGGGFGGGGFGSR1320.65Uncharacterized protein LOC124113905 [H. rufescens]
Fibroin heavy-chain isoform X1 [A. californica]
Elastin-like [Ostrea edulis]
Glycine, alanine asparagine-rich protein [Haliotis asinina]
XP_046330350.2
XP_012943828.1
XP_056017499.1
P86732.1
100%, E = 9 × 10−4
81%, E = 0.018
87%, E = 0.038
65%, E = 0.004
84.7YVLEDLSAADLELSR1693.86FMRFamide-activated amiloride-sensitive sodium channel [C. aspersum]Q25011.1100%, E = 0.14
GSSVSLCVWDWAVLPR1774.8FMRFamide-activated amiloride-sensitive sodium channel [C. aspersum]Q25011.171%, E = 1.9
97.0MVTSLYPGEDWAMLPR 1865.89Mucin-5AC-like, partial [Haliotis rufescens] XP_048239711.156%, E = 0.15
ETVSPGYSEGECTCASITQK2089.91Mucin-5B-like isoform X4 [H. rubra] XP_046552239.162%, E = 6.7
VFADFELHNIGASADVR 1860.92Hemocyanin β [C. aspersum]AYO86685.1100%, E = 2 × 10−10
CQVSLPYWDWAVPLR1832.92Hemocyanin, βC chain unit G [H. pomatia] P56823.1100%, E = 5 × 10−4
LSGYDVSKVNEILK1564.86Hemocyanin β [C. aspersum]AYO86685.185%, E = 8 × 10−5
HLWLLHCFEHDLNGYEYDNLR2687.25Hemocyanin β [C. aspersum]AYO86685.187% E = 8 × 10−6
ANNARLTDASHDNPFSSYTLR2350.12Hemocyanin β [C. aspersum]AYO86685.194%, E = 1 × 10−9
143.3VGRIESESYVVKKSK1708.96Zinc finger protein 502-like [B. glabrata]
Zinc finger protein 184 [B. glabrata]
XP_055863608
KAI8795828.1
77%, E = 0.12
77%, E = 0.12
VLTFYQSCDCVVDHCHR2024.88Zinc finger protein 664-like [Patella vulgata]XP_050401404.175%, E = 1.5
GEPGSTGPPGLK1096.56Collagen alpha-1(IV) chain-like, partial [P. canaliculata] XP_025114158.1100%, E = 2 × 10−4
NGPSGVELDEFEARVELK1988.99Collagen alpha-1(XIII) chain-like isoform X7 [H. rubra]XP_046573418.159%, E = 2.5
FVDMDGMFSSAAGGRPEAR 2000.89Collagen α-4(VI) chain-like X2 [P. acuta]
Collagen α-1(XII) chain-like [P. acuta]
Collagen α-1(XII) chain-like isoform X6 [B. glabrata]
XP_059154404.1
XP_059163536.1
XP_055860588.1
73%, E = 0.012
75%, E = 0.26
68%, E = 0.26
RAYTDGMFSSAAGGRPEAR1999.94Collagen α-4(VI) chain-like isoform [P. acuta]
Collagen α-4(VI) chain-like isoform [P. acuta]
XP_059154404.1
XP_059154396.1
79%, E = 0.031
79%, E = 0.031
CNEGGTNTHSPLR1385.62Collagen α-6(VI) chain-like [Physella acuta]XP_059164377.189%, E = 6.1
198.31NPGYLVSKVNEILK1573.89Mucin-2-like [P. acuta]
Serine/arginine repetitive matrix protein 2 [B. glabrata]
XP_059140993.1
KAI8735946.1
71%, E = 0.84
71%, E = 0.84
DCRVRVGGPLFAPSPYLFER2279.1Mucin-17-like [Haliotis rubra] XP_046554219.152%, E = 0.78
FNFLPLSADALESLR1692.90E3 ubiquitin-protein ligase HERC2-like isoform X2 [B. glabrata] XP_055894969.183%, E = 0.50
ASSGSCDFSSSTAANR1547.64Mucin-5AC-like isoform X2 [H. rufescens]
Mucin-5AC-like isoform X1 [H. rufescens]
XP_048252836.1
XP_048252834.1
85%, E = 0.45
85%, E = 0.45
GCAGCPQAGSK978.41Fibrillin-1-like [B. glabrata]XP_055888733.189%, E = 2.9
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Velkova, L.; Dolashki, A.; Petrova, V.; Pisareva, E.; Kaynarov, D.; Kermedchiev, M.; Todorova, M.; Dolashka, P. Antibacterial Properties of Peptide and Protein Fractions from Cornu aspersum Mucus. Molecules 2024, 29, 2886. https://doi.org/10.3390/molecules29122886

AMA Style

Velkova L, Dolashki A, Petrova V, Pisareva E, Kaynarov D, Kermedchiev M, Todorova M, Dolashka P. Antibacterial Properties of Peptide and Protein Fractions from Cornu aspersum Mucus. Molecules. 2024; 29(12):2886. https://doi.org/10.3390/molecules29122886

Chicago/Turabian Style

Velkova, Lyudmila, Aleksandar Dolashki, Ventsislava Petrova, Emiliya Pisareva, Dimitar Kaynarov, Momchil Kermedchiev, Maria Todorova, and Pavlina Dolashka. 2024. "Antibacterial Properties of Peptide and Protein Fractions from Cornu aspersum Mucus" Molecules 29, no. 12: 2886. https://doi.org/10.3390/molecules29122886

APA Style

Velkova, L., Dolashki, A., Petrova, V., Pisareva, E., Kaynarov, D., Kermedchiev, M., Todorova, M., & Dolashka, P. (2024). Antibacterial Properties of Peptide and Protein Fractions from Cornu aspersum Mucus. Molecules, 29(12), 2886. https://doi.org/10.3390/molecules29122886

Article Metrics

Back to TopTop