Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides
Abstract
1. Introduction
2. Sources, Structures and Activities of Antimicrobial Peptides
2.1. Sources of AMPs
2.1.1. AMPs from Microorganisms
2.1.2. AMPs from Animals and Plants
2.1.3. AMPs from Marine Organisms
2.2. Structures and Activities of AMPs
3. Mechanism of Action of Antimicrobial Peptides
3.1. AMPs Acting on the Cell Wall
3.2. AMPs Acting on the Cell Membrane
3.3. AMPs Acting on Intracellular Targets
3.4. AMPs Acting on Biofilms
3.5. Antiviral Mechanism of AMPs
4. Advantages, Disadvantages and Clinical Applications of Antimicrobial Peptides
5. Conclusions
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Moretta, A.; Scieuzo, C.; Petrone, A.M.; Salvia, R.; Manniello, M.D.; Franco, A.; Lucchetti, D.; Vassallo, A.; Vogel, H.; Sgambato, A.; et al. Antimicrobial Peptides: A New Hope in Biomedical and Pharmaceutical Fields. Front. Cell Infect. Microbiol. 2021, 11, 668632. [Google Scholar] [CrossRef] [PubMed]
- Zhang, K.; Li, X.; Yu, C.; Wang, Y. Promising Therapeutic Strategies Against Microbial Biofilm Challenges. Front. Cell Infect. Microbiol. 2020, 10, 359. [Google Scholar] [CrossRef] [PubMed]
- Van Eijk, M.; Boerefijn, S.; Cen, L.; Rosa, M.; Morren, M.J.H.; van der Ent, C.K.; Kraak, B.; Dijksterhuis, J.; Valdes, I.D.; Haagsman, H.P.; et al. Cathelicidin-inspired antimicrobial peptides as novel antifungal compounds. Med. Mycol. 2020, 58, 1073–1084. [Google Scholar] [CrossRef] [PubMed]
- Buccini, D.F.; Cardoso, M.H.; Franco, O.L. Antimicrobial Peptides and Cell-Penetrating Peptides for Treating Intracellular Bacterial Infections. Front. Cell Infect. Microbiol. 2020, 10, 612931. [Google Scholar] [CrossRef] [PubMed]
- Kurpe, S.R.; Grishin, S.Y.; Surin, A.K.; Panfilov, A.V.; Slizen, M.V.; Chowdhury, S.D.; Galzitskaya, O.V. Antimicrobial and Amyloidogenic Activity of Peptides. Can Antimicrobial Peptides Be Used against SARS-CoV-2? Int. J. Mol. Sci. 2020, 21, 9552. [Google Scholar] [CrossRef] [PubMed]
- Rowe-Magnus, D.A.; Kao, A.Y.; Prieto, A.C.; Pu, M.; Kao, C. Cathelicidin Peptides Restrict Bacterial Growth via Membrane Perturbation and Induction of Reactive Oxygen Species. mBio 2019, 10, e02021-19. [Google Scholar] [CrossRef] [PubMed]
- Mansour, S.C.; Pena, O.M.; Hancock, R.E. Host defense peptides: Front-line immunomodulators. Trends Immunol. 2014, 35, 443–450. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Bjorn, C.; Ekblom, J. Antimicrobial peptides as therapeutic agents: Opportunities and challenges. Crit. Rev. BioTechnol. 2020, 40, 978–992. [Google Scholar] [CrossRef] [PubMed]
- Elnagdy, S.; AlKhazindar, M. The Potential of Antimicrobial Peptides as an Antiviral Therapy against COVID-19. ACS Pharmacol. Transl. Sci. 2020, 3, 780–782. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Cao, L.; Zhong, M.; Zhang, Y.; Han, C.; Li, Q.; Yang, J.; Zhou, D.; Shi, W.; He, B.; et al. Anti-HIV-1 activity of a new scorpion venom peptide derivative Kn2-7. PLoS ONE 2012, 7, e34947. [Google Scholar] [CrossRef] [PubMed]
- Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef] [PubMed]
- Stansly, P.G.; Schlosser, M.E. Studies on Polymyxin: Isolation and Identification of Bacillus polymyxa and Differentiation of Polymyxin from Certain Known Antibiotics. J. Bacteriol. 1947, 54, 549–556. [Google Scholar] [CrossRef] [PubMed]
- Trimble, M.J.; Mlynarcik, P.; Kolar, M.; Hancock, R.E. Polymyxin: Alternative Mechanisms of Action and Resistance. Cold Spring Harb. Perspect. Med. 2016, 6, a025288. [Google Scholar] [CrossRef] [PubMed]
- Li, J.; Nation, R.L.; Turnidge, J.D.; Milne, R.W.; Coulthard, K.; Rayner, C.R.; Paterson, D.L. Colistin: The re-emerging antibiotic for multidrug-resistant Gram-negative bacterial infections. Lancet Infect. Dis. 2006, 6, 589–601. [Google Scholar] [CrossRef]
- Falagas, M.E.; Kasiakou, S.K. Toxicity of polymyxins: A systematic review of the evidence from old and recent studies. Crit. Care 2006, 10, R27. [Google Scholar] [CrossRef] [PubMed]
- Sumi, C.D.; Yang, B.W.; Yeo, I.C.; Hahm, Y.T. Antimicrobial peptides of the genus Bacillus: A new era for antibiotics. Can. J. Microbiol. 2015, 61, 93–103. [Google Scholar] [CrossRef]
- Li, Q.; Montalban-Lopez, M.; Kuipers, O.P. Increasing the Antimicrobial Activity of Nisin-Based Lantibiotics against Gram-Negative Pathogens. Appl. Environ. Microbiol. 2018, 84, e00052-18. [Google Scholar] [CrossRef]
- Shin, J.M.; Gwak, J.W.; Kamarajan, P.; Fenno, J.C.; Rickard, A.H.; Kapila, Y.L. Biomedical applications of nisin. J. Appl. Microbiol. 2016, 120, 1449–1465. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Q.; Zhu, S.; Cui, N.; Zhang, B.; Wang, Z.; Chen, X.; Liu, J.; Li, J.; Cai, D.; Yang, Z.; et al. Enhanced production of bacitracin via energy metabolism engineering in Bacillus licheniformis DW2. Sheng Wu Gong Cheng Xue Bao 2020, 36, 1126–1137. [Google Scholar] [CrossRef] [PubMed]
- Prenner, E.J.; Lewis, R.N.; McElhaney, R.N. The interaction of the antimicrobial peptide gramicidin S with lipid bilayer model and biological membranes. Biochim. Biophys. Acta 1999, 1462, 201–221. [Google Scholar] [CrossRef]
- Bruniera, F.R.; Ferreira, F.M.; Saviolli, L.R.; Bacci, M.R.; Feder, D.; da Luz Goncalves Pedreira, M.; Sorgini Peterlini, M.A.; Azzalis, L.A.; Campos Junqueira, V.B.; Fonseca, F.L. The use of vancomycin with its therapeutic and adverse effects: A review. Eur. Rev. Med. Pharmacol. Sci. 2015, 19, 694–700. [Google Scholar] [PubMed]
- Shen, B.; Song, J.; Zhao, Y.; Zhang, Y.; Liu, G.; Li, X.; Guo, X.; Li, W.; Cao, Z.; Wu, Y. Triintsin, a human pathogenic fungus-derived defensin with broad-spectrum antimicrobial activity. Peptides 2018, 107, 61–67. [Google Scholar] [CrossRef] [PubMed]
- Luo, X.; Zhu, W.; Ding, L.; Ye, X.; Gao, H.; Tai, X.; Wu, Z.; Qian, Y.; Ruan, X.; Li, J.; et al. Bldesin, the first functionally characterized pathogenic fungus defensin with Kv1.3 channel and chymotrypsin inhibitory activities. J. Biochem. Mol. Toxicol. 2019, 33, e22244. [Google Scholar] [CrossRef]
- Garcia, J.; Oliveira, A.; de Pinho, P.G.; Freitas, V.; Carvalho, A.; Baptista, P.; Pereira, E.; de Lourdes Bastos, M.; Carvalho, F. Determination of amatoxins and phallotoxins in Amanita phalloides mushrooms from northeastern Portugal by HPLC-DAD-MS. Mycologia 2015, 107, 679–687. [Google Scholar] [CrossRef] [PubMed]
- Ding, W.; Liu, W.Q.; Jia, Y.; Li, Y.; van der Donk, W.A.; Zhang, Q. Biosynthetic investigation of phomopsins reveals a widespread pathway for ribosomal natural products in Ascomycetes. Proc. Natl. Acad. Sci. USA 2016, 113, 3521–3526. [Google Scholar] [CrossRef]
- Nagaoka, I.; Tamura, H.; Reich, J. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int. J. Mol. Sci. 2020, 21, 5973. [Google Scholar] [CrossRef]
- Spencer, J.J.; Pitts, R.E.; Pearson, R.A.; King, L.B. The effects of antimicrobial peptides WAM-1 and LL-37 on multidrug-resistant Acinetobacter baumannii. Pathog. Dis. 2018, 76, fty007. [Google Scholar] [CrossRef]
- Wilson, S.S.; Wiens, M.E.; Smith, J.G. Antiviral mechanisms of human defensins. J. Mol. Biol. 2013, 425, 4965–4980. [Google Scholar] [CrossRef]
- Sorensen, O.E.; Thapa, D.R.; Roupe, K.M.; Valore, E.V.; Sjobring, U.; Roberts, A.A.; Schmidtchen, A.; Ganz, T. Injury-induced innate immune response in human skin mediated by transactivation of the epidermal growth factor receptor. J. Clin. Investig. 2006, 116, 1878–1885. [Google Scholar] [CrossRef]
- Gschwandtner, M.; Zhong, S.; Tschachler, A.; Mlitz, V.; Karner, S.; Elbe-Burger, A.; Mildner, M. Fetal human keratinocytes produce large amounts of antimicrobial peptides: Involvement of histone-methylation processes. J. Investig. Dermatol. 2014, 134, 2192–2201. [Google Scholar] [CrossRef]
- Zasloff, M. Magainins, a class of antimicrobial peptides from Xenopus skin: Isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef] [PubMed]
- Lee, H. Heterodimer and pore formation of magainin 2 and PGLa: The anchoring and tilting of peptides in lipid bilayers. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183305. [Google Scholar] [CrossRef] [PubMed]
- Aisenbrey, C.; Amaro, M.; Pospisil, P.; Hof, M.; Bechinger, B. Highly synergistic antimicrobial activity of magainin 2 and PGLa peptides is rooted in the formation of supramolecular complexes with lipids. Sci Rep. 2020, 10, 11652. [Google Scholar] [CrossRef] [PubMed]
- Hultmark, D.; Steiner, H.; Rasmuson, T.; Boman, H.G. Insect immunity. Purification and properties of three inducible bactericidal proteins from hemolymph of immunized pupae of Hyalophora cecropia. Eur. J. Biochem. 1980, 106, 7–16. [Google Scholar] [CrossRef]
- Hultmark, D.; Engstrom, A.; Bennich, H.; Kapur, R.; Boman, H.G. Insect immunity: Isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae. Eur. J. Biochem. 1982, 127, 207–217. [Google Scholar] [CrossRef]
- Ekengren, S.; Hultmark, D. Drosophila cecropin as an antifungal agent. Insect Biochem. Mol. Biol. 1999, 29, 965–972. [Google Scholar] [CrossRef]
- Yi, H.Y.; Chowdhury, M.; Huang, Y.D.; Yu, X.Q. Insect antimicrobial peptides and their applications. Appl. Microbiol. Biotechnol. 2014, 98, 5807–5822. [Google Scholar] [CrossRef]
- Mylonakis, E.; Podsiadlowski, L.; Muhammed, M.; Vilcinskas, A. Diversity, evolution and medical applications of insect antimicrobial peptides. Philos. Trans. R. Soc. Lond. B Biol. Sci. 2016, 371, 20150290. [Google Scholar] [CrossRef]
- Li, J.; Hu, S.; Jian, W.; Xie, C.; Yang, X. Plant antimicrobial peptides: Structures, functions, and applications. Bot. Stud. 2021, 62, 5. [Google Scholar] [CrossRef]
- Tang, S.S.; Prodhan, Z.H.; Biswas, S.K.; Le, C.F.; Sekaran, S.D. Antimicrobial peptides from different plant sources: Isolation, characterisation, and purification. Phytochemistry 2018, 154, 94–105. [Google Scholar] [CrossRef]
- Gasu, E.N.; Ahor, H.S.; Borquaye, L.S. Peptide Extract from Olivancillaria hiatula Exhibits Broad-Spectrum Antibacterial Activity. Biomed. Res. Int. 2018, 2018, 6010572. [Google Scholar] [CrossRef] [PubMed]
- Kollakalnaduvil Raghavan, R.M.; Ali Pannippara, M.; Kesav, S.; Mathew, A.; Bhat, S.G.; Hatha Aa, M.; Kk, E. MFAP9: Characterization of an extracellular thermostable antibacterial peptide from marine fungus with biofilm eradication potential. J. Pharm. Biomed. Anal. 2021, 194, 113808. [Google Scholar] [CrossRef] [PubMed]
- Shah, P.; Chen, C.S. Systematical Screening of Intracellular Protein Targets of Polyphemusin-I Using Escherichia coli Proteome Microarrays. Int. J. Mol. Sci. 2021, 22, 9158. [Google Scholar] [CrossRef] [PubMed]
- Zhang, W.; Xu, X.; Zhang, J.; Ye, T.; Zhou, Q.; Xu, Y.; Li, W.; Hu, Z.; Shang, C. Discovery and Characterization of a New Crustin Antimicrobial Peptide from Amphibalanus amphitrite. Pharmaceutics 2022, 14, 413. [Google Scholar] [CrossRef]
- Vila, J.; Moreno-Morales, J.; Balleste-Delpierre, C. Current landscape in the discovery of novel antibacterial agents. Clin. Microbiol. Infect. 2020, 26, 596–603. [Google Scholar] [CrossRef] [PubMed]
- Bechinger, B.; Zasloff, M.; Opella, S.J. Structure and orientation of the antibiotic peptide magainin in membranes by solid-state nuclear magnetic resonance spectroscopy. Protein Sci. 1993, 2, 2077–2084. [Google Scholar] [CrossRef] [PubMed]
- Oren, Z.; Lerman, J.C.; Gudmundsson, G.H.; Agerberth, B.; Shai, Y. Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: Relevance to the molecular basis for its non-cell-selective activity. Biochem. J. 1999, 341 Pt 3, 501–513. [Google Scholar] [CrossRef]
- Mishra, A.K.; Choi, J.; Moon, E.; Baek, K.H. Tryptophan-Rich and Proline-Rich Antimicrobial Peptides. Molecules 2018, 23, 815. [Google Scholar] [CrossRef]
- Zhang, Z.T.; Zhu, S.Y. Drosomycin, an essential component of antifungal defence in Drosophila. Insect Mol. Biol. 2009, 18, 549–556. [Google Scholar] [CrossRef]
- Mygind, P.H.; Fischer, R.L.; Schnorr, K.M.; Hansen, M.T.; Sonksen, C.P.; Ludvigsen, S.; Raventos, D.; Buskov, S.; Christensen, B.; De Maria, L.; et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature 2005, 437, 975–980. [Google Scholar] [CrossRef]
- Romeo, D.; Skerlavaj, B.; Bolognesi, M.; Gennaro, R. Structure and bactericidal activity of an antibiotic dodecapeptide purified from bovine neutrophils. J. Biol. Chem. 1988, 263, 9573–9575. [Google Scholar] [CrossRef]
- Babasaki, K.; Takao, T.; Shimonishi, Y.; Kurahashi, K. Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: Isolation, structural analysis, and biogenesis. J. Biochem. 1985, 98, 585–603. [Google Scholar] [CrossRef] [PubMed]
- Conibear, A.C.; Rosengren, K.J.; Harvey, P.J.; Craik, D.J. Structural characterization of the cyclic cystine ladder motif of theta-defensins. Biochemistry 2012, 51, 9718–9726. [Google Scholar] [CrossRef] [PubMed]
- Graf, M.; Mardirossian, M.; Nguyen, F.; Seefeldt, A.C.; Guichard, G.; Scocchi, M.; Innis, C.A.; Wilson, D.N. Proline-rich antimicrobial peptides targeting protein synthesis. Nat. Prod. Rep. 2017, 34, 702–711. [Google Scholar] [CrossRef] [PubMed]
- Shagaghi, N.; Palombo, E.A.; Clayton, A.H.; Bhave, M. Archetypal tryptophan-rich antimicrobial peptides: Properties and applications. World J. Microbiol. Biotechnol. 2016, 32, 31. [Google Scholar] [CrossRef] [PubMed]
- Basak, A.; Ernst, B.; Brewer, D.; Seidah, N.G.; Munzer, J.S.; Lazure, C.; Lajoie, G.A. Histidine-rich human salivary peptides are inhibitors of proprotein convertases furin and PC7 but act as substrates for PC1. J. Pept. Res. 1997, 49, 596–603. [Google Scholar] [CrossRef]
- Sochacki, K.A.; Barns, K.J.; Bucki, R.; Weisshaar, J.C. Real-time attack on single Escherichia coli cells by the human antimicrobial peptide LL-37. Proc. Natl. Acad. Sci. USA 2011, 108, E77–E81. [Google Scholar] [CrossRef]
- Batoni, G.; Maisetta, G.; Esin, S. Antimicrobial peptides and their interaction with biofilms of medically relevant bacteria. Biochim. Biophys. Acta 2016, 1858, 1044–1060. [Google Scholar] [CrossRef]
- Schromm, A.B.; Paulowski, L.; Kaconis, Y.; Kopp, F.; Koistinen, M.; Donoghue, A.; Keese, S.; Nehls, C.; Wernecke, J.; Garidel, P.; et al. Cathelicidin and PMB neutralize endotoxins by multifactorial mechanisms including LPS interaction and targeting of host cell membranes. Proc. Natl. Acad. Sci. USA 2021, 118, e2101721118. [Google Scholar] [CrossRef]
- Shurko, J.F.; Galega, R.S.; Li, C.; Lee, G.C. Evaluation of LL-37 antimicrobial peptide derivatives alone and in combination with vancomycin against S. aureus. J. Antibiot. 2018, 71, 971–974. [Google Scholar] [CrossRef]
- Neshani, A.; Zare, H.; Akbari Eidgahi, M.R.; Khaledi, A.; Ghazvini, K. Epinecidin-1, a highly potent marine antimicrobial peptide with anticancer and immunomodulatory activities. BMC Pharmacol. Toxicol. 2019, 20, 33. [Google Scholar] [CrossRef] [PubMed]
- Mohanram, H.; Bhattacharjya, S. Resurrecting inactive antimicrobial peptides from the lipopolysaccharide trap. Antimicrob. Agents Chemother. 2014, 58, 1987–1996. [Google Scholar] [CrossRef] [PubMed]
- Li, T.; Li, L.; Du, F.; Sun, L.; Shi, J.; Long, M.; Chen, Z. Activity and Mechanism of Action of Antifungal Peptides from Microorganisms: A Review. Molecules 2021, 26, 3438. [Google Scholar] [CrossRef] [PubMed]
- Malanovic, N.; Lohner, K. Gram-positive bacterial cell envelopes: The impact on the activity of antimicrobial peptides. Biochim. Biophys. Acta 2016, 1858, 936–946. [Google Scholar] [CrossRef] [PubMed]
- Malanovic, N.; Lohner, K. Antimicrobial Peptides Targeting Gram-Positive Bacteria. Pharmaceuticals 2016, 9, 59. [Google Scholar] [CrossRef]
- Garcia-Rubio, R.; de Oliveira, H.C.; Rivera, J.; Trevijano-Contador, N. The Fungal Cell Wall: Candida, Cryptococcus, and Aspergillus Species. Front. Microbiol. 2019, 10, 2993. [Google Scholar] [CrossRef]
- Le, C.F.; Fang, C.M.; Sekaran, S.D. Intracellular Targeting Mechanisms by Antimicrobial Peptides. Antimicrob. Agents Chemother. 2017, 61, e02340-16. [Google Scholar] [CrossRef]
- Hort, M.; Bertsche, U.; Nozinovic, S.; Dietrich, A.; Schrotter, A.S.; Mildenberger, L.; Axtmann, K.; Berscheid, A.; Bierbaum, G. The Role of beta-Glycosylated Wall Teichoic Acids in the Reduction of Vancomycin Susceptibility in Vancomycin-Intermediate Staphylococcus aureus. Microbiol. Spectr. 2021, 9, e0052821. [Google Scholar] [CrossRef]
- Munch, D.; Engels, I.; Muller, A.; Reder-Christ, K.; Falkenstein-Paul, H.; Bierbaum, G.; Grein, F.; Bendas, G.; Sahl, H.G.; Schneider, T. Structural variations of the cell wall precursor lipid II and their influence on binding and activity of the lipoglycopeptide antibiotic oritavancin. Antimicrob. Agents Chemother. 2015, 59, 772–781. [Google Scholar] [CrossRef] [PubMed]
- Panina, I.; Krylov, N.; Nolde, D.; Efremov, R.; Chugunov, A. Environmental and dynamic effects explain how nisin captures membrane-bound lipid II. Sci. Rep. 2020, 10, 8821. [Google Scholar] [CrossRef]
- Wen, P.C.; Vanegas, J.M.; Rempe, S.B.; Tajkhorshid, E. Probing key elements of teixobactin-lipid II interactions in membranes. Chem. Sci. 2018, 9, 6997–7008. [Google Scholar] [CrossRef] [PubMed]
- Hussein, M.; Karas, J.A.; Schneider-Futschik, E.K.; Chen, F.; Swarbrick, J.; Paulin, O.K.A.; Hoyer, D.; Baker, M.; Zhu, Y.; Li, J.; et al. The Killing Mechanism of Teixobactin against Methicillin-Resistant Staphylococcus aureus: An Untargeted Metabolomics Study. mSystems 2020, 5, e00077-20. [Google Scholar] [CrossRef] [PubMed]
- Schneider, T.; Kruse, T.; Wimmer, R.; Wiedemann, I.; Sass, V.; Pag, U.; Jansen, A.; Nielsen, A.K.; Mygind, P.H.; Raventos, D.S.; et al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II. Science 2010, 328, 1168–1172. [Google Scholar] [CrossRef] [PubMed]
- O’Connor, R.D.; Singh, M.; Chang, J.; Kim, S.J.; VanNieuwenhze, M.; Schaefer, J. Dual Mode of Action for Plusbacin A3 in Staphylococcus aureus. J. Phys. Chem. B 2017, 121, 1499–1505. [Google Scholar] [CrossRef]
- Cochrane, S.A.; Findlay, B.; Bakhtiary, A.; Acedo, J.Z.; Rodriguez-Lopez, E.M.; Mercier, P.; Vederas, J.C. Antimicrobial lipopeptide tridecaptin A1 selectively binds to Gram-negative lipid II. Proc. Natl. Acad. Sci. USA 2016, 113, 11561–11566. [Google Scholar] [CrossRef]
- Somner, E.A.; Reynolds, P.E. Inhibition of peptidoglycan biosynthesis by ramoplanin. Antimicrob. Agents Chemother. 1990, 34, 413–419. [Google Scholar] [CrossRef]
- El Ghachi, M.; Bouhss, A.; Barreteau, H.; Touze, T.; Auger, G.; Blanot, D.; Mengin-Lecreulx, D. Colicin M exerts its bacteriolytic effect via enzymatic degradation of undecaprenyl phosphate-linked peptidoglycan precursors. J. Biol. Chem. 2006, 281, 22761–22772. [Google Scholar] [CrossRef]
- Bierbaum, G.; Sahl, H.G. Autolytic system of Staphylococcus simulans 22: Influence of cationic peptides on activity of N-acetylmuramoyl-L-alanine amidase. J. Bacteriol. 1987, 169, 5452–5458. [Google Scholar] [CrossRef]
- Dash, R.; Bhattacharjya, S. Thanatin: An Emerging Host Defense Antimicrobial Peptide with Multiple Modes of Action. Int. J. Mol. Sci. 2021, 22, 1522. [Google Scholar] [CrossRef]
- Upert, G.; Luther, A.; Obrecht, D.; Ermert, P. Emerging peptide antibiotics with therapeutic potential. Med. Drug Discov. 2021, 9, 100078. [Google Scholar] [CrossRef]
- Brauner, A.; Alvendal, C.; Chromek, M.; Stopsack, K.H.; Ehrstrom, S.; Schroder, J.M.; Bohm-Starke, N. Psoriasin, a novel anti-Candida albicans adhesin. J. Mol. Med. 2018, 96, 537–545. [Google Scholar] [CrossRef] [PubMed]
- Kovacs, R.; Nagy, F.; Toth, Z.; Bozo, A.; Balazs, B.; Majoros, L. Synergistic effect of nikkomycin Z with caspofungin and micafungin against Candida albicans and Candida parapsilosis biofilms. Lett. Appl. Microbiol. 2019, 69, 271–278. [Google Scholar] [CrossRef] [PubMed]
- Buda De Cesare, G.; Cristy, S.A.; Garsin, D.A.; Lorenz, M.C. Antimicrobial Peptides: A New Frontier in Antifungal Therapy. mBio 2020, 11, e02123-20. [Google Scholar] [CrossRef] [PubMed]
- Ma, H.; Zhao, X.; Yang, L.; Su, P.; Fu, P.; Peng, J.; Yang, N.; Guo, G. Antimicrobial Peptide AMP-17 Affects Candida albicans by Disrupting Its Cell Wall and Cell Membrane Integrity. Infect. Drug Resist. 2020, 13, 2509–2520. [Google Scholar] [CrossRef]
- Kumar, D.K.; Choi, S.H.; Washicosky, K.J.; Eimer, W.A.; Tucker, S.; Ghofrani, J.; Lefkowitz, A.; McColl, G.; Goldstein, L.E.; Tanzi, R.E.; et al. Amyloid-beta peptide protects against microbial infection in mouse and worm models of Alzheimer’s disease. Sci. Transl. Med. 2016, 8, 340ra72. [Google Scholar] [CrossRef] [PubMed]
- Sinha, S.; Zheng, L.; Mu, Y.; Ng, W.J.; Bhattacharjya, S. Structure and Interactions of A Host Defense Antimicrobial Peptide Thanatin in Lipopolysaccharide Micelles Reveal Mechanism of Bacterial Cell Agglutination. Sci Rep. 2017, 7, 17795. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Q.Y.; Yan, Z.B.; Meng, Y.M.; Hong, X.Y.; Shao, G.; Ma, J.J.; Cheng, X.R.; Liu, J.; Kang, J.; Fu, C.Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef]
- Kabelka, I.; Vacha, R. Advances in Molecular Understanding of alpha-Helical Membrane-Active Peptides. Acc. Chem. Res. 2021, 54, 2196–2204. [Google Scholar] [CrossRef]
- Abrunhosa, F.; Faria, S.; Gomes, P.; Tomaz, I.; Pessoa, J.C.; Andreu, D.; Bastos, M. Interaction and lipid-induced conformation of two cecropin-melittin hybrid peptides depend on peptide and membrane composition. J. Phys. Chem. B 2005, 109, 17311–17319. [Google Scholar] [CrossRef]
- Wadhwani, P.; Sekaran, S.; Strandberg, E.; Burck, J.; Chugh, A.; Ulrich, A.S. Membrane Interactions of Latarcins: Antimicrobial Peptides from Spider Venom. Int. J. Mol. Sci. 2021, 22, 10156. [Google Scholar] [CrossRef] [PubMed]
- Arouri, A.; Dathe, M.; Blume, A. The helical propensity of KLA amphipathic peptides enhances their binding to gel-state lipid membranes. Biophys. Chem. 2013, 180, 10–21. [Google Scholar] [CrossRef] [PubMed]
- Marquette, A.; Bechinger, B. Biophysical Investigations Elucidating the Mechanisms of Action of Antimicrobial Peptides and Their Synergism. Biomolecules 2018, 8, 18. [Google Scholar] [CrossRef] [PubMed]
- Burck, J.; Roth, S.; Wadhwani, P.; Afonin, S.; Kanithasen, N.; Strandberg, E.; Ulrich, A.S. Conformation and membrane orientation of amphiphilic helical peptides by oriented circular dichroism. Biophys. J. 2008, 95, 3872–3881. [Google Scholar] [CrossRef] [PubMed]
- Palffy, R.; Gardlik, R.; Behuliak, M.; Kadasi, L.; Turna, J.; Celec, P. On the physiology and pathophysiology of antimicrobial peptides. Mol. Med. 2009, 15, 51–59. [Google Scholar] [CrossRef]
- Yang, L.; Harroun, T.A.; Weiss, T.M.; Ding, L.; Huang, H.W. Barrel-stave model or toroidal model? A case study on melittin pores. Biophys. J. 2001, 81, 1475–1485. [Google Scholar] [CrossRef]
- Laver, D.R. The barrel-stave model as applied to alamethicin and its analogs reevaluated. Biophys J. 1994, 66 Pt 1, 355–359. [Google Scholar] [CrossRef]
- Bessin, Y.; Saint, N.; Marri, L.; Marchini, D.; Molle, G. Antibacterial activity and pore-forming properties of ceratotoxins: A mechanism of action based on the barrel stave model. Biochim. Biophys. Acta. 2004, 1667, 148–156. [Google Scholar] [CrossRef]
- Langham, A.A.; Ahmad, A.S.; Kaznessis, Y.N. On the nature of antimicrobial activity: A model for protegrin-1 pores. J. Am. Chem. Soc. 2008, 130, 4338–4346. [Google Scholar] [CrossRef]
- Bishop, J.A.; Sharma, R.; Illei, P.B. Napsin A and thyroid transcription factor-1 expression in carcinomas of the lung, breast, pancreas, colon, kidney, thyroid, and malignant mesothelioma. Hum. Pathol. 2010, 41, 20–25. [Google Scholar] [CrossRef]
- Matsuzaki, K.; Murase, O.; Fujii, N.; Miyajima, K. An antimicrobial peptide, magainin 2, induced rapid flip-flop of phospholipids coupled with pore formation and peptide translocation. Biochemistry 1996, 35, 11361–11368. [Google Scholar] [CrossRef] [PubMed]
- Bolintineanu, D.S.; Vivcharuk, V.; Kaznessis, Y.N. Multiscale models of the antimicrobial peptide protegrin-1 on Gram-negative bacteria membranes. Int. J. Mol. Sci. 2012, 13, 11000–11011. [Google Scholar] [CrossRef] [PubMed]
- Rojko, N.; Dalla Serra, M.; Macek, P.; Anderluh, G. Pore formation by actinoporins, cytolysins from sea anemones. Biochim. Biophys. Acta 2016, 1858, 446–456. [Google Scholar] [CrossRef] [PubMed]
- McMillan, K.A.M.; Coombs, M.R.P. Review: Examining the Natural Role of Amphibian Antimicrobial Peptide Magainin. Molecules 2020, 25, 5436. [Google Scholar] [CrossRef]
- Rodrigues de Almeida, N.; Catazaro, J.; Krishnaiah, M.; Singh Chhonker, Y.; Murry, D.J.; Powers, R.; Conda-Sheridan, M. Understanding interactions of Citropin 1.1 Analogues with Model Membranes and Their Influence on Biological Activity. Peptides 2019, 119, 170119. [Google Scholar] [CrossRef]
- Lee, C.C.; Sun, Y.; Qian, S.; Huang, H.W. Transmembrane pores formed by human antimicrobial peptide LL-37. Biophys. J. 2011, 100, 1688–1696. [Google Scholar] [CrossRef]
- Majewska, M.; Zamlynny, V.; Pieta, I.S.; Nowakowski, R.; Pieta, P. Interaction of LL-37 human cathelicidin peptide with a model microbial-like lipid membrane. Bioelectrochemistry 2021, 141, 107842. [Google Scholar] [CrossRef]
- Matsuzaki, K.; Sugishita, K.; Ishibe, N.; Ueha, M.; Nakata, S.; Miyajima, K.; Epand, R.M. Relationship of membrane curvature to the formation of pores by magainin 2. Biochemistry 1998, 37, 11856–11863. [Google Scholar] [CrossRef]
- Galvan, A.E.; Chalon, M.C.; Rios Colombo, N.S.; Schurig-Briccio, L.A.; Sosa-Padilla, B.; Gennis, R.B.; Bellomio, A. Microcin J25 inhibits ubiquinol oxidase activity of purified cytochrome bd-I from Escherichia coli. Biochimie 2019, 160, 141–147. [Google Scholar] [CrossRef]
- Hasenoehrl, E.J.; Wiggins, T.J.; Berney, M. Bioenergetic Inhibitors: Antibiotic Efficacy and Mechanisms of Action in Mycobacterium tuberculosis. Front. Cell Infect. Microbiol. 2020, 10, 611683. [Google Scholar] [CrossRef]
- Luo, Y.; Song, Y. Mechanism of Antimicrobial Peptides: Antimicrobial, Anti-Inflammatory and Antibiofilm Activities. Int. J. Mol. Sci. 2021, 22, 11401. [Google Scholar] [CrossRef] [PubMed]
- Sim, S.; Wang, P.; Beyer, B.N.; Cutrona, K.J.; Radhakrishnan, M.L.; Elmore, D.E. Investigating the nucleic acid interactions of histone-derived antimicrobial peptides. FEBS Lett. 2017, 591, 706–717. [Google Scholar] [CrossRef] [PubMed]
- Park, C.B.; Kim, H.S.; Kim, S.C. Mechanism of action of the antimicrobial peptide buforin II: Buforin II kills microorganisms by penetrating the cell membrane and inhibiting cellular functions. Biochem. Biophys. Res. Commun. 1998, 244, 253–257. [Google Scholar] [CrossRef] [PubMed]
- Subbalakshmi, C.; Sitaram, N. Mechanism of antimicrobial action of indolicidin. FEMS Microbiol. Lett. 1998, 160, 91–96. [Google Scholar] [CrossRef]
- Ramamourthy, G.; Park, J.; Seo, C.; Vogel, H.J.; Park, Y. Antifungal and Antibiofilm Activities and the Mechanism of Action of Repeating Lysine-Tryptophan Peptides against Candida albicans. Microorganisms 2020, 8, 758. [Google Scholar] [CrossRef]
- Boman, H.G.; Agerberth, B.; Boman, A. Mechanisms of action on Escherichia coli of cecropin P1 and PR-39, two antibacterial peptides from pig intestine. Infect. Immun. 1993, 61, 2978–2984. [Google Scholar] [CrossRef]
- Sharma, S.; Khuller, G. DNA as the intracellular secondary target for antibacterial action of human neutrophil peptide-I against Mycobacterium tuberculosis H37Ra. Curr. Microbiol. 2001, 43, 74–76. [Google Scholar] [CrossRef]
- Chen, R.B.; Zhang, K.; Zhang, H.; Gao, C.Y.; Li, C.L. Analysis of the antimicrobial mechanism of porcine beta defensin 2 against E. coli by electron microscopy and differentially expressed genes. Sci. Rep. 2018, 8, 14711. [Google Scholar] [CrossRef]
- Zhang, K.; Zhang, H.; Gao, C.; Chen, R.; Li, C. Antimicrobial Mechanism of pBD2 against Staphylococcus aureus. Molecules 2020, 25, 3513. [Google Scholar] [CrossRef]
- Riciluca, K.C.T.; Oliveira, U.C.; Mendonca, R.Z.; Bozelli Junior, J.C.; Schreier, S.; da Silva Junior, P.I. Rondonin: Antimicrobial properties and mechanism of action. FEBS Open Bio 2021, 11, 2541–2559. [Google Scholar] [CrossRef]
- Marchand, C.; Krajewski, K.; Lee, H.F.; Antony, S.; Johnson, A.A.; Amin, R.; Roller, P.; Kvaratskhelia, M.; Pommier, Y. Covalent binding of the natural antimicrobial peptide indolicidin to DNA abasic sites. Nucleic Acids Res. 2006, 34, 5157–5165. [Google Scholar] [CrossRef] [PubMed]
- Collin, F.; Maxwell, A. The Microbial Toxin Microcin B17: Prospects for the Development of New Antibacterial Agents. J. Mol. Biol. 2019, 431, 3400–3426. [Google Scholar] [CrossRef] [PubMed]
- Jeanne Dit Fouque, K.; Hegemann, J.D.; Zirah, S.; Rebuffat, S.; Lescop, E.; Fernandez-Lima, F. Evidence of Cis/Trans-Isomerization at Pro7/Pro16 in the Lasso Peptide Microcin J25. J. Am. Soc. Mass Spectrom. 2019, 30, 1038–1045. [Google Scholar] [CrossRef] [PubMed]
- Delgado, M.A.; Rintoul, M.R.; Farias, R.N.; Salomon, R.A. Escherichia coli RNA polymerase is the target of the cyclopeptide antibiotic microcin J25. J. Bacteriol. 2001, 183, 4543–4550. [Google Scholar] [CrossRef] [PubMed]
- Sugiarto, H.; Yu, P.L. Mechanisms of action of ostrich beta-defensins against Escherichia coli. FEMS Microbiol. Lett. 2007, 270, 195–200. [Google Scholar] [CrossRef][Green Version]
- Xie, Q.; Wang, Y.; Zhang, M.; Wu, S.; Wei, W.; Xiao, W.; Wang, Y.; Zhao, J.; Liu, N.; Jin, Y.; et al. Recombinant HNP-1 Produced by Escherichia coli Triggers Bacterial Apoptosis and Exhibits Antibacterial Activity against Drug-Resistant Bacteria. Microbiol. Spectr. 2022, 10, e0086021. [Google Scholar] [CrossRef]
- Welch, N.G.; Li, W.; Hossain, M.A.; Separovic, F.; O’Brien-Simpson, N.M.; Wade, J.D. (Re)Defining the Proline-Rich Antimicrobial Peptide Family and the Identification of Putative New Members. Front. Chem. 2020, 8, 607769. [Google Scholar] [CrossRef]
- Roy, R.N.; Lomakin, I.B.; Gagnon, M.G.; Steitz, T.A. The mechanism of inhibition of protein synthesis by the proline-rich peptide oncocin. Nat. Struct. Mol. Biol. 2015, 22, 466–469. [Google Scholar] [CrossRef]
- Graf, M.; Wilson, D.N. Intracellular Antimicrobial Peptides Targeting the Protein Synthesis Machinery. Adv. Exp. Med. Biol. 2019, 1117, 73–89. [Google Scholar] [CrossRef]
- Krizsan, A.; Prahl, C.; Goldbach, T.; Knappe, D.; Hoffmann, R. Short Proline-Rich Antimicrobial Peptides Inhibit Either the Bacterial 70S Ribosome or the Assembly of its Large 50S Subunit. ChemBioChem 2015, 16, 2304–2308. [Google Scholar] [CrossRef]
- Brakel, A.; Krizsan, A.; Itzenga, R.; Kraus, C.N.; Otvos, L.; Hoffmann, R., Jr. Influence of Substitutions in the Binding Motif of Proline-Rich Antimicrobial Peptide ARV-1502 on 70S Ribosome Binding and Antimicrobial Activity. Int. J. Mol. Sci. 2022, 23, 3150. [Google Scholar] [CrossRef] [PubMed]
- Li, W.; Lin, F.; Hung, A.; Barlow, A.; Sani, M.A.; Paolini, R.; Singleton, W.; Holden, J.; Hossain, M.A.; Separovic, F.; et al. Enhancing proline-rich antimicrobial peptide action by homodimerization: Influence of bifunctional linker. Chem. Sci. 2022, 13, 2226–2237. [Google Scholar] [CrossRef] [PubMed]
- Otvos, L., Jr.; Insug, O.; Rogers, M.E.; Consolvo, P.J.; Condie, B.A.; Lovas, S.; Bulet, P.; Blaszczyk-Thurin, M. Interaction between heat shock proteins and antimicrobial peptides. Biochemistry 2000, 39, 14150–14159. [Google Scholar] [CrossRef] [PubMed]
- Kragol, G.; Lovas, S.; Varadi, G.; Condie, B.A.; Hoffmann, R.; Otvos, L., Jr. The antibacterial peptide pyrrhocoricin inhibits the ATPase actions of DnaK and prevents chaperone-assisted protein folding. Biochemistry 2001, 40, 3016–3026. [Google Scholar] [CrossRef] [PubMed]
- Di Somma, A.; Avitabile, C.; Cirillo, A.; Moretta, A.; Merlino, A.; Paduano, L.; Duilio, A.; Romanelli, A. The antimicrobial peptide Temporin L impairs E. coli cell division by interacting with FtsZ and the divisome complex. Biochim. Biophys. Acta Gen. Subj. 2020, 1864, 129606. [Google Scholar] [CrossRef] [PubMed]
- Di Somma, A.; Cane, C.; Moretta, A.; Duilio, A. Interaction of Temporin-L Analogues with the E. coli FtsZ Protein. Antibiotics 2021, 10, 704. [Google Scholar] [CrossRef]
- Yadavalli, S.S.; Carey, J.N.; Leibman, R.S.; Chen, A.I.; Stern, A.M.; Roggiani, M.; Lippa, A.M.; Goulian, M. Antimicrobial peptides trigger a division block in Escherichia coli through stimulation of a signalling system. Nat. Commun. 2016, 7, 12340. [Google Scholar] [CrossRef]
- Okuda, K.; Zendo, T.; Sugimoto, S.; Iwase, T.; Tajima, A.; Yamada, S.; Sonomoto, K.; Mizunoe, Y. Effects of bacteriocins on methicillin-resistant Staphylococcus aureus biofilm. Antimicrob. Agents Chemother. 2013, 57, 5572–5579. [Google Scholar] [CrossRef]
- Chen, Z.; Yang, G.; Lu, S.; Chen, D.; Fan, S.; Xu, J.; Wu, B.; He, J. Design and antimicrobial activities of LL-37 derivatives inhibiting the formation of Streptococcus mutans biofilm. Chem. Biol. Drug Des. 2019, 93, 1175–1185. [Google Scholar] [CrossRef]
- Wang, H.Y.; Lin, L.; Tan, L.S.; Yu, H.Y.; Cheng, J.W.; Pan, Y.P. Molecular pathways underlying inhibitory effect of antimicrobial peptide Nal-P-113 on bacteria biofilms formation of Porphyromonas gingivalis W83 by DNA microarray. BMC Microbiol. 2017, 17, 37. [Google Scholar] [CrossRef]
- Overhage, J.; Campisano, A.; Bains, M.; Torfs, E.C.; Rehm, B.H.; Hancock, R.E. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect. Immun. 2008, 76, 4176–4182. [Google Scholar] [CrossRef] [PubMed]
- Dean, S.N.; Bishop, B.M.; van Hoek, M.L. Susceptibility of Pseudomonas aeruginosa Biofilm to Alpha-Helical Peptides: D-enantiomer of LL-37. Front. Microbiol. 2011, 2, 128. [Google Scholar] [CrossRef] [PubMed]
- Zsila, F.; Ricci, M.; Szigyarto, I.C.; Singh, P.; Beke-Somfai, T. Quorum Sensing Pseudomonas Quinolone Signal Forms Chiral Supramolecular Assemblies with the Host Defense Peptide LL-37. Front. Mol. Biosci. 2021, 8, 742023. [Google Scholar] [CrossRef] [PubMed]
- Cai, S.; Meng, K.; Liu, P.; Cao, X.; Wang, G. Suppressive effects of gecko cathelicidin on biofilm formation and cariogenic virulence factors of Streptococcus mutans. Arch. Oral Biol. 2021, 129, 105205. [Google Scholar] [CrossRef] [PubMed]
- Haisma, E.M.; de Breij, A.; Chan, H.; van Dissel, J.T.; Drijfhout, J.W.; Hiemstra, P.S.; El Ghalbzouri, A.; Nibbering, P.H. LL-37-derived peptides eradicate multidrug-resistant Staphylococcus aureus from thermally wounded human skin equivalents. Antimicrob. Agents Chemother. 2014, 58, 4411–4419. [Google Scholar] [CrossRef] [PubMed]
- De la Fuente-Nunez, C.; Korolik, V.; Bains, M.; Nguyen, U.; Breidenstein, E.B.; Horsman, S.; Lewenza, S.; Burrows, L.; Hancock, R.E. Inhibition of bacterial biofilm formation and swarming motility by a small synthetic cationic peptide. Antimicrob. Agents Chemother. 2012, 56, 2696–2704. [Google Scholar] [CrossRef]
- Brancatisano, F.L.; Maisetta, G.; Di Luca, M.; Esin, S.; Bottai, D.; Bizzarri, R.; Campa, M.; Batoni, G. Inhibitory effect of the human liver-derived antimicrobial peptide hepcidin 20 on biofilms of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains of Staphylococcus epidermidis. Biofouling 2014, 30, 435–446. [Google Scholar] [CrossRef]
- Zhu, C.; Tan, H.; Cheng, T.; Shen, H.; Shao, J.; Guo, Y.; Shi, S.; Zhang, X. Human beta-defensin 3 inhibits antibiotic-resistant Staphylococcus biofilm formation. J. Surg. Res. 2013, 183, 204–213. [Google Scholar] [CrossRef]
- Libardo, M.D.J.; Bahar, A.A.; Ma, B.; Fu, R.; McCormick, L.E.; Zhao, J.; McCallum, S.A.; Nussinov, R.; Ren, D.; Angeles-Boza, A.M.; et al. Nuclease activity gives an edge to host-defense peptide piscidin 3 over piscidin 1, rendering it more effective against persisters and biofilms. FEBS J. 2017, 284, 3662–3683. [Google Scholar] [CrossRef]
- Conlon, B.P.; Nakayasu, E.S.; Fleck, L.E.; LaFleur, M.D.; Isabella, V.M.; Coleman, K.; Leonard, S.N.; Smith, R.D.; Adkins, J.N.; Lewis, K. Activated ClpP kills persisters and eradicates a chronic biofilm infection. Nature 2013, 503, 365–370. [Google Scholar] [CrossRef]
- Ansari, J.M.; Abraham, N.M.; Massaro, J.; Murphy, K.; Smith-Carpenter, J.; Fikrig, E. Anti-Biofilm Activity of a Self-Aggregating Peptide against Streptococcus mutans. Front. Microbiol. 2017, 8, 488. [Google Scholar] [CrossRef] [PubMed]
- Di Somma, A.; Recupido, F.; Cirillo, A.; Romano, A.; Romanelli, A.; Caserta, S.; Guido, S.; Duilio, A. Antibiofilm Properties of Temporin-L on Pseudomonas fluorescens in Static and In-Flow Conditions. Int. J. Mol. Sci. 2020, 21, 8526. [Google Scholar] [CrossRef] [PubMed]
- Grassi, L.; Batoni, G.; Ostyn, L.; Rigole, P.; Van den Bossche, S.; Rinaldi, A.C.; Maisetta, G.; Esin, S.; Coenye, T.; Crabbe, A. The Antimicrobial Peptide lin-SB056-1 and Its Dendrimeric Derivative Prevent Pseudomonas aeruginosa Biofilm Formation in Physiologically Relevant Models of Chronic Infections. Front. Microbiol. 2019, 10, 198. [Google Scholar] [CrossRef] [PubMed]
- Yu, H.; Liu, X.; Wang, C.; Qiao, X.; Wu, S.; Wang, H.; Feng, L.; Wang, Y. Assessing the potential of four cathelicidins for the management of mouse candidiasis and Candida albicans biofilms. Biochimie 2016, 121, 268–277. [Google Scholar] [CrossRef]
- Yasir, M.; Willcox, M.D.P.; Dutta, D. Action of Antimicrobial Peptides against Bacterial Biofilms. Materials 2018, 11, 2468. [Google Scholar] [CrossRef]
- Hinsa, S.M.; Espinosa-Urgel, M.; Ramos, J.L.; O’Toole, G.A. Transition from reversible to irreversible attachment during biofilm formation by Pseudomonas fluorescens WCS365 requires an ABC transporter and a large secreted protein. Mol. Microbiol. 2003, 49, 905–918. [Google Scholar] [CrossRef]
- Parducho, K.R.; Beadell, B.; Ybarra, T.K.; Bush, M.; Escalera, E.; Trejos, A.T.; Chieng, A.; Mendez, M.; Anderson, C.; Park, H.; et al. The Antimicrobial Peptide Human Beta-Defensin 2 Inhibits Biofilm Production of Pseudomonas aeruginosa without Compromising Metabolic Activity. Front. Immunol. 2020, 11, 805. [Google Scholar] [CrossRef]
- Geng, H.; Yuan, Y.; Adayi, A.; Zhang, X.; Song, X.; Gong, L.; Zhang, X.; Gao, P. Engineered chimeric peptides with antimicrobial and titanium-binding functions to inhibit biofilm formation on Ti implants. Mater. Sci. Eng. C Mater. Biol. Appl. 2018, 82, 141–154. [Google Scholar] [CrossRef]
- De la Fuente-Nunez, C.; Reffuveille, F.; Haney, E.F.; Straus, S.K.; Hancock, R.E. Broad-spectrum anti-biofilm peptide that targets a cellular stress response. PLoS Pathog. 2014, 10, e1004152. [Google Scholar] [CrossRef]
- Parn, K.; Eriste, E.; Langel, U. The Antimicrobial and Antiviral Applications of Cell-Penetrating Peptides. Methods Mol. Biol. 2015, 1324, 223–245. [Google Scholar] [CrossRef]
- Maiti, B.K. Potential Role of Peptide-Based Antiviral Therapy Against SARS-CoV-2 Infection. ACS Pharmacol. Transl. Sci. 2020, 3, 783–785. [Google Scholar] [CrossRef] [PubMed]
- Feng, M.; Fei, S.; Xia, J.; Labropoulou, V.; Swevers, L.; Sun, J. Antimicrobial Peptides as Potential Antiviral Factors in Insect Antiviral Immune Response. Front. Immunol. 2020, 11, 2030. [Google Scholar] [CrossRef] [PubMed]
- Ahmed, A.; Siman-Tov, G.; Hall, G.; Bhalla, N.; Narayanan, A. Human Antimicrobial Peptides as Therapeutics for Viral Infections. Viruses 2019, 11, 704. [Google Scholar] [CrossRef] [PubMed]
- Tonk, M.; Ruzek, D.; Vilcinskas, A. Compelling Evidence for the Activity of Antiviral Peptides against SARS-CoV-2. Viruses 2021, 13, 912. [Google Scholar] [CrossRef]
- Diamond, G.; Molchanova, N.; Herlan, C.; Fortkort, J.A.; Lin, J.S.; Figgins, E.; Bopp, N.; Ryan, L.K.; Chung, D.; Adcock, R.S.; et al. Potent Antiviral Activity against HSV-1 and SARS-CoV-2 by Antimicrobial Peptoids. Pharmaceuticals 2021, 14, 304. [Google Scholar] [CrossRef]
- Currie, S.M.; Findlay, E.G.; McFarlane, A.J.; Fitch, P.M.; Bottcher, B.; Colegrave, N.; Paras, A.; Jozwik, A.; Chiu, C.; Schwarze, J.; et al. Cathelicidins Have Direct Antiviral Activity against Respiratory Syncytial Virus In Vitro and Protective Function In Vivo in Mice and Humans. J. Immunol. 2016, 196, 2699–2710. [Google Scholar] [CrossRef]
- Moreno-Habel, D.A.; Biglang-awa, I.M.; Dulce, A.; Luu, D.D.; Garcia, P.; Weers, P.M.; Haas-Stapleton, E.J. Inactivation of the budded virus of Autographa californica M nucleopolyhedrovirus by gloverin. J. Invertebr. Pathol. 2012, 110, 92–101. [Google Scholar] [CrossRef]
- Li, Q.; Zhao, Z.; Zhou, D.; Chen, Y.; Hong, W.; Cao, L.; Yang, J.; Zhang, Y.; Shi, W.; Cao, Z.; et al. Virucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses. Peptides 2011, 32, 1518–1525. [Google Scholar] [CrossRef]
- Albiol Matanic, V.C.; Castilla, V. Antiviral activity of antimicrobial cationic peptides against Junin virus and herpes simplex virus. Int. J. Antimicrob. Agents 2004, 23, 382–389. [Google Scholar] [CrossRef]
- Yu, Y.; Cooper, C.L.; Wang, G.; Morwitzer, M.J.; Kota, K.; Tran, J.P.; Bradfute, S.B.; Liu, Y.; Shao, J.; Zhang, A.K.; et al. Engineered Human Cathelicidin Antimicrobial Peptides Inhibit Ebola Virus Infection. iScience 2020, 23, 100999. [Google Scholar] [CrossRef]
- Xu, C.; Wang, A.; Marin, M.; Honnen, W.; Ramasamy, S.; Porter, E.; Subbian, S.; Pinter, A.; Melikyan, G.B.; Lu, W.; et al. Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry. Viruses 2021, 13, 1246. [Google Scholar] [CrossRef] [PubMed]
- Furci, L.; Sironi, F.; Tolazzi, M.; Vassena, L.; Lusso, P. Alpha-defensins block the early steps of HIV-1 infection: Interference with the binding of gp120 to CD4. Blood 2007, 109, 2928–2935. [Google Scholar] [CrossRef] [PubMed]
- Chang, T.L.; Vargas, J.; DelPortillo, A., Jr.; Klotman, M.E. Dual role of alpha-defensin-1 in anti-HIV-1 innate immunity. J. Clin. Investig. 2005, 115, 765–773. [Google Scholar] [CrossRef]
- Dugan, A.S.; Maginnis, M.S.; Jordan, J.A.; Gasparovic, M.L.; Manley, K.; Page, R.; Williams, G.; Porter, E.; O’Hara, B.A.; Atwood, W.J. Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells. J. Biol. Chem. 2008, 283, 31125–31132. [Google Scholar] [CrossRef] [PubMed]
- Zhao, H.; Zhou, J.; Zhang, K.; Chu, H.; Liu, D.; Poon, V.K.; Chan, C.C.; Leung, H.C.; Fai, N.; Lin, Y.P.; et al. A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses. Sci. Rep. 2016, 6, 22008. [Google Scholar] [CrossRef] [PubMed]
- Zhao, H.; To, K.K.W.; Sze, K.H.; Yung, T.T.; Bian, M.; Lam, H.; Yeung, M.L.; Li, C.; Chu, H.; Yuen, K.Y. A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. Nat. Commun. 2020, 11, 4252. [Google Scholar] [CrossRef]
- Nguyen, E.K.; Nemerow, G.R.; Smith, J.G. Direct evidence from single-cell analysis that human {alpha}-defensins block adenovirus uncoating to neutralize infection. J. Virol. 2010, 84, 4041–4049. [Google Scholar] [CrossRef]
- Hazrati, E.; Galen, B.; Lu, W.; Wang, W.; Ouyang, Y.; Keller, M.J.; Lehrer, R.I.; Herold, B.C. Human alpha- and beta-defensins block multiple steps in herpes simplex virus infection. J. Immunol. 2006, 177, 8658–8666. [Google Scholar] [CrossRef]
- Tripathi, S.; Wang, G.; White, M.; Qi, L.; Taubenberger, J.; Hartshorn, K.L. Antiviral Activity of the Human Cathelicidin, LL-37, and Derived Peptides on Seasonal and Pandemic Influenza A Viruses. PLoS ONE 2015, 10, e0124706. [Google Scholar] [CrossRef]
- Wong, J.H.; Legowska, A.; Rolka, K.; Ng, T.B.; Hui, M.; Cho, C.H.; Lam, W.W.; Au, S.W.; Gu, O.W.; Wan, D.C. Effects of cathelicidin and its fragments on three key enzymes of HIV-1. Peptides 2011, 32, 1117–1122. [Google Scholar] [CrossRef]
- Hong, W.; Li, T.; Song, Y.; Zhang, R.; Zeng, Z.; Han, S.; Zhang, X.; Wu, Y.; Li, W.; Cao, Z. Inhibitory activity and mechanism of two scorpion venom peptides against herpes simplex virus type 1. Antiviral Res. 2014, 102, 1–10. [Google Scholar] [CrossRef]
- Solanki, S.S.; Singh, P.; Kashyap, P.; Sansi, M.S.; Ali, S.A. Promising role of defensins peptides as therapeutics to combat against viral infection. Microb. Pathog. 2021, 155, 104930. [Google Scholar] [CrossRef] [PubMed]
- Mondal, A.; Dawson, A.R.; Potts, G.K.; Freiberger, E.C.; Baker, S.F.; Moser, L.A.; Bernard, K.A.; Coon, J.J.; Mehle, A. Influenza virus recruits host protein kinase C to control assembly and activity of its replication machinery. eLife 2017, 6, e26910. [Google Scholar] [CrossRef]
- Salvatore, M.; Garcia-Sastre, A.; Ruchala, P.; Lehrer, R.I.; Chang, T.; Klotman, M.E. alpha-Defensin inhibits influenza virus replication by cell-mediated mechanism(s). J. Infect. Dis. 2007, 196, 835–843. [Google Scholar] [CrossRef] [PubMed]
- Okoye, A.A.; Fromentin, R.; Takata, H.; Brehm, J.H.; Fukazawa, Y.; Randall, B.; Pardons, M.; Tai, V.; Tang, J.; Smedley, J.; et al. The ingenol-based protein kinase C agonist GSK445A is a potent inducer of HIV and SIV RNA transcription. PLoS Pathog. 2022, 18, e1010245. [Google Scholar] [CrossRef] [PubMed]
- Kudoh, A.; Takahama, S.; Sawasaki, T.; Ode, H.; Yokoyama, M.; Okayama, A.; Ishikawa, A.; Miyakawa, K.; Matsunaga, S.; Kimura, H.; et al. The phosphorylation of HIV-1 Gag by atypical protein kinase C facilitates viral infectivity by promoting Vpr incorporation into virions. Retrovirology 2014, 11, 9. [Google Scholar] [CrossRef]
- He, M.; Zhang, H.; Li, Y.; Wang, G.; Tang, B.; Zhao, J.; Huang, Y.; Zheng, J. Cathelicidin-Derived Antimicrobial Peptides Inhibit Zika Virus Through Direct Inactivation and Interferon Pathway. Front. Immunol. 2018, 9, 722. [Google Scholar] [CrossRef]
- Ji, Z.; Li, F.; Xia, Z.; Guo, X.; Gao, M.; Sun, F.; Cheng, Y.; Wu, Y.; Li, W.; Ali, S.A.; et al. The Scorpion Venom Peptide Smp76 Inhibits Viral Infection by Regulating Type-I Interferon Response. Virol. Sin. 2018, 33, 545–556. [Google Scholar] [CrossRef]
- Lee, E.Y.; Lee, M.W.; Wong, G.C.L. Modulation of toll-like receptor signaling by antimicrobial peptides. Semin. Cell Dev. Biol. 2019, 88, 173–184. [Google Scholar] [CrossRef]
- Holani, R.; Babbar, A.; Blyth, G.A.D.; Lopes, F.; Jijon, H.; McKay, D.M.; Hollenberg, M.D.; Cobo, E.R. Cathelicidin-mediated lipopolysaccharide signaling via intracellular TLR4 in colonic epithelial cells evokes CXCL8 production. Gut Microbes 2020, 12, 1785802. [Google Scholar] [CrossRef]
- Barlow, P.G.; Svoboda, P.; Mackellar, A.; Nash, A.A.; York, I.A.; Pohl, J.; Davidson, D.J.; Donis, R.O. Antiviral activity and increased host defense against influenza infection elicited by the human cathelicidin LL-37. PLoS ONE 2011, 6, e25333. [Google Scholar] [CrossRef] [PubMed]
- LeMessurier, K.S.; Lin, Y.; McCullers, J.A.; Samarasinghe, A.E. Antimicrobial peptides alter early immune response to influenza A virus infection in C57BL/6 mice. Antivir. Res. 2016, 133, 208–217. [Google Scholar] [CrossRef] [PubMed]
- Liang, W.; Diana, J. The Dual Role of Antimicrobial Peptides in Autoimmunity. Front. Immunol. 2020, 11, 2077. [Google Scholar] [CrossRef] [PubMed]
- Mackenzie-Dyck, S.; Latimer, L.; Atanley, E.; Kovacs-Nolan, J.; Attah-Poku, S.; Babiuk, L.A.; van Drunen Littel-van den Hurk, S. Immunogenicity of a bovine herpesvirus 1 glycoprotein D DNA vaccine complexed with bovine neutrophil beta-defensin 3. Clin. Vaccine Immunol. 2015, 22, 79–90. [Google Scholar] [CrossRef]
- Riedl, P.; Reimann, J.; Schirmbeck, R. Peptides containing antigenic and cationic domains have enhanced, multivalent immunogenicity when bound to DNA vaccines. J. Mol. Med. 2004, 82, 144–152. [Google Scholar] [CrossRef]
- Ghosh, S.K.; Weinberg, A. Ramping Up Antimicrobial Peptides Against Severe Acute Respiratory Syndrome Coronavirus-2. Front. Mol. Biosci. 2021, 8, 620806. [Google Scholar] [CrossRef] [PubMed]
- Mackenzie-Dyck, S.; Kovacs-Nolan, J.; Snider, M.; Babiuk, L.A.; van Drunen Littel-van den Hurk, S. Inclusion of the bovine neutrophil beta-defensin 3 with glycoprotein D of bovine herpesvirus 1 in a DNA vaccine modulates immune responses of mice and cattle. Clin. Vaccine Immunol. 2014, 21, 463–477. [Google Scholar] [CrossRef]
- Romeli, S.; Hassan, S.S.; Yap, W.B. Multi-Epitope Peptide-Based and Vaccinia-Based Universal Influenza Vaccine Candidates Subjected to Clinical Trials. Malays. J. Med. Sci. 2020, 27, 10–20. [Google Scholar] [CrossRef]
- Wang, C.; Wang, S.; Li, D.; Wei, D.Q.; Zhao, J.; Wang, J. Human Intestinal Defensin 5 Inhibits SARS-CoV-2 Invasion by Cloaking ACE2. Gastroenterology 2020, 159, 1145–1147.e4. [Google Scholar] [CrossRef]
- Bakovic, A.; Risner, K.; Bhalla, N.; Alem, F.; Chang, T.L.; Weston, W.; Harness, J.A.; Narayanan, A. Brilacidin, a COVID-19 Drug Candidate, Exhibits Potent In Vitro Antiviral Activity Against SARS-CoV-2. bioRxiv 2020. [Google Scholar] [CrossRef]
- Bhattacharya, R.; Gupta, A.M.; Mitra, S.; Mandal, S.; Biswas, S.R. A natural food preservative peptide nisin can interact with the SARS-CoV-2 spike protein receptor human ACE2. Virology 2021, 552, 107–111. [Google Scholar] [CrossRef] [PubMed]
- Liscano, Y.; Onate-Garzon, J.; Ocampo-Ibanez, I.D. In Silico Discovery of Antimicrobial Peptides as an Alternative to Control SARS-CoV-2. Molecules 2020, 25, 5535. [Google Scholar] [CrossRef] [PubMed]
- Zhang, R.; Jiang, X.; Qiao, J.; Wang, Z.; Tong, A.; Yang, J.; Yang, S.; Yang, L. Antimicrobial peptide DP7 with potential activity against SARS coronavirus infections. Signal Transduct. Target. Ther. 2021, 6, 140. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.; Wang, S.; Li, D.; Chen, P.; Han, S.; Zhao, G.; Chen, Y.; Zhao, J.; Xiong, J.; Qiu, J.; et al. Human Cathelicidin Inhibits SARS-CoV-2 Infection: Killing Two Birds with One Stone. ACS Infect. Dis. 2021, 7, 1545–1554. [Google Scholar] [CrossRef] [PubMed]
- Zhang, L.; Ghosh, S.K.; Basavarajappa, S.C.; Chen, Y.; Shhreestha, P.; Penfield, J.; Brewer, A.; Ramakrishnan, P.; Buck, M.; Weinberg, A. HBD-2 binds SARS-CoV-2 RBD and blocks viral entry: Strategy to combat COVID-19. iScience 2022, 25, 103856. [Google Scholar] [CrossRef]
- Mahnam, K.; Lotfi, M.; Shapoorabadi, F.A. Examining the interactions scorpion venom peptides (HP1090, Meucin-13, and Meucin-18) with the receptor binding domain of the coronavirus spike protein to design a mutated therapeutic peptide. J. Mol. Graph. Model. 2021, 107, 107952. [Google Scholar] [CrossRef] [PubMed]
- Bansal, R.; Mohagaonkar, S.; Sen, A.; Khanam, U.; Rathi, B. In-silico study of peptide-protein interaction of antimicrobial peptides potentially targeting SARS and SARS-CoV-2 nucleocapsid protein. In Silico Pharmacol. 2021, 9, 46. [Google Scholar] [CrossRef]
- Kudryashova, E.; Zani, A.; Vilmen, G.; Sharma, A.; Lu, W.; Yount, J.S.; Kudryashov, D.S. Inhibition of SARS-CoV-2 Infection by Human Defensin HNP1 and Retrocyclin RC-101. J. Mol. Biol. 2021, 434, 167225. [Google Scholar] [CrossRef]
- Mahendran, A.S.K.; Lim, Y.S.; Fang, C.M.; Loh, H.S.; Le, C.F. The Potential of Antiviral Peptides as COVID-19 Therapeutics. Front. Pharmacol. 2020, 11, 575444. [Google Scholar] [CrossRef]
- Negahdaripour, M.; Rahbar, M.R.; Mosalanejad, Z.; Gholami, A. Theta-Defensins to Counter COVID-19 as Furin Inhibitors: In Silico Efficiency Prediction and Novel Compound Design. Comput. Math. Methods Med. 2022, 2022, 9735626. [Google Scholar] [CrossRef]
- Muller, H.; Salzig, D.; Czermak, P. Considerations for the process development of insect-derived antimicrobial peptide production. Biotechnol. Prog. 2015, 31, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Kasser, L.; Rotter, M.; Coletta, L.; Salzig, D.; Czermak, P. Process intensification for the continuous production of an antimicrobial peptide in stably-transformed Sf-9 insect cells. Sci. Rep. 2022, 12, 1086. [Google Scholar] [CrossRef]
- Roldan-Tapia, M.; Anne, J.; Reyes, A.G.; Carrasco, U.; Millan-Pacheco, C.; Barrios-Gonzalez, J.; Mejia, A. Streptomyces as Overexpression System for Heterologous Production of an Antimicrobial Peptide. Protein Pept. Lett. 2017, 24, 483–488. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Rima, M.; Rima, M.; Fajloun, Z.; Sabatier, J.M.; Bechinger, B.; Naas, T. Antimicrobial Peptides: A Potent Alternative to Antibiotics. Antibiotics 2021, 10, 1095. [Google Scholar] [CrossRef]
- Whelan, C.; Roark, B.; Sonmez, K. Designing antimicrobial peptides with weighted finite-state transducers. Annu. Int. Conf. IEEE Eng. Med. Biol. Soc. 2010, 2010, 764–767. [Google Scholar] [CrossRef] [PubMed]
- Nuti, N.; Rottmann, P.; Stucki, A.; Koch, P.; Panke, S.; Dittrich, P.S. A Multiplexed Cell-Free Assay to Screen for Antimicrobial Peptides in Double Emulsion Droplets. Angew. Chem. Int. Ed. Engl. 2022, 61, e202114632. [Google Scholar] [CrossRef]
- Tanhaieian, A.; Sekhavati, M.H.; Ahmadi, F.S.; Mamarabadi, M. Heterologous expression of a broad-spectrum chimeric antimicrobial peptide in Lactococcus lactis: Its safety and molecular modeling evaluation. Microb. Pathog. 2018, 125, 51–59. [Google Scholar] [CrossRef]
- Papo, N.; Shai, Y. Effect of drastic sequence alteration and D-amino acid incorporation on the membrane binding behavior of lytic peptides. Biochemistry 2004, 43, 6393–6403. [Google Scholar] [CrossRef]
- Liu, B.; Zhang, W.; Gou, S.; Huang, H.; Yao, J.; Yang, Z.; Liu, H.; Zhong, C.; Liu, B.; Ni, J.; et al. Intramolecular cyclization of the antimicrobial peptide Polybia-MPI with triazole stapling: Influence on stability and bioactivity. J. Pept. Sci. 2017, 23, 824–832. [Google Scholar] [CrossRef]
- Li, D.; Yang, Y.; Li, R.; Huang, L.; Wang, Z.; Deng, Q.; Dong, S. N-terminal acetylation of antimicrobial peptide L163 improves its stability against protease degradation. J. Pept. Sci. 2021, 27, e3337. [Google Scholar] [CrossRef]
- Ortiz-Gomez, V.; Rodriguez-Ramos, V.D.; Maldonado-Hernandez, R.; Gonzalez-Feliciano, J.A.; Nicolau, E. Antimicrobial Polymer-Peptide Conjugates Based on Maximin H5 and PEG to Prevent Biofouling of E. coli and P. aeruginosa. ACS Appl. Mater. Interfaces 2020, 12, 46991–47001. [Google Scholar] [CrossRef] [PubMed]
- Hu, Y.; Chen, Y.; Lin, L.; Zhang, J.; Lan, R.; Wu, B. Studies on antimicrobial peptide-loaded nanomaterial for root caries restorations to inhibit periodontitis related pathogens in periodontitis care. J. Microencapsul. 2021, 38, 89–99. [Google Scholar] [CrossRef]
- Thankappan, B.; Sivakumar, J.; Asokan, S.; Ramasamy, M.; Pillai, M.M.; Selvakumar, R.; Angayarkanni, J. Dual antimicrobial and anticancer activity of a novel synthetic alpha-helical antimicrobial peptide. Eur. J. Pharm. Sci. 2021, 161, 105784. [Google Scholar] [CrossRef] [PubMed]
- Rezende, S.B.; Oshiro, K.G.N.; Junior, N.G.O.; Franco, O.L.; Cardoso, M.H. Advances on chemically modified antimicrobial peptides for generating peptide antibiotics. Chem. Commun. 2021, 57, 11578–11590. [Google Scholar] [CrossRef]
- Huang, H.W. DAPTOMYCIN, its membrane-active mechanism vs. that of other antimicrobial peptides. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183395. [Google Scholar] [CrossRef] [PubMed]
- Dai, C.; Wang, Y.; Sharma, G.; Shen, J.; Velkov, T.; Xiao, X. Polymyxins-Curcumin Combination Antimicrobial Therapy: Safety Implications and Efficacy for Infection Treatment. Antioxidants 2020, 9, 506. [Google Scholar] [CrossRef]
- Lei, J.; Sun, L.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q. The antimicrobial peptides and their potential clinical applications. Am. J. Transl. Res. 2019, 11, 3919–3931. [Google Scholar]
- Taylor, S.D.; Palmer, M. The action mechanism of daptomycin. Bioorg. Med. Chem. 2016, 24, 6253–6268. [Google Scholar] [CrossRef]
- Espona, M.; Ferrandez, O.; Grau, S.; Carmona, A. Enfuvirtide: First drug of a new family of antiretroviral agents. Farm. Hosp. 2005, 29, 375–383. [Google Scholar] [CrossRef]
- Mousavi Maleki, M.S.; Rostamian, M.; Madanchi, H. Antimicrobial peptides and other peptide-like therapeutics as promising candidates to combat SARS-CoV-2. Expert Rev. Anti-Infect. Ther. 2021, 19, 1205–1217. [Google Scholar] [CrossRef]
- Kollef, M.; Pittet, D.; Sanchez Garcia, M.; Chastre, J.; Fagon, J.Y.; Bonten, M.; Hyzy, R.; Fleming, T.R.; Fuchs, H.; Bellm, L.; et al. A randomized double-blind trial of iseganan in prevention of ventilator-associated pneumonia. Am. J. Respir. Crit. Care Med. 2006, 173, 91–97. [Google Scholar] [CrossRef] [PubMed]
- Yendewa, G.A.; Griffiss, J.M.; Jacobs, M.R.; Fulton, S.A.; O’Riordan, M.A.; Gray, W.A.; Proskin, H.M.; Winkle, P.; Salata, R.A. A two-part phase 1 study to establish and compare the safety and local tolerability of two nasal formulations of XF-73 for decolonisation of Staphylococcus aureus: A previously investigated 0.5 mg/g viscosified gel formulation versus a modified formulation. J. Glob. Antimicrob. Resist. 2020, 21, 171–180. [Google Scholar] [CrossRef] [PubMed]
- Van Dyke, T.; Paquette, D.; Grossi, S.; Braman, V.; Massaro, J.; D’Agostino, R.; Dibart, S.; Friden, P. Clinical and microbial evaluation of a histatin-containing mouthrinse in humans with experimental gingivitis: A phase-2 multi-center study. J. Clin. Periodontol. 2002, 29, 168–176. [Google Scholar] [CrossRef] [PubMed]
- Niemeyer-van der Kolk, T.; van der Wall, H.; Hogendoorn, G.K.; Rijneveld, R.; Luijten, S.; van Alewijk, D.; van den Munckhof, E.H.A.; de Kam, M.L.; Feiss, G.L.; Prens, E.P.; et al. Pharmacodynamic Effects of Topical Omiganan in Patients with Mild to Moderate Atopic Dermatitis in a Randomized, Placebo-Controlled, Phase II Trial. Clin. Transl. Sci. 2020, 13, 994–1003. [Google Scholar] [CrossRef] [PubMed]
- Nilsson, A.C.; Janson, H.; Wold, H.; Fugelli, A.; Andersson, K.; Hakangard, C.; Olsson, P.; Olsen, W.M. LTX-109 is a novel agent for nasal decolonization of methicillin-resistant and -sensitive Staphylococcus aureus. Antimicrob. Agents Chemother. 2015, 59, 145–151. [Google Scholar] [CrossRef]
- Knappe, D.; Adermann, K.; Hoffmann, R. Oncocin Onc72 is efficacious against antibiotic-susceptible Klebsiella pneumoniae ATCC 43816 in a murine thigh infection model. Biopolymers 2015, 104, 707–711. [Google Scholar] [CrossRef]
- De Breij, A.; Riool, M.; Kwakman, P.H.; de Boer, L.; Cordfunke, R.A.; Drijfhout, J.W.; Cohen, O.; Emanuel, N.; Zaat, S.A.; Nibbering, P.H.; et al. Prevention of Staphylococcus aureus biomaterial-associated infections using a polymer-lipid coating containing the antimicrobial peptide OP-145. J. Control. Release 2016, 222, 1–8. [Google Scholar] [CrossRef]
- Ochoa, T.J.; Zegarra, J.; Bellomo, S.; Carcamo, C.P.; Cam, L.; Castaneda, A.; Villavicencio, A.; Gonzales, J.; Rueda, M.S.; Turin, C.G.; et al. Randomized Controlled Trial of Bovine Lactoferrin for Prevention of Sepsis and Neurodevelopment Impairment in Infants Weighing Less Than 2000 Grams. J. Pediatr. 2020, 219, 118–125.e5. [Google Scholar] [CrossRef]
- Dale, G.E.; Halabi, A.; Petersen-Sylla, M.; Wach, A.; Zwingelstein, C. Pharmacokinetics, Tolerability, and Safety of Murepavadin, a Novel Antipseudomonal Antibiotic, in Subjects with Mild, Moderate, or Severe Renal Function Impairment. Antimicrob. Agents Chemother. 2018, 62, e00490-18. [Google Scholar] [CrossRef]
- Lee, C.H.; Patino, H.; Stevens, C.; Rege, S.; Chesnel, L.; Louie, T.; Mullane, K.M. Surotomycin versus vancomycin for Clostridium difficile infection: Phase 2, randomized, controlled, double-blind, non-inferiority, multicentre trial. J. Antimicrob. Chemother. 2016, 71, 2964–2971. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Sidorowicz, A.; Mikosinski, J.; Krzyzanowski, M.; Orleanski, J.; Twardowska-Saucha, K.; Nykaza, A.; Dyaczynski, M.; Belz-Lagoda, B.; Dziwiszek, G.; et al. Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial. Wound Repair Regen. 2021, 29, 938–950. [Google Scholar] [CrossRef] [PubMed]
- Abdeen, S.; Bdeir, K.; Abu-Fanne, R.; Maraga, E.; Higazi, M.; Khurram, N.; Feldman, M.; Deshpande, C.; Litzky, L.A.; Heyman, S.N.; et al. Alpha-defensins: Risk factor for thrombosis in COVID-19 infection. Br. J. Haematol. 2021, 194, 44–52. [Google Scholar] [CrossRef] [PubMed]
- Mellhammar, L.; Thelaus, L.; Elen, S.; Fisher, J.; Linder, A. Heparin binding protein in severe COVID-19-A prospective observational cohort study. PLoS ONE 2021, 16, e0249570. [Google Scholar] [CrossRef] [PubMed]


| AMP | Source | Peptide Type | Sequence | Infection Model | Effect and Mechanism of Action | Reference |
|---|---|---|---|---|---|---|
| HD5 | Human intestinal Paneth cells | β-sheet | ATCYCRTGRCARESLSGVCEISGRLYRLCCR | in vitro | Shields ACE2 from binding to SARS-CoV-2 | [199] |
| P9R | Modification | β-sheet | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR | in vitro | Binds to the virus and inhibits virus–host endosomal acidification | [176] |
| Brilacidin | Synthetic | Peptidomimetic | Not provided | in vitro | Interferes with virus entry and destroys virus integrity; synergistic antiviral activity when combined with remdesivir | [200] |
| Nisin H | Lactic acid bacteria | Cyclic peptide | FTSISMCTPGCKTGACMTCNYKTATCHCSIKVSK | in vitro | Competes with SARS-CoV-2 for binding to hACE2 | [201] |
| Caerin 1.6 and caerin 1.10 | Amphibian | α-helical | GLFSVLGAVAKHVLPHVVPVIAEK/GLLSVLGSVAKHVLPHVVPVIAEKL | in silico discovery | Interacts with Arg995 located in the S2 subunit of Sgp, which is the key subunit that plays an essential role in viral fusion and entry into the host cell through ACE2 | [202] |
| DP7 | Synthetic | Not provided | VQWRIRVAVIRK | in vitro | Inhibits SARS-CoV-2 S protein-mediated cell fusion and inhibits SARS-CoV-2 3CLpro enzyme activity | [203] |
| Peptoid 1 and its derivatives | Synthetic | α-helical | Not provided | in vitro | Inactivates enveloped viruses through a membrane disruption mechanism | [165] |
| LL-37 | Human | α-helical | [LL-37, 37 aa] | in vitro and in vivo | Simultaneously blocks viral S1 and cloaks ACE2 | [204] |
| HBD2 | Human mucosal epithelium | β-sheet | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP | in vitro | Binds the SARS-CoV-2 RBD and blocks viral entry | [205] |
| Meucin-18 and its derivative | Venom scorpion | α-helical | FFGHLFKLATKIIPSLFQ/FFGHLFKLTTKIIPSLFQ | in vitro | Interacts with the RBD of the spike protein of SARS-CoV-2 to inhibit the spike protein’s interaction with the ACE2 receptor | [206] |
| Plectasin | Pseudoplectania nigrella | Not provided | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY | in silico discovery | Interacts with the nucleocapsid of coronaviruses | [207] |
| HNP1 | Human neutrophil | β-sheet | Not provided | in vitro | Destabilizes and precipitates spike protein and inhibits the interaction of spike with the ACE2 receptor | [208] |
| RC-101 | Modification | Not provided | Not provided | in vitro | Destabilizes and precipitates spike protein and inhibits the interaction of spike with the ACE2 receptor | [208] |
| RTD-1 | Rhesus macaque leukocytes | Cyclic peptide | GFCRCLCRRGVCRCICTR | in silico discovery | Modulates host immunity by inhibiting the release of proinflammatory cytokines, protecting the body from immune-mediated organ damage | [209,210] |
| AMP | Template | Phase of Clinical Trials | Administration | Application | Reference |
|---|---|---|---|---|---|
| Iseganan | Protegrin-1 | Phase 2/3 | Topical | Prevention of ventilator-associated pneumonia | [231] |
| XF-73 | Porphyrin | Phase 1 | Nasal gel | Prevention of postoperative S. aureus colonization and infection | [232] |
| P-113 | Histatin 5 | Phase 2 | Mouth rinse | Reduce gum bleeding, gingivitis and plaque | [233] |
| Omiganan | Indolicidin | Phase 2 | Topical gel | Treatment of mild to moderate atopic dermatitis | [234] |
| LTX-109 | Synthetic peptidomimetic | Phase 1/2 | Topical | Prevention of nasal infections caused by methicillin-sensitive/resistant S. aureus | [235] |
| Onc72 | Oncocin | Preclinical | Subcutaneous | Treatment of antibiotic-susceptible K. pneumoniae | [236] |
| OP-145 | LL-37 | Preclinical | Implant coating | Prevention of S. aureus-induced biomaterial-associated infections | [237] |
| Lactoferrin | Not applicable | Phase 4 | Oral | Prevention of neonatal sepsis | [238] |
| Murepavadin | Protegrin-1 | Phase 1 | Intravenous | Treatment of pneumonia caused by P. aeruginosa infection | [239] |
| Surotomycin | Daptomycin | Phase 2 | Oral | Treatment of C. difficile-associated infection | [240] |
| LL-37 | Not applicable | Phase 2 | Topical | Control of infection of diabetic foot ulcers | [241] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Li, X.; Zuo, S.; Wang, B.; Zhang, K.; Wang, Y. Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides. Molecules 2022, 27, 2675. https://doi.org/10.3390/molecules27092675
Li X, Zuo S, Wang B, Zhang K, Wang Y. Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides. Molecules. 2022; 27(9):2675. https://doi.org/10.3390/molecules27092675
Chicago/Turabian StyleLi, Xin, Siyao Zuo, Bin Wang, Kaiyu Zhang, and Yang Wang. 2022. "Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides" Molecules 27, no. 9: 2675. https://doi.org/10.3390/molecules27092675
APA StyleLi, X., Zuo, S., Wang, B., Zhang, K., & Wang, Y. (2022). Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides. Molecules, 27(9), 2675. https://doi.org/10.3390/molecules27092675

