Next Article in Journal
The Use of Biologic and Targeted Synthetic Disease-Modifying Drugs in the Treatment of Psoriatic Arthritis
Previous Article in Journal
Selection and Characterization of Antibodies Recognizing Unnatural Base Pairs
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Antimicrobial Peptides from Frogs of the Glandirana Genus

by
Frederick Harris
1,
David A. Phoenix
2 and
Sarah R. Dennison
1,*
1
Biomedical Evidence-based Transdisciplinary (BEST) Health Research Institute, School of Pharmacy and Biological Sciences, University of Central Lancashire, Preston PR1 2HE, UK
2
Office of the Chancellor, London South Bank University, 103 Borough Road, London SE1 0AA, UK
*
Author to whom correspondence should be addressed.
Biologics 2024, 4(4), 444-507; https://doi.org/10.3390/biologics4040027
Submission received: 10 October 2024 / Revised: 25 November 2024 / Accepted: 4 December 2024 / Published: 8 December 2024
(This article belongs to the Section Natural Products)

Abstract

Glandirana is a genus of frogs that includes G. rugosa, G. emeljanovi, G. minima, G. tientaiensis, G. susurra, G. nakamurai and G. reliquia. These frogs produce antimicrobial peptides (AMPs), which are endogenous antibiotics that possess antibacterial, antifungal, antiviral and anti-endotoxin activity and help keep the hosts free from infections. In these activities, microbial death is promoted by membranolytic mechanisms that are mediated by the cationic charge and amphiphilic α-helical structures of these peptides. In general, these peptides are selective for microbes, showing low levels of hemolytic and cytotoxic activity, as well as possessing other biological activities, including anticancer, antioxidative and insulinotrophic action. In this review, a brief overview of AMPs with a focus on those from amphibians is provided, along with the phylogeny and nomenclature of frogs and AMPs from the Glandirana genus. This review then provides a comprehensive, in-depth description of the antimicrobial and other biological activities of all AMPs produced by known frogs of the Glandirana for the period 1994 to 2024. This description includes a detailed discussion of the structure/function relationships and mechanisms involved in the membrane interactions that drive these biological activities, with comparisons between AMPs from the same frog and between frogs across the genus. Based on their biological properties, AMPs from frogs of the Glandirana genus have been proposed for investigation as potential therapeutic agents, such as in the treatment of cancers and diabetes, as well as antimicrobial agents in areas, including crop protection, the food industry and oral hygiene.

1. Introduction

It was generally believed that the production of antimicrobial peptides (AMPs) as a defence strategy was unique to unicellular organisms [1]; however, this belief began to be discredited by a number of studies in the later decades of the 1900s [2,3]. Notable is the work of Hirsch in 1956 and that of Spitznagel in 1966 showing that cationic proteins were responsible for the ability of human neutrophils to kill bacteria via oxygen-independent mechanisms, clearly not an activity associated with the adaptive immune system [4,5]. Subsequent investigations [2,3] eventually led to the work of Boman and colleagues in 1980, who were the first to fully isolate and characterize eukaryotic AMPs, which were derived from Hyalophora cecropia (the silk moth) [6] and today are known as cecropins [7]. This work also helped answer the longstanding question as to why insects, other invertebrates and plants, which are dispossessed of adaptive immune responses, remain free from infections for most of the time [1,2]. Interestingly, although beyond the scope of this review, more recent studies have provided increasing evidence for the existence of acquired immunity functions in invertebrates and plants [8,9].
Today, it is recognized that AMPs are key components of the innate immunity of creatures across Eukarya, possessing direct, potent activity against bacteria, viruses, fungi and parasites [10,11,12,13]. In relation to higher eukaryotes, amphibians played a central role in the discovery of AMPs when a series of landmark studies across the late 1980s and 1990s [2] led to the isolation of magainins from Xenopus laevis (the African clawed frog) [14]. These peptides were identified in the skin secretions of this frog by Zasloff and colleagues in 1987, who described them as a ‘… previously unrecognized, vertebrate antimicrobial host defence system.’ [15]. The characterization of magainins showed that they carried a net positive charge [14], which appears to be a general feature of AMPs and is thought to allow these peptides to target microbial cells, which carry a net negative charge [16]. The positive charge carried by AMPs is also a primary determinant of their selectivity, which allows them to distinguish microbial cells from mammalian cells, which possess no overall electrical charge [17]. However, in 1997, further studies on X. laevis identified the PYL peptide, which was the first major example of anionic AMPs to be described in higher eukaryotes [18]. Since this study, anionic AMPs have been reported in other amphibians, [19], as well as a variety of other eukaryotes [20,21,22], and appear to target and interact with microbial membranes using a variety of strategies [19,20,21,22]. It is generally believed that these peptides serve to synergize the action of positively charged AMPs and may represent relics from the early evolution of defence molecules involved in host—pathogen interactions [19].
There have been numerous studies on the antimicrobial action of AMPs and the general, essential properties of these peptides are the possession of a cationic charge along with a hydrophobic and/or amphiphilic molecular architecture that, in combination, mediate their ability to interact with lipids [16,23]. In the case of α-helical AMPs, the study of these molecular architectural characteristics was greatly enhanced by the landmark studies of Eisenberg et al., who in 1982 developed the concept of the hydrophobic moment, <μH> [24,25]. This concept is essentially a mathematical model that is able to quantify the structured spatial partitioning of hydrophilic and hydrophobic residues about the long axis of α-helical AMPs and hence provides a measure of their amphiphilicity [26,27]. This methodology then takes the hydrophobicity of α-helical AMPs to be the mean hydrophobicity, <H>, of their sequences, thereby providing a measure of the affinity of these peptides for the membrane interior [28,29]. Numerous studies based on this methodology have shown that there are no general, close correlations between the cationic charge/amphiphilicity/hydrophobicity and the ability of α-helical AMPs to selectively kill microbes [23,30,31]. However, these studies revealed a tendency for more amphiphilic peptides to seek interaction with the surface of membranes, which led to a number of methodologies designed to guide the structure/function analyses of AMPs and thereby the prediction of their modes of membrane interaction, as illustrated in Section 5.2.2 [26,27,32,33].
The ability of AMPs to interact with lipids allows these peptides to partition into the cytoplasmic membrane (CM) of bacteria, which is generally their primary site of action and leads to the death of the target organism through the lysis of the CM [16,23], although some of these peptides traverse the CM and attack intracellular targets [34,35]. In the case of AMPs that target Gram-negative bacteria, lipid interactivity also promotes their passage across the barrier posed by the outer membrane (OM) to gain access to the CM [36,37]. Most commonly, this passage is facilitated by the ‘self-promoted pathway’ [38] in which AMPs target and bind lipopolysaccharides (LPS) [37,39], which are anionic and the major component of the OM [40,41]. These binding events competitively displace Ca2+ and Mg2+ ions that help maintain cell surface stability and lead to the disruption of the OM, which allows further peptides to migrate to the CM and inflict lethal damage [37,39,42]. Based on these observations, a variety of models have been proposed to describe the antimicrobial action of AMPs, general variants of the barrel stave pore and toroidal pore models, which involve membrane disruption via discrete channel formation, and carpet-type and tilted-type mechanisms, which involve non-specific solubilization [16,30,39,42]. The multiplicity of their target sites and the relatively non-specific nature of their action has led to only a low incidence of microbial resistance to these AMPs, which is generally due to inherent rather than adaptive mechanisms [36,43,44]. It is believed that microbial resistance to these peptides is unlikely to approach that of conventional antibiotics, endowing these AMPs with a major advantage [44,45,46], although this has been disputed [47,48]. Microbial resistance to antibiotics, particularly that of multiple drug-resistant (MDR) strains, is now recognized as a major threat to human health and a cause of mortality on a global scale [49,50]. The potential of AMPs for development as medically relevant antimicrobials was first recognized for magainins [51,52], and numerous derivatives of these peptides have been used for purposes ranging from spermicides to anti-biofilm agents [14]. To date, the most successful of these derivatives is pexiganan (MSI-78) [53], which is an analogue of magainin 2 with potent activity towards a broad range of Gram-positive and Gram-negative bacteria [54,55,56]. The major therapeutic potential shown by pexiganan is for topical application as an antibacterial agent [53,54], which led to the peptide becoming the first of AMPs to undergo commercial development [57,58]. In clinical trials for the topical treatment of diabetic foot ulcers [53,54,59], pexiganan was well tolerated and achieved clinical cure or improvement in the vast majority of patients [60]. Based on the success and lessons learnt from the development of pexiganan [14], a number of other compounds based on AMPs have undergone clinical trials for a variety of conditions [61,62,63]. A major example of amphibian AMPs in clinical trials is buforin II, which is derived from Bufo gargarizans (the Asiatic toad) and appears to exert its antibacterial activity through membrane translocation to attack DNA and other intracellular targets [34,35]. This peptide is in phase I clinical trials as a broad-spectrum agent for the treatment of bacterial infections [62] and, in particular, those due to Acinetobacter baumannii [64], which is currently classed as a critical priority pathogen by the World Health Organization (WHO) [65]. Currently, there is an urgent requirement for novel agents to combat infections due to A. baumannii, which is an invasive MDR pathogen that is associated with high mortality and is one of the major causes of nosocomial infections, which range from pneumonia and septicemia to meningitis and surgical site infections [66,67,68].
According to the APD3 database (https://aps.unmc.edu/), currently over a thousand AMPs, just over one third of all those known, have been identified in anurans [69] and it is generally accepted that the richest source of AMPs is the skin secretions of these creatures [70,71]. Amphibian skin possesses a highly plastic, cutaneous exocrine apparatus, which includes numerous granular (serous) glands that release AMPs in response to a microbial attack, to both kill these microbes and to assist in wound repair [72,73]. Research into AMPs and other bioactive compounds produced by amphibian skin secretions has been largely focused on anurans [73,74] and, currently, peptides from a wide variety of frogs, toads and salamanders are under investigation as therapeutically relevant antibacterial, antiviral, antifungal and antiprotozoan agents [19,70,73,74].
In particular, the true frogs, Ranidae family, have been a promising target in the search for novel AMPs as they are the most diverse and widely distributed group of anuran amphibians worldwide, occurring on all continents except Antarctica [74,75]. The Ranidae family has undergone many taxonomic reorganizations and phylogenetic studies [76,77,78,79] and, currently, the online database, AmphibiaWeb, lists 22 genera with 407 species for this family [80]. The biggest of these genera is the Rana with more than 100 species occurring from North America to the northern half of South America as well as across Europe and Asia [79,80]. In contrast, one of the smallest genera of the Ranidae is the Glandirana, which is found in eastern China, Korea, Japan and possibly the Russian Far East and, currently, includes five species with two pending [80]. Here, we present an overview of changes in the phylogeny of frogs from this genus and an update on the nomenclature, biological properties and mechanisms of action used by their AMPs.

2. The Phylogeny and Nomenclature of Frogs and AMPs from the Glandirana Genus

Glandirana means ‘glandular frog’ and this genus has had a convoluted taxonomic history [81]: it currently includes G. rugosa, G. emeljanovi, G, minima, G. tientaiensis and G. susurra [75] and with the exception of the latter frogs [82], each of these species have been included in Rana, as well as other genera [81]. In the case of G. emeljanovi, this frog was initially recognized as a species separate to G. rugosa based on an analysis and comparison of the AMPs in the defence repertoires of these amphibians. In the mid-1990s, a family of AMPs were isolated from the skin secretions of G. rugosa found in Korea and named gaegurins [83,84], whilst around the same time, three AMPs named rugosins were identified in the skin secretions of a frog found in Japan that was also believed to be G. rugosa [85]. Nonetheless, although high levels of sequence homology existed between rugosins and gaegurins, differences were observed that would not be expected for peptides from exactly the same species [76,86]. This apparent discrepancy was resolved by recent advances in the phylogenetic analysis of the family Ranidae, which showed that ‘Rana rugosa’ from Japan and Korea were similar, but different species of frogs that belonged to a new genus, Glandirana, and were reclassified as Glandirana rugosa and G. emeljanovi, respectively [76,80,86,87]. However, G. emeljanovi is found not only in Korea, but also in northeastern China, and an unanswered question was the taxonomic relationship between these frogs [88]. In response, the mitochondrial genomes of these frogs, as well as that of G. rugosa, were recently sequenced [89,90,91,92]. Tthe analysis of these mitogenomes showed that not only were G. emeljanovi from Korea and China the same species, but that they were a different species to G. rugosa, which also strongly supported the monophylogeny of the Glandirana genus [87,89]. G. susurra is the most recently characterized species of frog to be included within the Glandirama genus and it had previously been believed to be the R. rugosa found in most of mainland Japan and neighboring islands, including Sado Island [75,82]. However, although the frog inhabiting Sado Island was genetically close, it was postzygotically isolated and distinguishable from R. rugosa, both morphologically and in relation to its advertisement call [82,93]. Based on these observations, it was proposed that the frog inhabiting Sado Island had evolved from an ancient form of R. rugosa and, after a long separation, had speciated on this island and become endemic [82,94]. To take account of the genetic and phylogenetic differentiation between the frog of Sado Island and R. rugosa inhabiting other Japanese locations, the former frog was renamed Rugosa susurra and later as G. susurra when placed in the Glandirana genus [93]. Currently, both G. susurra and G. rugosa are found on Sado Island, although in distinct non-overlapping locations, and it is believed that speciation by G. susurra preceded the invasion of the Island by the present-day G. rugosa lineage [82,94]. It is not known how long G. susurra has resided on Sado Island [82], but analogous cases of separation involving Australian frogs have indicated that evolutionary change can be effected in a relatively short time in evolutionary terms, of the order of 10,000 years [95]. Most recently, a number of taxonomic studies have identified groups of frogs in the east and center of Japan that appear to be distinct from G. rugosa and represent new species in the Glandirana genus, including G. reliquia and G. nakamurai [87,96,97].
Biologics 04 00027 i001Biologics 04 00027 i002
G. reliquia: taken from [80].G. nakamurai: taken from [80].
Currently, there appear to have been no investigations into the capacity of G. reliquia and G. nakamurai to produce AMPs [87,96,97] and, historically, gaegurins were the first AMPs to be isolated from frogs of the Glandirana genus [83]. These peptides were also the first to be isolated from the skin of frogs in Korea, which led to them being named after the Korean word for frog, Gaegury [83]. However, more recently, there have been attempts to derive a consistent nomenclature for AMPs of the Ranidae [76,98,99] and using the system proposed by Conlon, these peptides are assigned to one of fourteen families on the basis of sequence similarity [76]. Accordingly, AMPs from G. susurra have been named using this system and the gaegurins and rugosins [83,85] renamed, with the result that most of the known peptides produced by frogs of the Glandirana genus are now members of the brevinin, esculentin, ranatuerin and granuliberin families of AMPs (Figure 1) [76,86,100]. A summary of the phylogeny and nomenclature of frogs and AMPs from the Glandirana Genus is given below in Box 1.
Immediately after their discovery, AMPs from this genus were the focus of numerous studies, but no review of these peptides has been presented in over a decade and a half, although there has been much progress in elucidating their antimicrobial action and other biological activities, as well as deciphering the mechanisms underpinning these properties [55,86].
Box 1. The Phylogeny and Nomenclature of Frogs and AMPs from the Glandirana Genus.
  • Frogs from the Glandirana genus, which is one of the smallest in the family Ranidae, are found in eastern China, Korea, Japan and possibly the Russian Far East.
  • Glandirana means ‘glandular frog’ and currently, this genus includes G. nakamurai and G. reliquia, which are new species added over the last decade, and the established species G. rugosa, G. emeljanovi, G. minima, G. tientaiensis and G. susurra.
  • AMPs from frogs of the Glandirana genus are are assigned to one of fourteen families on the basis of sequence similarity and most are now members of the brevinin, esculentin, ranatuerin and granuliberin families (Figure 1).

3. AMPs from G. minima, G. tientaiensis and G. rugosa

G. minima (the Fujian Frog) is endemic to the Fujian province, China, and has been known since 1979, whilst G. tientaiensis (the Tiantai frog) is only found in Zhejiang and Anhui provinces, China, and was first reported in 1933 [75]. However, currently, no AMPs appear to have been reported for these species of frog, as evidenced by searches in the Swissprot protein database [102] and APD3 database, which are the major repository of amphibian peptides [69]. Interestingly, a significant number of frog species appear to be devoid of AMPs, and although beyond the scope of this review, this observation has led to the view that antimicrobial function may not be the primary role of these peptides in anurans [74].
Biologics 04 00027 i003Biologics 04 00027 i004
G. minima: taken from [80].G. tientaiensis: taken from [80].
G. rugosa (the Japanese wrinkled frog) was first identified in 1838 [75] and a suite of three AMPs were isolated from this amphibian [85] that were later renamed brevinin-2 Ra (B2Ra: GLLNTFKDWAISIAKGAGKGVLTTLSCKLDKSC), brevinin-2 Rb (B2Rb: SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC) and esculentin-2 R (E2R: GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC) from rugosin A, rugosin B and rugosin C, respectively (Figure 1) [76,86,100]. A limited characterization of these AMPs showed that B2Ra and B2Rb were both 33 residues long and possessed net charges of +4 and +5, respectively, whereas E2R possessed 37 residues and had a net charge of +5. All three peptides carried a C-terminal Rana box motif [85,86], which is a post translational modification comprising a cysteine-stabilized, heptapeptide, loop-like fold, so called because it is conserved across many ranid AMPs (Figure 1) [71,73,86,103]. These studies also showed that B2Rb possessed broad-range antibacterial activity, whereas B2Ra possessed potent activity against Gram-positive bacteria, but weaker activity against Gram-negative bacteria (Table 1). E2R showed activity against Gram-positive bacteria, which was not quantified, and no further research into these peptides appears to have been undertaken [85]. A summary of AMPs from G. minima, G. tientaiensis and G. rugosa is given below in Box 2. Currently, the best characterized AMPs produced by frogs in the Glandirana are those identified in G. susurra [101] and G. emeljanovi [55,86].
Biologics 04 00027 i005
G. rugosa: taken from [80].
Box 2. AMPs from G. minima, G. tientaiensis and G. rugosa.
  • G. reliquia and G. nakamurai are found in Japan, whilst G. minima and G. tientaiensis occur in China and, currently, the production of AMPs by these frogs has not been reported.
  • G. rugosa occurs in Japan and Korea and produces the cationic AMPs brevinin-2 Ra (B2Ra), brevinin-2 Rb (B2Rb) and esculentin-2 R (E2R), which are cationic and carry a C-terminal Rana box motif (Figure 1).
  • B2Rb possesses broad-range antibacterial activity, whereas B2Ra possesses potent activity against Gram-positive bacteria, but weaker activity against Gram-negative bacteria (Table 1).

4. AMPs from G. susurra

G. susurra (the Sado wrinkled frog) was only identified in 2012 [75] and derives its name from ‘susurrus’, which in Latin means ‘whispering’ and reflects the fact that the advertisement call of G. susurra is much quieter than those of other anuran species in the same locality [82,104]. Most recently, in a major study, cDNA clones were amplified from the total RNA obtained from the skin of G. susurra and their deduced sequences revealed a tripartite organization, comprising an N-terminal signal sequence, followed by a spacer region rich in glutamic and aspartic acids, which was terminated at the C-terminus by the mature peptide [101]. This tripartite organization is typical of prepropeptides for amphibian AMPs, which are initially synthesized in the granular glands of the skin through ribosomal translation. Post-translational processing then occurs to yield the mature biologically active peptide, which is stored in the large granules of the glands for inducible release [73,74]. The bioinformatic analyses of the cDNAs from G. susurra showed that they encoded homologs of precursor polypeptides of a series of AMPs and bioactive peptides [101]. Bradykinin-SSa (BSSa) was the only non-AMP identified in G. susurra [101], and within the Glandirana genus, these peptides have only previously been reported to occur in G. rugosa [105], although they are known to be present in anurans from genera across the Ranidae, Hylidae, Ascaphidae and Bombinatatoridae [70]. Bradykinins (BKs) and bradykinin-related peptides (BRPs) are myotropic agents that are released in amphibian skin secretions and serve as antipredator defence agents. Essentially, these peptides act on receptors in predators to produce a diverse range of effects, including the induction of hypotension, vasodilatation, pain, inflammation and smooth muscle contraction [70,106]. For example, it has been proposed that these peptides may induce spasms in the smooth muscles that surround the digestive tract of a predator’s gastrointestinal system, leading to vomiting and other adverse reactions that cause the predator to avoid the host amphibians [74,106].
Biologics 04 00027 i006
G. susurra: taken from [80].
In general, the sequences of AMPs identified in G. susurra were found to be highly conserved across this species, G. rugosa and G. emeljanove (Figure 1), which supported earlier work suggesting that these frogs are very closely related but are not conspecific [82]. A number of the AMPs from G. susurra were found to be typical of the established families of anuran peptides, possessing a net positive charge and the C-terminal, heptapeptide, Rana box motif [101], as carried by peptides from G. rugosa and G. emeljanove [85,86]. These AMPs from G. susurra included brevinin-1SSc (B1SSc), brevinin-1SSd (B1SSd), brevinin-2SSb (B2SSb), brevinin-2SSd (B2SSd) and esculentin-2SSa (E2SSa) (Figure 1) [101]. However, other AMPs identified in G. susurra were atypical of these families and included brevinin-1SSa (B1SSa) and brevinin-1SSb (B1SSb), which were cationic, acyclic peptides carrying a C-terminal amide moiety (Figure 1). C-terminal amidation is a common post-translational modification found in amphibian AMPs [70] that appears to play a variety of roles in their biological activity, ranging from the stabilization of the α-helical structure to promoting microbial targeting [107]. None of the foregone AMPs were further characterized and the focus of these investigations was on the three remaining, atypical peptides produced by G. susurra, namely brevinin-2SSb (B2SSb), ranatuerin-2SSa (R2SSa) and granuliberin-2SSa (GSSa), which are shown in Figure 1.

4.1. The Biological Activity of Brevinin-2SSb, Ranateurin-2SSa and Granuliberin-SSa

R2SSa (GLISTIWNTASNVAGTLTDSVKCKFKKC) was the first peptide of the ranatuerin-2 family to be discovered in the Glandirana genus and the initial analyses showed that this peptide and B2SSb (SFLLIKAGAKFLGKNMLKQGAQYAACKVSKDSENVNWKS) possessed net charges of +5 and +3, respectively, and appeared to be predominantly formed from the α-helical structure that carried modified C-terminal Rana box motifs (Figure 1) [101]. In the case of R2SSa, this modified C-terminal Rana box motif was formed from six residues and in that of B2SSb, the C-terminal cysteine residue of this motif had been substituted by serine and an extra seven residues added to the sequence (Figure 1). Similar variations of the Rana box motif, as well as those that possess additional disulfide bonds, have been reported for other frogs and it is believed that these observations reflect evolutionary divergence by amphibian AMPs [71,73,103]. In contrast to B2SSb and R2SSa, GSSa (FIFLPIFRRPVS-NH2) exhibited a net charge of +3 and appeared to be primarily formed from a β-sheet structure that carried a C-terminal amide moiety [101]. Interestingly, the bioinformatic analysis suggested that GSSa resulted from mutations in the genes encoding brevinin-1 peptides produced by G. sussura which led to the insertion of a premature stop codon in the cDNA of these peptides (Figure 1) [101]. Similar cases have been reported for other phyla; for example, θ-defensin, produced by rhesus macaques, is heterodimeric and formed from initial monomers that are the product of a mutated α-defensin gene containing a premature stop codon in its mature AMP domain [108].
B2SSb, R2SSa and GSSa were found to possess a variety of biological activities (Table 2) [101], which is consistent with the multifunctionality of AMPs in general [2,109,110,111], although the functional diversity of amphibian peptides appears to be especially broad with roles ranging from insulin and corticotropin release to protease and neuronal nitric oxide synthase inhibition [70,100,112]. For example, B2SSb and R2SSa were found to be antioxidant peptides (AOs) [101], which has been reported for other amphibian AMPs and bioactive peptides and is believed to help protect the host anurans from oxidative stress and UV irradiation [111]. Endogenous antioxidants are key for the survival and adaptation of animals to the environment [113] and due to a variety of factors, such as the fragile nature of the stratum corneum, it is essential for amphibians to protect their skin against endogenous and exogenous oxidative insults far more than other vertebrates [111,114]. Typically, Odorrana andersonii (the golden cross band frog) lives in high-altitude environments with elevated UV radiation, and the skin of O. andersonii was shown to be highly tolerant to this radiation, primarily due to the presence of a rich diversity of AOs with a potent ability to scavenge free radicals [115].
B2SSb and R2SSa showed potent anticancer activity, reducing the viability of cell lines representing human liver cancer (HepG2) by over three quarters at low peptide concentrations (<12.0 µM). However, GSSa only achieved similar reductions in the viability of these cells at concentrations circa seven-fold higher than those of B2SSb and R2SSa, indicating much lower activity against HepG2 cells [101]. The ability to kill cancer cells is common to not only amphibian peptides, but AMPs in general [116,117,118] and is discussed in more detail in Section 5.1.1 and Section 5.1.2 in relation to B1EMa and B1EMb from G. emeljanovi [119,120,121,122]. This ability appears to be underpinned by the fact that the CM of cancer cells resembles those of microbial cells by carrying a net negative charge [117,118,123]. In general, this resemblance in the membrane surface charge also allows AMPs to selectively target cancer cells over normal eukaryotic cells, which, as described in Section 1, carry no overall electrical charge [117,118,123]. However, B2SSb, R2SSa and GSSa showed cytotoxicity to normal mammalian cells, namely the monkey kidney cell line, COS7, and the calf pulmonary artery endothelium (CPAE) cell line, that was comparable to that of their anticancer activity [101]. These observations clearly made these peptides undesirable for therapeutic and biotechnical use, and it was proposed that they could be modified to reduce their cytotoxicity and improve their selectivity [101]. The modification of AMPs to optimize their biological properties is a well-established strategy, and the properties most commonly varied are their net positive charge, hydrophobicity and amphiphilicity [124,125,126,127]. As described in Section 1, the net positive charge carried by AMPs is a primary determinant of their ability to selectively kill microorganisms; however, this ability is also known to be modulated by a complex interplay between interconnected peptide and membrane properties. For example, conformational transitions and self-assembly equilibria modulate the effective hydrophobicity of AMPs and thereby their ability to penetrate membranes, whilst kinetic processes can play a key role in promoting the selective killing of microorganisms by these peptides in the presence of host cells [128,129,130]. Based on these observations, a variety of strategies to reduce the cytotoxicity and improve the microbial selectivity of B2SSb, R2SSa and GSSa can be envisaged, ranging from the site-directed sequence mutation(s) to chemical modifications, such as lipidation and glycosylation [124,125,126,127].
The antimicrobial efficacy of B2SSb, R2SSa and GSSa was evaluated against a panel of bacterial and fungal pathogens, which showed that these peptides had varying antimicrobial spectra and levels of activity (Table 2). An evaluation against human pathogens showed that R2SSa and GSSa were ineffective against all the bacteria assayed and B2SSb was ineffective against Gram-positive bacteria (Table 2). However, B2SSb showed moderate activity towards Gram-negative bacteria, which included Escherichia coli and Pseudomonas aeruginosa whose MDR strains are currently classed as amongst the world’s most dangerous bacterial pathogens [65]. B2SSb, R2SSa and GSSa also exhibited moderate activity towards Candida albicans [101] and invasive infections by this fungus are a major cause of morbidity and mortality, especially in immunocompromised and critically ill patients [131,132], which has exacerbated the emergence of MDR strains of the organism [133,134]. Based on these observations, it was proposed that, appropriately modified to reduce their high cytotoxicity, B2SSb, R2SSa and GSSa may have the potential for development to treat infections due to Candida and Gram-negative bacteria (Table 2) [101]. An evaluation of the activity of B2SSb, R2SSa and GSSa against plant pathogens was a particular focus of the studies on these peptides (Table 2) [101]. The application of AMPs in the protection of plants and crops is an increasingly important use that receives relatively little attention in the literature [135,136]. These pathogens included the Gram-negative bacterium, Xanthomonas oryzae, which causes a serious blight of rice [137]; the Gram-positive bacterium, Clavibacter michiganensis, which causes ring-rot disease in potatoes [138]; and the fungus, Pyricularia oryzae (Magnaporthe oryzae), which causes rice blast disease (Table 2) [139]. Notably, B2SSb showed very high efficacy against X. oryzae, whilst both this peptide and GSSa showed similar potent activity towards C. michiganensis which was accompanied by moderate activity against P. oryzae in both cases (Table 2). In contrast, R2SSa showed weak activity against C. michiganensis and was ineffective against both X. oryzae and P. oryzae (Table 2) [101]. These studies did not evaluate the toxicity of B2SSb, R2SSa and GSSa to host plant cells, which is clearly a requirement for the use of these peptides in crop protection and other plant-related uses. However, the toxicity of AMPs to mammalian cells is not necessarily indicative of phytotoxicity [140], as shown for a variety of these peptides [141,142]. Based on these observations, it was suggested that, appropriately modified, B2SSb, R2SSa and GSSa may have the potential for development as novel agents to address a number of increasingly problematic issues related to crop protection [101]. As major instances, AMPs have been investigated as biopesticides [143,144] in the search for ‘natural’ alternatives to pesticides in order to reduce the use of these environmentally damaging chemical agents [135,145]. AMPs have also been investigated for heterologous expression in plants to combat MDR phytopathogens [136,146], which are currently an ongoing, serious issue in agriculture [147,148].

4.2. Structure/Function Studies on Brevinin-2SSb, Ranateurin-2SSa and Granuliberin-SSa

B2SSb was found to exhibit strong antioxidant and free-radical scavenging activity whilst R2SSa was found to possess this activity at lower levels [101], and it is generally accepted that antioxidant activity is related to a variety of factors, including the secondary structure, amino acid arrangement and amino acid composition of AMPs/AOs [149,150]. Most importantly, the sequences of these peptides were rich in hydrophobic and aromatic residues such as tyrosine, tryptophan, methionine, proline and cysteine that have the ability to promote the scavenging of free radicals [151,152]. In particular, peptides with free cysteines are strongly antioxidative due to the highly reductive mercapto group possessed by these residues [149,150], which was proposed to help explain the higher levels of the antioxidative activity shown for B2SSb compared to R2SSa [101]. However, despite possessing two proline residues, which are one of the most common residues found in AOs [149,150], no antioxidative activity was detected for GSSa, indicating the importance of other factors to this activity [101]. For example, the amphiphilicity of AMPs/AOs appears to enhance their radical-scavenging activities by increasing their solubility and facilitating interactions and proton exchanges with radical species [149,150]. Based on the observation that amphibian AMPs and AOs show precursor similarity and that many AMPs have antioxidant activity whilst many AOs have antimicrobial activity, it has been suggested that these two peptide classes may have a common evolutionary origin [153,154]. Interestingly, most recently, AOs were identified in the skin secretions of Salamandra salamandra (the European fire salamander) [155], including salamandrin-1, which appeared to be derived from CFBD-1, a β-defensin first identified in Cynops fudingensis (the Fuding fire belly newt) [156]. Salamandrin-1 showed no antimicrobial or cytotoxic activity, and it was proposed that after glandular extrusion, this peptide was proteolytically cleaved from CFBD-1, thereby representing a novel amphibian strategy for generating AOs from AMPs [155].
To gain insight into mechanisms underpinning other biological activities of B2SSb, R2SSa and GSSa, scanning electron microscopy (SEM) was used to study the effects of these peptides on the morphology of various cells and microbes [101]. These AMPs were found to induce a range of surface abnormalities in the cells of Staphylococcus aureus, C. michiganensis, E. coli, X. oryzae and C. albicans. These effects included corrugations, blebbing and a loss of membrane integrity consistent with membranolytic action, although no clear correlation with the specificity and level of the antimicrobial action shown by B2SSb, R2SSa and GSSa could be discerned. However, these observations clearly suggested that these peptides interacted with the cell surface components of these various microorganisms, which was strongly supported by data showing that these peptides bound to both LPS and lipoteichoic acid (LTA) [101]. The ability to either promote or inhibit the action of AMPs is well established for LTA [157,158], which is a major, anionic and surface component found in the cell wall of Gram-positive bacteria [159,160], and LPS [37,39], which, as described above in Section 1, is the major anionic component of the OM possessed by Gram-negative bacteria [40,41]. Based on the affinity of B2SSb and R2SSa for LTA, it was also suggested that these peptides may have the potential to act as anti-inflammatory agents by neutralizing the endotoxic activity of the molecule [101]. In addition to its cell wall functions, LTA is believed to translocate into systemic circulation and function as an endotoxin by activating the host immune system to induce sepsis [161,162]. However, this function of LTA has been the subject of considerable debate [163,164] and recent studies have suggested that after LPS, lipoprotein is the most potent pro-inflammatory endotoxin of bacterial cell walls [162]. In contrast, B2SSb and R2SSa showed a much higher affinity for LPS than LTA [101], and it is well established the former molecule acts as an endotoxin when released into systemic circulation by bacteria, which can lead to the induction of pro-inflammatory cytokines, sepsis and septic shock [161,165,166]. Based on these observations, it was proposed that B2SSb and R2SSa possessed a strong potential to act as anti-inflammatory agents in the treatment of LPS-mediated sepsis, although through apparently different mechanisms [101]. The ability of R2SSa to bind LPS was accompanied by a lack of activity towards Gram-negative bacteria (Table 2) and similar results have been reported for other amphibian AMPs [167], such as tigerinins, which are found in frogs from a number of families [168]. In contrast, B2SSb was able to both bind LPS and kill Gram-negative bacteria (Table 2) and, in combination, these observations are consistent with the view that the anti-endotoxin activity and antibacterial action of AMPs do not necessarily correspond and can represent different properties of these peptides [169]. Indeed, B2SSb would appear to fit a number of the general criteria required for this dual mode of action [169], including the possession of a strong positive charge and the ability to form an amphiphilic structure [101]. The capacity to exert antibacterial and anti-endotoxin activity similar to that described for B2SSb (Table 2) [101] has been reported for both other amphibian peptides [167,170,171] and AMPs from other sources [169,172,173,174,175]. This capacity gives these AMPs an advantage over many conventional antibiotics, such as β-lactams, which can promote the release of endotoxins and augment the severity of sepsis [161,174,175,176,177]. Nonetheless, efforts to introduce AMPs into sepsis therapy have generally failed [173,174,175] and currently, the only potential candidate in clinical trials would appear to be the synthetic peptide, EA-230, which, for example, has been shown to attenuate LPS-mediated systemic inflammation in experimental human endotoxemia [178,179]. Accordingly, it would seem that B2SSb and R2SSa merit further investigation as anti-sepsis agents, given that that there is no effective, safe drug to treat the disease [173] and sepsis is considered to be the most common cause of mortality in intensive care units [180,181].
SEM was also used to investigate the effect of B2SSb, R2SSa and GSSa on mammalian cells, which showed that these peptides induced high levels of membrane destruction when directed against cells of the COS7 and HepG2 cell lines [101], indicating a membranolytic mode of action that was suggestive of a carpet-type mechanism [16,30,39,42]. In the case of HepG2, the use of membranolytic action to promote killing cancer cells is typical of not only amphibian AMPs, but of these peptides in general [116,117,118], which is discussed in detail below in Section 5.1.1 and Section 5.1.2 in relation to B1EMa and B1EMb from G. emeljanovi [119,120,121,122]. However, as described above in Section 4.1 and Section 4.2, the ability of B2SSb, R2SSa and GSSa to induce the lysis of both microbial cells and normal mammalian cells [101] is atypical of the selectivity generally shown by AMPs [23,42]. Indeed, such a lack of specificity is more characteristic of cytolytic toxins found in the venom of stinging insects within the order, hymenoptera [182,183], which are generally produced as a response to a perceived threat [184]. One of the most studied examples of these cytolytic toxins is melittin from Apis mellifera (the European honey bee), which is the major cause of pain to humans and animals within the venom of these insects and serves a primary role in defending bee colonies from predators [184,185]. Interestingly, recent studies have suggested that some AMPs may serve roles in amphibian antipredator defence systems by promoting the permeabilization of a predator’s epithelial tissue to facilitate the delivery of co-secreted BKs and BRPs, such as caeruleins [74,186,187]. These neuropeptides have been isolated from the skin secretions of a number of anurans [106,188] and it has been proposed that the cytolytic action of AMPs promotes their delivery to the endocrine and nervous systems of predators, thereby causing pain and other adverse effects that deter predation [71]. Given the ability of B2SSb, R2SSa and GSSa to efficiently permeabilize mammalian cells, these peptides could potentially serve such roles in G. susurra by promoting the uptake by predators of BSSa or other myotropic agents produced by this frog [101]. Indeed, it was proposed that the cytotoxic activity of the amphibian AMPs involved in these delivery systems, per se, may provide a secondary and fast-acting effect on some predators; for example, by causing irritation or pain on oral mucosa [74,186]. It seems likely that delivery mechanisms based on tissue permeabilization may be used by other creatures, and mechanisms of this type would appear to be of particular significance in that they command a reappraisal of the textbook distinction between poisonous and venomous animals [186]. A summary of AMPs from G. susurra is given below in Box 3.
Box 3. AMPs from G. susurra.
  • G. susurra, which occurs in Sado Island, Japan, produces brevinin-1SSc (B1SSc), brevinin-1SSd (B1SSd), brevin-in-2SSb (B2SSb), brevinin-2SSd (B2SSd) and esculentin-2SSa (E2SSa), which are cationic and possess a C-terminal, heptapeptide and Rana box motif (Figure 1).
  • G. susurra produces seven atypical ranid-AMPs, of which three were characterized, namely, ranatuerin-2SSa (R2SSa), brevinin-2SSb (B2SSb) and granuliberin-2SSa (GSSa). All of these peptides are cationic, with the first two carrying modified C-terminal Rana box motifs and the third possessing a C-terminal amide moiety (Figure 1).
  • B2SSb and R2SSa exhibit antioxidant activity and intrinsic antioxidants are essential for amphibians to protect their skin against both endogenous and exogenous oxidative insults.
  • B2SSb, R2SSa and GSSa show varying levels of efficacy towards cancer cells but are cytotoxic to normal mammalian cells. Modified to reduce their cytotoxicity, B2SSb, R2SSa and GSSa show the potential for development to treat various cancers.
  • B2SSb, R2SSa and GSSa exhibit varying levels of efficacy towards fungi and Gram-negative bacteria that are pathogenic to humans. Modified to reduce their cytotoxicity, B2SSb, R2SSa and GSSa show the potential for development to treat infections due to these microbes (Table 2).
  • B2SSb, R2SSa and GSSa show varying levels of efficacy towards fungi, Gram-positive bacteria and Gram-negative bacteria that are pathogenic to plants, indicating the potential for development as crop protection agents (Table 2).
  • B2SSb and R2SSa bind strongly to endotoxins and show the potential to act as anti-inflammatory agents.
  • B2SSb and R2SSa appear to be predominantly formed from an α-helical structure, whereas GSSa appears to be primarily formed from a β-sheet structure, and the antibacterial, antifungal, anticancer and cytotoxic action of these AMPs appears to involve membranolytic mechanisms.

5. AMPs from G. emeljanovi

G. emeljanovi (the Imienpo Station frog or Rough-Skinned frog), which was first identified in 1913 [75], appears to be the archetypal species of Glandirana and is the best characterized in relation to its AMPs [86]. The initial characterization showed that there were six of these peptides that each possessed a C-terminal Rana box motif and could be considered to fall into three groups (Figure 1). The first of these groups was formed by brevinin-2EMa (B2EMa: SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC), brevinin-2EMb (B2EMb: GIMSIVKDVAKNAAKEAAKGALSTLSCKLAKTC) and brevinin-2EMb’ (B2EMb’: GIMSIVKDVAKTAAKEAAKGALSTLSCKLAKTC), which were previously known as gaegurin 1, gaegurin 2 and gaegurin 3 (gaegurin 2′), respectively (Figure 1). B2EMb’ is generally regarded as a variant of B2EMb rather than a homologue as these peptides only differ by a N → T substitution at sequence position 12 (Figure 1). Each of these AMPs exhibited very low levels of hemolysis and possessed potent activity against Gram-positive bacteria, but weaker activity against Gram-negative bacteria and fungi (Table 1), and since their initial characterization, no further work on any of these brevinins appears to have been conducted. The remaining two major groups of AMPs from G. emeljanovi are formed from brevinin-1 EMa (B1EMa: FLGALFKVASKVLPSVKCAITKKC) and brevinin-1 EMb (B1EMb: FLPLLAGLAANFLPTIICKISYKC), previously known as gaegurin 5 and gaegurin 6, respectively, and esculentin-2 EM (E2EM: GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC), formerly called gaegurin 4 (Figure 1) [83,86]. During the initial characterization of B1EMa and E2EM, a minor inconsistency in the sequence of each peptide was revealed, which was subsequently corrected; namely K17 → F17 and L35 → K35 substitutions, respectively [86]. These variants are generally referred to as B1EMa’ (FLGALFKVASKVLPSVFCAITKKC) and E2EM’ (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLALTC) and the accepted sequences of all known AMPs from G. emeljanovi, as listed in the Swissprot protein database [102], are shown in Figure 1.
Biologics 04 00027 i007
G. emeljanovi: Taken from [80].

5.1. Brevinin-1 EMa and Brevinin-1 EMb

The initial characterization of B1EMa and B1EMb showed that these peptides were each 24 residues in length and possessed net charges of +5 and +2, respectively (Figure 1), [83] and, subsequently, the complete cDNA encoding B1EMa was isolated from a library constructed with mRNAs from the skin of G. emeljanovi [84]. The sequence of the B1EMa precursor polypeptide was deduced from this clone, which revealed a tripartite organization that was similar to that of precursor polypeptides from AMPs of G. susurra [101]: an N-terminal signal sequence followed by an acidic spacer region that was terminated at the C-terminus by the mature peptide [84]. The alignment of the sequences of B1EMa and B1EMb showed that they were highly homologous, paralleling the brevinin 1 peptides and other families of AMPs produced by G. rugosa and G. susurra (Figure 1). It is believed that amphibians produce homologous AMPs as a strategy to diversify and optimize their defence capabilities [70,71] and, consistent with these observations, B1EMa and B1EMb were found to serve a variety of biological roles (Table 3, Table 4 and Table 5) [70,100,112].

5.1.1. The Biological Activity of Brevinin-1 EMa, Brevinin-1 EMb and Their Derivatives

B1EMa and B1EMb were first recognized for their antimicrobial activity [83] and particularly, their strong preference for Gram-positive bacteria (Table 3 and Table 4) [83,86,121,189,190,191]. There is an urgent need for novel agents to combat infections caused by these bacteria and their MDR forms, which are a major global cause of morbidity and mortality [192,193]. In response, numerous derivatives of B1EMa and B1EMb were produced in an effort to maintain or improve the antibacterial efficacy of the parent AMPs (Table 3 and Table 4) [86] and it was found that reduced or linearized B1EMa retained the same profile and preferences for antimicrobial activity as the parent peptide [189]. In contrast, the linear form of B1EMb showed a complete loss of antibacterial and antifungal activity, but when this analogue underwent S → C substitutions at positions 18 and 24, the antimicrobial activity was comparable in profile and the preferences to B1EMb were restored [190]. It was proposed that both B1EMb and its serine substituted analogue showed the potential for development as novel antimicrobials; for example, these peptides exhibited potent activity towards Mycobacterium smegmatis [190]. This organism is generally used as a non-pathogenic model to assay AMPs for potential activity against M. tuberculosis, which is the causative agent of tuberculosis [194,195] and a leading cause of death from an infectious disease among adults worldwide [196]. Currently, M. tuberculosis is classed as of critical priority by the WHO and there is an urgent requirement for novel agents to combat infections due to this organism [65], which suggests that potentially, B1EMb and its serine substituted analogue could be developed to serve in this capacity [190]. Nonetheless, the potential of B1EMa, B1EMb and their derivatives to serve as AMPs in a therapeutic context only appears to have been followed up in a few cases [197,198].
In relation to B1EMa, in what would appear to be the first major report on the antiviral potential of AMPs from G. emeljanovi, or indeed, the Gladirana genus, a recent study investigated the activity of peptide B against a series of viruses [199]. This peptide (FLGWLFKVASKVL-NH2) [199], which was essentially the N-terminal sequence of B1EMa (1–13) with a V → W substitution at position 4 [120,191], exhibited activity against enveloped viruses but not non-enveloped viruses [199]. Viruses can be divided into two main categories: enveloped viruses, which are characterized by the possession of a membrane that is derived from the host cell and encapsulates the virion, and non-enveloped viruses, which lack a membrane surrounding their protein capsid [200,201]. The viruses inactivated by peptide B included hepatitis C virus, herpes simplex virus and notably, retrovirus and lentivirus [199]. Retroviruses can cause an array of malignancies, immunodeficiencies and neurologic disorders, whilst lentivirus, which is a sub-type of retrovirus, can cause chronic and deadly diseases, including AIDS [202]. Peptide B showed similar levels of potent activity against retrovirus and lentivirus that were accompanied by comparable levels of cytotoxicity to human keratinocytes (HFK) and, in the case of retrovirus, these levels of activity were quantified using a variety of infection models (Table 3) [199].
Peptide B also showed activity against a range of Gram-positive and Gram-negative bacteria, notably methicillin-resistant S. aureus (MRSA) and in both this case and the peptide’s antiviral activity [199], the underlying mechanisms appeared to involve the formation of an amphiphilic α-helical structure and membranolytic mechanisms (Table 6) [199], which was consistent with previous studies [120,191]. However, given the peptide’s significant cytotoxicity to human cells (Table 3), efforts to enhance both its selective antibacterial and antiviral activity were undertaken and stapled analogues were produced, which is described below in Section 5.3 [199]. A major example of an antibacterial derivative from B1EMa was GA-K4AL (FAKWAFKWLKK-NH2), which was essentially the N-terminal sequence of B1EMa (1–11), with multiple residue substitutions (Table 3) [197]. This peptide was developed from lead molecules identified in earlier work that showed antibacterial activity at levels consistent with the therapeutic application but also exhibited strong hemolytic activity [191], which is clearly undesirable for such an application [203]. However, the systematic engineering of these lead molecules through multiple residue substitutions that effectively modulated their hydrophobicity and amphiphilicity generated GA-K4AL, which showed negligible hemolysis, but retained antibacterial activity with action against both Gram-positive and Gram-negative bacteria [197], contrasting to B1EMa [83] (Table 3). Notably, GA-K4AL also showed superior antibacterial efficacy to omiganan [197], which is a broad-spectrum analogue of the bovine AMP, indolicidin [204]. Omiganan has been clinically trialled for the topical treatment of a variety of conditions, such as atopic dermatitis [205], and most recently has been developed to combat skin infections due to MRSA [206]. Based on these observations, it was proposed that GA-K4AL may serve as a useful lead molecule for the development of novel antibiotics and merited investigation for its clinical and commercial potential [197].
In relation to B1EMb, one study investigated the antimicrobial activity of a C-terminally amidated isoform of the peptide, B1EMb-NH2 (FLPLLAGLAANFLPTIICKISYKC-NH2), and it was found that it possessed levels of activity against a range of bacteria and fungi [190] that were similar to those of B1EMb (Table 4). These observations suggested that C-terminal amidation had not greatly affected the antimicrobial activity of the peptide [190]. It is well established that this structural modification can have a variable effect on the antimicrobial efficacy of AMPs, promoting either decreases or increases in efficacy in some cases and having no effect on efficacy in other cases [207]. However, an important result from these studies on B1EMb-NH2 was that the peptide showed activity against MRSA (Table 4) which was observed to be the most potent here for AMPs from G. emeljanovi [190] (Table 1, Table 2, Table 3 and Table 4, Table 6 and Table 7). Although most MRSA infections, such as those of skin and subcutaneous tissues, are relatively harmless, others, such as bacteremia, endocarditis and pneumonia, can be life-threatening and are associated with high levels of morbidity and mortality [208,209,210]. Currently, there is an urgent requirement for novel agents to combat infections due to MRSA, which is currently classed by the WHO as a high-priority pathogen [65] and based on these observations, it was suggested that B1EMb-NH2 may have the potential to serve in this capacity [190]. Other major examples of antibacterial derivatives from B1EMb were PTP6 (FLKLLKKLAAKLF) and PTP7/PTP12 (FLGALFKALSKLL), which are essentially analogues of its N-terminal region, B1EMb (1–13), with multiple residue substitutions and deletions [121,198]. Similar to B1EMa, B1EMb has a preference for Gram-positive bacteria [83], which was also shown by PTP7/PTP12 who exhibited potent action against organisms such as S. aureus, but much weaker activity towards bacteria such as E. coli (Table 4) [211]. Using PTP7/PTP12 and derivatives, these latter authors showed that there was a strong correlation between the activity of these peptides against Gram-positive bacteria, their membranolytic action and their hydrophobicity [211], which, as described above in Section 1, is a major determinant in the activity of AMPs [16,23]. However, this correlation was not observed for Gram-negative bacteria and it was suggested that peptide characteristics in addition to hydrophobicity may be important to facilitating diffusion through the outer membrane of these bacteria and thereby, membranolytic antibacterial action [211]. Interestingly, these correlations were observed when the peptide hydrophobicity was quantified as the retention time in reverse-phase high-performance liquid chromatography, but not when measured as their mean hydrophobicity or <H>, as defined in Section 1 [211]. It was proposed that this experimental technique provided a better representation of peptide hydrophobicity because this property also depends upon peptide α-helicity, which is not taken into account by a simple mean of residue hydrophobicity [32,211]. Based on their preference for Gram-positive bacteria, B1EMb, PTP6 and PTP7/PTP12 were assayed against a panel of oral streptococci and each of these peptides was found to possess potent activity against S. mutans, S. sobrinus, S. sanguis and S. gordonii (Table 4) [198], which are major oral pathogens, causing diseases such as dental caries and periodontitis [212]. Safety considerations showed that these peptides were not toxic to normal eukaryotic cells and appeared to be non-immunogenic, suggesting that they would be safe for use in the gastrointestinal tract [198]; the induction of an immune response is a potential hazard associated with the therapeutic use of AMPs [213,214]. B1EMb, PTP6 and PTP7/PTP12 were also able to promote synergistic antibacterial effects with chlorhexidine or xylitol [198], which are conventional oral antimicrobials [215,216]. A similar synergistic action has been reported for other AMPs in combination with chlorhexidine against S. mutans, oral pathogens in plaque biofilms [217,218] and strains of P. aeruginosa involved in canine otitis externa, the chronic inflammation of the external ear canal [219]. This synergistic ability is well established for AMPs and appears to be based on their capacity to induce a loss of barrier function in microbial membranes, thereby facilitating the uptake of traditional antibiotics by target microbes [220]. Based on these observations, it was proposed that B1EMb, PTP6 and PTP7/PTP12, either alone or in combination with established oral antimicrobials, might be effective in the treatment of cariogenic oral streptococci [198,221]. Other AMPs that have been investigated for use as oral antimicrobials include C16G2 [222], which is in clinical trials as a mouth rinse component selective for S. mutans [179]. A major example of these AMPs is kappacins, which are cleaved from milk proteins and [223] serve as components in commercially available mouthwash and other dental care products to combat gingivitis and dental plaque [224].
Table 3. Antimicrobial, cytotoxic and hemolytic activity of B1EMa and its derivatives.
Table 3. Antimicrobial, cytotoxic and hemolytic activity of B1EMa and its derivatives.
B1EMaA4W- B1EMaV8W- B1EMaGA-K4AL Peptide B
BacteriaMIC (µM)
B. subtilis<4.04.99.94.4ND
M. luteus<3.019.639.54.4ND
S. aureus1.32.59.94.4ND
MRSANDNDNDND12.5
S. epidermidis<5.59.819.84.4ND
E. coli<20.019.619.88.8ND
S. dysenteriae<20.09.819.88.8ND
S. typhimurium>40.039.279.016.6ND
K. pneumoniae<20.09.89.94.4ND
P. putida19.4NDNDNDND
P. aeruginosa>35.078.4158.08.8ND
P. mirabilis>75.0>155.0>158.0NDND
S. marcescens>77.0NDNDNDND
FungiMIC (µM)
C. albicans19.4NDNDNDND
S. cerevisiae19.4NDNDNDND
VirusesEC50 (µM)
RetrovirusNDNDNDND<11.0
CytotoxicityCC50 (µM)
Human keratinocytes<1.5NDNDND>10.0
HemolysisMaximal levels (%)
Human erythrocytes<1.511.96.7<1.0ND
Table 3 was compiled from [83,191,197,199] and shows the minimum inhibitory concentration (MIC, µM) of B1EMa (FLGALFKVASKVLPSVK-CAITKKC) and its derivatives, A4W- B1Ema (FLGWLFKVASK), V8W-B1EMa (FLGALFKWASK), GA-K4AL (FAKWAFKWLKK-NH2) and peptide B (FLGWLFKVASKVL-NH2) from G. emeljanovi against a series of bacteria and fungi. Also shown is the activity of these peptides against viruses as the half maximal effective concentration (EC50, µM), against human foreskin keratinocytes as the half maximal cytotoxicity concentrations (CC50, µM) and against erythrocytes as the maximal % hemolysis achieved. ND denotes ‘not determined’.
Table 4. Antimicrobial and hemolytic activity of B1EMb and its derivatives.
Table 4. Antimicrobial and hemolytic activity of B1EMb and its derivatives.
BacteriaB1EMbB1EMb-NH2PTP6PTP7/PTP12
MIC (µM)
B. subtilis3.84.8NDND
M. luteus1.01.2ND2.1
S. aureusND1.2ND3.5
MRSAND4.8NDND
S. epidermidis3.82.4ND6.4
M. smegmatis1.24.8NDND
C. diphteriaeND1.6NDND
S. mutans<5.0ND4.14.4
S. sanguis2.4ND<8.04.4
S. sobrinus2.4ND4.14.4
S. gordonii1.2ND8.24.4
P. vulgarisND>38.0NDND
E. coli>9.02.44.1>70.0
P. putida57.60NDNDND
S. dysenteriae19.20NDNDND
S. typhimurium>19.0ND16.3>70.0
K. pneumoniae>9.0ND16.317.6
P. mirabilis>75.0NDNDND
P. aeruginosa57.6019.2NDND
S. marcescens>75.0NDNDND
S. flexneriND9.6NDND
FungiMIC (µM)
C. albicans19.24.8NDND
S. cerevisiae19.2NDNDND
HemolysisMaximal levels (%)
Human erythrocytes<1.0ND<1.0<4.0
Table 4 was compiled from [83,121,190,198,211] and shows the minimum inhibitory concentration (MIC, µM) of B1EMb (FLPLLAGLAANFLPTIICKISYKC) and its derivatives, B1EMb-NH2 (FLPLLAGLAANFLPTIICKISYKC-NH2), PT6 (FLKLLKKLAAKLF) and PTP7/PTP12 (FLGALFKALSKLL), from G. emeljanovi against series of bacteria and fungi. Also shown is the activity of these peptides against human erythrocytes as the maximal % hemolysis achieved. ND denotes ‘not determined’.
Similar to AMPs from G. susurra [101], in addition to antimicrobial activity, B1EMa and B1EMb were found to exhibit other biological properties [119,120,121,122,225]; for example, anticancer activity was demonstrated for both B1EMa and several analogues of its N-terminal sequence, B1EMa (1–11) (Table 5) [120]. These analogues, A4W-B1EMa (FLGWLFKVASK) and V8W- B1EMa (FLGALFKWASK) (Table 5) were essentially B1EMa (1–11) with A → W and V → W substitutions at positions 4 and 8 of the peptide’s sequence, respectively (Table 5) [120]. Similarly to B1EMa [83], these analogues have been shown to possess potent antibacterial activity (Table 3), clearly illustrating the multifunctionality of these three peptides [191]. B1EMa, A4W-B1EMa and V8W-B1EMa demonstrated activity against a range of cancer cell lines, including those representing cancers of the lung (A549), breast (MCF-7), prostate (PC-3) and colon (HCT116) [120] (Table 5), which, globally, are the top four causes of cancer mortality [226]. More recently, another strongly antibacterial derivative of B1EMa [197] which was found to possess anticancer action was GA-K4 (FLKWLFKWAKK-NH2), which is essentially B1EMa (1–11) with A → W and V → W substitutions at positions 4 and 8 of the peptide’s sequence [119]. GA-K4 was found able to kill a spectrum of cancer cells that was similar to that of A4W-B1EMa and V8W- B1EMa, but with a potency that was generally up to tenfold stronger than the latter two peptides (Table 5) [119,120]. GA-K4 was also able to synergize the activity of doxorubicin [119], which is a frontline anticancer drug that inhibits DNA synthesis and function through alkylation and is extensively used in combination chemotherapy [227,228]. For example, the co-administration GA-K4 and doxorubicin was circa nine times more effective against cells of kidney cancer (A498) and five times more effective against those of lung cancer (A549) compared to doxorubicin alone [119]. It was suggested that GA-K4 may kill cancer cells using membranolytic mechanisms and that the synergistic effect uptake of doxorubicin by these cells may be promoted by the ability of the peptide to compromise the integrity of their CM [119], as shown for other AMPs [229,230,231]. These observations reinforce the general view that AMPs promote the uptake of anticancer agents using mechanisms generally similar to those used in the case of antibiotics, as discussed above in this section [232]. GA-K4, along with B1EMa, A4W-B1EMa and V8W-B1EMa, showed low levels of hemolysis (Table 3) and no cytotoxicity to normal eukaryotic cells (Table 5), which led to the suggestion that they were worthy of further investigation in the production of therapeutically relevant, anticancer agents [119,120]. Reinforcing the potential of A4W-B1EMa and V8W-B1EMa to serve as both anticancer and antimicrobial agents, these peptides and their derivatives have been patented in both capacities [233,234].
Consistent with the multifunctionality of AMPs [2,109,110,111], B1EMb was shown to possess anticancer activity (Table 5) [121] and to act directly on pancreatic β Rin5mf cells, stimulating insulin secretion [225]. As described above in Section 5, B1EMb is highly prevalent in the skin of G. emeljanovi [12], and its ability to stimulate an insulin release suggested that the skin of the frog stores some components of insulin secretagogues [225], as reported for other frogs and their AMPs [70,235,236]. Based on these results, it was proposed that B1EMb should be investigated for its effect on insulin-related disorders to aid the design of anti-diabetic drugs; for example, to combat type 2 diabetes mellitus [225], which is a rapidly increasing global problem that is closely linked to the current, burgeoning epidemic of obesity [237]. In relation to anticancer activity, B1EMb, its derivative, PTP7/PTP12 and other analogues were found to have activity against a range of cancer cell lines, including those representing breast cancer (MCF-7) and its MDR variant (MCF-7/DOX) (Table 5) [121]. This latter cell line shows resistance to doxorubicin through the possession of the P-glycoprotein [238,239], which is a member of the ABC transporter family that is found in many MDR cancer cells and acts as an efflux pump, eliminating a wide range of drugs and other substrates from these cells [240,241]. The highest efficacy of the tested peptides was shown by B1EMb and PTP7/PTP12, which showed potent activity against all the cell lines tested, including MCF-7 and MCF-7/DOX (Table 5) [121]. These results clearly showed that B1EMb and PTP7/PTP12 were not P-glycoprotein substrates and, taken with their lack of toxicity to normal eukaryotic cells, led to the proposal that these peptides could be developed as therapeutic agents to treat MDR cancers [121]. Breast cancer is rapidly becoming the leading cause of oncologic morbidity and mortality among women on a global scale [226], in part due to the lack of drugs able to prevent or reverse MDR mediated by P-glycoprotein and other efflux transporters [242,243].
Table 5. The anticancer activity of B1EMa, B1EMb and their derivatives.
Table 5. The anticancer activity of B1EMa, B1EMb and their derivatives.
Cancer CellsB1EMaA4W-B1EMaV8W-B1EMaGA-K4B1EMb PTP6PTP7/PTP12
IC50 (µM)
A49854.156.5169.121.5NDNDND
A54957.182.0329.914.52.59.15.6
HCT11644.423.5113.914.8NDNDND
MCF-772.059.6156.9ND1.911.53.7
MCF-7/DOXNDNDNDND1.8ND3.7
MKN4513.763.8112.622.5NDNDND
PC-317.195.5137.429.12.08.73.5
SK-MEL-218.623.5ND22.3NDNDND
NCl-H63016.458.6102.2NDNDNDND
Hep 3B NDNDNDND1.99.83.8
SK-OV-315.071.1118.712.6NDNDND
293NDNDNDND2.29.14.7
CytotoxicityIC50 (µM)
MCF-10aND240.5343.4NDNDNDND
Table 5 was compiled from [119,120,121] and shows the half inhibition concentration (IC50, µM) of B1EMa (FLGALFKVASKVLPSVKCAITKKC) and its derivatives, A4W- B1EMa (FLGWLFKVASK), V8W-B1EMa (FLGALFKWASK) and GA-K4AL (FAKWAFKWLKK-NH2), along with B1EMb (FLPLLAGLAANFLPTIICKISYKC) and its derivatives, PTP6 (FLKLLKKLAAKLF) and PTP7/PTP12 (FLGALFKALSKLL), from G. emeljanovi against a range of cancer cell lines. These included A498 (kidney), A549 (lung), HCT116 (colon), MCF-7 (breast), MCF-7/DOX (breast resistant to doxorubicin), MKN45 (stomach), PC-3 (prostate), SK-MEL-2 (skin), NCl-H630 (liver), Hep 3B (liver), SK-OV-3 (ovary), U937 (lymphoma) and 293 (kidney). Also shown is the IC50 (µM) of these peptides against MCF-10a, which is a non-transformed breast cell line. ND denotes ‘not determined’.

5.1.2. Structure/Function Relationships of Brevinin-1 EMa, Brevinin-1 EMb and Their Derivatives

B1EMa and B1EMb were unstructured, or random coil, in aqueous solution but in a membrane mimetic environment and each peptide adopted an amphiphilic α-helical architecture that stretched between residues 3–20 and residues 4–24 of B1EMa and B1EMb, respectively (Figure 2D,E and Figure 3) [189,244,245]. This conformational behavior is typical of α-helical AMPs and it is well established that these random coil to α-helix transitions are a major force in the binding and insertion of these peptides into membranes [246]. The possession of an amphiphilic α-helical structure by B1EMa and B1EMb was found to be essential for their membrane interactions and thereby their antimicrobial activity, anticancer action and insulinotropic properties [86,120,121,189,244]. However, a series of structure/function studies on these peptides showed that similarities and differences between their α-helical structures influenced their capacity for membrane interactions and biological activity [86]. Both B1EMa and B1EMb were found to possess a proline residue at position 14 of their sequences (Figure 1 and Figure 2D,E), which caused a kink in their α-helical structure, endowing it with a curvature of circa 25° (Figure 3) [86,189,244,245]. Similarly located, internal proline residues have been reported for many other α-helical AMPs [69] and it is well established that this residue can either break or kink an α-helix due to the inability of its amino acid side chain to donate an amide hydrogen bond and the steric interference caused to the α-helix formation by this side chain [117,247]. Essentially, both B1EMa and B1EMb formed a continuous, curved, amphiphilic α-helix with hydrophilic and lysine residues located on its convex face and hydrophobic residues such as valine and isoleucine situated on its concave face (Figure 2D,E and Figure 3) [86,189,244,245]. A similar molecular architecture has been reported for a number of other α-helical AMPs [69,248] and, in general, the presence of their proline kink has been shown to be relevant to the activity of these peptides [248,249,250,251]. These AMPs are prevalent in amphibians [69,70,71], with prototypic examples including buforins and their derivatives [34,35] and maculatin 1.1 from Litoria genimaculata (the Green-Eyed Tree frog) [252,253]. Nonetheless, it is known that the presence of a proline kink in an α-helical structure can have a variable effect on the biological activity of AMPs [248,251,254,255,256] and, in response, the role of this residue in the biological action of B1EMa and B1EMb was probed [189,244]. P → A substitutions at position 14 of these peptides had a generally similar effect on their overall structures, generating molecules that showed a low level of intrinsic curvature of circa 10° or less, but lacked the prominent kink at position 14 of the parent AMPs [86,189,244]. However, in contrast, P → A substitutions at position 14 of these peptides promoted differing effects on their selectivity and biological action [86,189,244]. In the case of B1EMa, this substitution had no significant effect on the antimicrobial activity but led to greatly enhanced hemolytic activity [189]. Similar results have been reported for other α-helical AMPs [248] and for both, these peptides and B1EMa [189], a primary driver of this effect, appeared to have a disruption to their compact, curved structures and, hence, their ability to shield their apolar residues from the aqueous phase [189,248]. This loss of shielding ability effectively increased the hydrophobicity of these peptides and thereby their affinity for zwitterionic lipids [189,248], which are the primary constituents in the outer leaflet of the erythrocyte CM [23,257]. In contrast, a P → A substitution at position 14 of B1EMb led to a significant decrease in the antimicrobial activity, but had little effect on the hemolytic activity [244]. Similar results were reported for the corresponding substitutions in maculatin 1.1 [258,259,260], which led to the suggestion that there may be similarities in the structure/function relationships of the proline residues in these two AMPs [86]. A P → A substitution at position 15 of maculatin 1.1 appeared to promote a decrease in the antibacterial activity by disrupting a membrane-interactive, amphiphilic wedge formed by this proline and flanking charged and hydrophobic residues [252,261]. However, it has been shown that the resulting loss of the amphiphilic structure by maculatin 1.1 promotes an increase in the hemolytic activity [252,258,260], which contrasts to B1EMb and suggests that the antibacterial action of the latter peptide is affected differently by a P → A substitution than is maculatin 1.1 [244]. Indeed, B1EMb would seem to have no capacity to form an amphiphilic wedge similar to that of maculatin 1.1, given that the proline residue at position 14 of B1EMb is flanked on either side by strongly hydrophobic four-residue segments (Figure 1). There is some evidence to suggest that the internal proline of both B1EMb and other α-helical AMPs may contribute to their bacterial selectivity by promoting a preferential affinity for anionic lipids, although the mechanisms by which the residue mediates this lipid preference are unclear [86,244,257]. Currently, it is generally believed that the underlying role of the proline residue at position 14 of both B1EMb and B1EMa is to stabilize and maintain the arrangements of the amphiphilic α-helical structure that optimize their membrane interactivity and, thereby, their capacity for selectivity and biological action [86,189,244,245].
Structure/function studies on B1EMa and B1EMb also showed that the proline residue at position 14 of their sequences effectively divided each of these peptides into two regions, formed by residues 1–13 and residues 15–24, respectively (Figure 2D,E and Figure 3) [86,189,244,245]. The region delineated by residues 15–24 of B1EMa (B1EMa (15–24)) and B1EMb (B1EMb (15–24)) includes the C-terminal, heptapeptide and Rana box motif of these peptides (Figure 1) [83]. Showing structural similarities to the AMPs produced by G. rugosa [85], this Rana box motif was formed by a loop-like, α-helical fold that was stabilized by a disulfide bond between their cysteine residues at positions 18 and 24 of the peptide, respectively (Figure 3) [83]. The possession of an intact Rana box region by B1EMb appeared to be required for anticancer action [121] and insulinotrophic activity [225] and there is evidence suggesting that this is also the case for the antimicrobial activity of the peptide [86]. Studies on both B1EMb and B1EMb-NH2 showed that the loss of the disulfide bond between their cysteine residues led to decreased insulinotrophic and antimicrobial activity, respectively, that was attributed to the reduced ability of their C-terminal regions to stabilize their lipid interactive α helical structure [190,225]. In contrast, it has been shown that the reduction in the disulfide bond between the cysteine residues at positions 18 and 24 of B1EMa led to no significant loss of either the α-helicity or antibacterial activity, suggesting that an intact Rana box region was not necessary for the biological activity of the peptide [189]. Similar results have been reported for the membranolytic antibacterial peptide, thanatin, from Podisus maculiventris (the Spined soldier bug) [264], that shows homology and structural similarities to B1EMa, including the possession of a C-terminal Rana box-type motif comprising an eight-residue loop stabilized by a disulfide bridge [265]. In further contrast to B1EMb [86], C → S substitutions in the Rana box region of both linear B1EMa and thanatin led to decreased antimicrobial activity, which led to the suggestion that these cysteine residues, but not their linkage, helped maintain the secondary structure and hydrophobicity/amphiphilicity balance required by these peptides for biological action [189,266]. Interestingly, B1EMa also shares significant homology with a number of cytolytic AMPs, including melittin, as well as ponericin W and Css54, which are found in the venom of the ant, Pachycondyla goeldii and Centruroides suffuses (the Mexican scorpion), respectively, although the functional significance of these observations was unclear [267,268,269].
The region delineated by residues 1 to 13 of B1EMa (B1EMa (1–13)) and B1EMb (B1EMb (1–13) comprises an amphiphilic α-helix that is flanked at the N-terminus by a hydrophobic segment that is formed by the residues, FLGALF and FLP, respectively (Figure 2D,E and Figure 3), and appears to be required for the biological action of these AMPs [86,121,191,225]. In combination, the structural characteristics of the proline-linked N-terminal α-helix and Rana box region of B1EMa and B1EMb facilitate the ability of these AMPs to form pores in target membranes, which appears to be the fundamental mechanism underlying the biological activity of these peptides (Figure 3) [86,225]. In relation to the antimicrobial activity of B1EMa and B1EMb, precise details of these pore-forming mechanism(s) were not elucidated, but it was predicted that there would be general similarities to those used by other AMPs [86]. Essentially, the lysine residues carried by these peptides would facilitate the targeting of microbial cells via electrostatic attraction to anionic components of the target cell membrane. The amphiphilic characteristics of the α-helical structure formed by B1EMa and B1EMb would then drive the partitioning of these peptides into the membrane, such that their hydrophobic surfaces interact with the apolar core of the membrane, and their hydrophilic surfaces engage in electrostatic associations with the head group region of the membrane [270,271]. It was predicted that the curved α-helical structure of both peptides would adopt similar membrane orientations, which in the case of B1EMa is illustrated in Figure 3. In this membrane orientation, B1EMa (15–24) is partitioned parallel to the bilayer surface, which anchors and stabilizes the oblique insertion of B1EMa (1–13) such that its hydrophobic face penetrates the acyl chain region of the membrane at an angle of circa 45° (Figure 3). A similar membrane orientation has been reported to facilitate the antibacterial action of other AMPs with a proline-induced, curved α-helical structure [257,272]. For these AMPs, it was suggested that the main driver of membrane penetration for the hydrophobic termini of these AMPs was the bending potential introduced into their the α-helical structure by the presence of their proline residues [257,272].
The oblique insertion of B1EMa (1–13) into membranes (Figure 3) resembles the mode of insertion used by AMPs with a tilted structure, which is characterized by a hydrophobicity gradient along the α-helical long axis [273]. This structural arrangement causes tilted AMPs to penetrate membranes at a shallow angle of between 20° and 80°, thereby promoting a range of membrane-destabilizing effects [42,262], including pore formation [274]. For example, the antimicrobial action of maculatin 1.1, as described above in this section, is believed to involve tilted membrane penetration, driven by the presence of a hydrophobicity gradient in the segment, maculatin 1.1 (1–15) [272,273,275]. Here, the theoretical analysis of B1EMa (1–13) showed that the peptide possessed the potential to form a tilted structure (Figure 2A) with a hydrophobicity gradient that increased in the N → C direction over residues six to fourteen (Figure 2B). These structural characteristics resembled those of the tilted structure formed by maculatin 1.1 (1–15) and could promote the oblique penetration of B1EMa (1–13) into membranes (Figure 3) [272,273]. As described above in this section, flanking the putative tilted structure formed by B1EMa (1–13), at the extreme N-terminus of the peptide, is a segment formed from the strongly hydrophobic residues, FLGALF (Figure 1 and Figure 3). Earlier studies showed that a complete loss of antimicrobial activity resulted from the deletion of this cluster of residues, from both B1EMa [86] and its putative tilted region, B1EMa (1–13), in isolation [191]. These observations suggested that this strongly hydrophobic N-terminal segment would help drive the tilted insertion of B1EMa into membranes, with its loss reducing the capacity of the peptide to engage in the pore-forming mechanisms that lead to membranolytic and antimicrobial function (Figure 3). The membrane orientation of B1EMa shown in Figure 3 would also allow the charged residues on the convex, hydrophilic face of the peptide, K7, K11, K22 and K23, to associate with the lipid head group region (Figure 3), and it is well established that these residues are able to promote the membrane partitioning of AMPs via the snorkeling mechanism [117,276]. According to this mechanism, the α-carbons of lysine residues are able to reside in the membrane core region whilst their long alkyl side-chains extend, allowing the positively charged moieties of these residues to engage in electrostatic interactions with the lipid head-group region [277]. This may be particularly relevant to K7 and K11, which lie at the surface-associated end of the putative tilted α-helix formed by B1EMa (1–13) (Figure 2B and Figure 3); snorkeling by similarly located K residues has been shown to promote the oblique insertion of a number of other amphibians with tilted characteristics [273,278].
In relation to the anticancer action of B1EMa and B1EMb [119,120,121,122], as described in Section 4.1, the ability of AMPs to kill cancer cells seems to be underpinned by the fact that the CMs of these cells resemble those of microbial cells by carrying a net negative charge [117]. This structural resemblance also appears to underpin the fact that AMPs kill cancer cells using mechanisms that are generally similar to those used by these peptides to kill microbes [279]. The use of these mechanisms allows AMPs to kill cancer cells through the induction of apoptosis/necrosis via CM disruption and/or translocation to attack internal targets, such as mitochondria [118,123,280]. The action of B1EMb and derivative peptides against cancer cell lines appeared to promote the blebbing of the CM and the fragmentation of DNA [121], which is consistent with an attack on mitochondrial membranes and the induction of apoptosis in these cells [281,282]. Mechanisms underpinning the anticancer action of B1EMa and B1EMb do not seem to have been investigated [119,120,121,122], but it is interesting to note that the internal proline possessed by buforin IIb is essential for the non-membranolytic anticancer action of the peptide [283]. Buforin IIb targets gangliosides on the surface of cancer cells and then uses proline-mediated membrane translocation via the formation of transient toroidal pores to enter these cells, which leads to the induction of apoptosis via mitochondrial-dependent pathways [284,285]. The insulinotrophic activity of B1EMb appeared to be selective for pancreatic cells although the mechanism(s) underpinning this specificity were not elucidated; presumably, it would involve the targeting of some anionic component(s) of the CM possessed by these cells [225]. The peptide appeared to stimulate insulin secretion from pancreatic cells via pore formation in their CM and the induction of an increased Ca2+ influx into these cells, which was proposed to constitute a novel mode of action for stimulating insulin release by AMPs [225]. In the case of other known AMPs, stimulating the secretion of the hormone from pancreatic cells appears to involve either the depolarization of their CM with a significant increase in intracellular Ca2+ or a Ca2+ independent pathway whose precise mode of action has yet to be elucidated [235,286].
No detailed model appears to have been presented for the mechanism(s) of membrane pore formation used by either B1EMb or B1EMa, although it has been suggested that internal proline kinks have a general tendency to disrupt the formation of barrel stave pores by AMPs, but to stabilize the construction of toroidal pores by these peptides [251]. It has previously been shown that a tilted structure can help promote pore formation by AMPs [274] and here, we have shown that B1EMb (1–13) possesses the potential to form this structure (Figure 2A) with a hydrophobicity gradient that increased in the N → C direction over residues seven to fourteen (Figure 2C). As described above in this section, flanking this putative tilted structure, at the extreme N-terminus of B1EMb (1–13), is a segment formed from the strongly hydrophobic residues, FLP (Figure 1), whose absence led to a complete loss of antimicrobial, anticancer and insulinotrophic action by the peptide [121,225]. A loss of antimicrobial activity was also reported for the deletion of the N-terminal triplet of residues, FLP, from brevinin 1E from Rana esculenta (the common water frog) [287], which shows high levels of sequence and structural similarity to B1EMb [288]. In the case of the insulinotrophic action of B1EMb, this loss of biological activity also appeared to be related to a reduced capacity to form an α-helical structure, thereby inhibiting membrane pore formation and Ca2+ influx into pancreatic cells [225]. These observations suggest that this FLP segment may help drive the tilted membrane insertion of B1EMb, both directly and indirectly, by stabilizing its formation of an α-helical and tilted structure; by analogy, it is tempting to speculate that a similar function may be served by the N-terminal segment, FLGALF, of B1EMa [191]. A summary of B1EMa and B1EMb from G. emeljanovi is given below in Box 4.
Box 4. Brevinin-1 EMa and brevinin-1 EMb from G. emeljanovi.
  • G. emeljanovi, which occurs in Korea, produces brevin-in-2EMa (B2Ema), brevinin-2EMb (B2EMb) and brevinin-2EMb’ (B2EMb’), which are cationic and possess a C-terminal, heptapeptide and Rana box motif (Figure 1).
  • B2Ema, B2EMb and B2EMb’ exhibit very low levels of hemolysis and possess potent activity against Gram-positive bacteria, but weaker activity against Gram-negative bacteria and fungi (Table 1).
  • G. emeljanovi produces brevinin-1 EMa (B1Ema), brevinin-1 EMb (B1EMb) and esculentin-2 EM (E2EM), which are cationic and possess a C-terminal, heptapeptide and Rana box motif (Figure 1).
  • B1Ema and B1EMb show very low levels of hemolysis and cytotoxicity to normal human cells and exhibit potent activity towards Gram-positive bacteria, showing the potential for development to treat infections due to these microbes. These peptides show weaker activity against fungi and Gram-negative bacteria (Table 3 and Table 4).
  • B1EMb shows the ability to stimulate insulin release and shows the potential for development to treat insulin-related disorders and to aid in the design of anti-diabetic drugs.
  • Derivatives of B1Ema, including A4W- B1Ema, V8W- B1Ema, GA-K4AL and peptide B, show varying levels of hemolysis and cytotoxicity. These peptides show potent activity towards Gram-positive bacteria and weaker activity towards Gram-negative bacteria and enveloped viruses. Modified, as appropriate, to reduce toxicity to human cells, A4W- B1Ema, V8W- B1Ema, GA-K4AL and peptide B show the potential for development to treat infections due to these microbes (Table 3).
  • Derivatives of B1EMb, including B1EMb-NH2, PTP6 and PTP7/PTP12, exhibit low levels of hemolysis and potent activity towards Gram-positive bacteria, showing the potential for development to treat infections due to these microbes. These peptides show weaker activity against fungi and Gram-negative bacteria (Table 4).
  • B1Ema, B1EMb and their derivatives, including A4W- B1Ema, V8W- B1Ema, GA-K4, PTP6 and PTP7/PTP12, exhibit low cytotoxicity and varying levels of efficacy against a spectrum of cancers, indicating the potential for development to treat these disorders, including those with MDR (Table 5).
  • B1EMa and B1EMb form continuous, curved amphiphilic α-helices with a hydrophobicity gradient and this structural arrangement appears to be the primary driver of the membranolytic action that underpins the antimicrobial, antifungal, anticancer and insulinotrophic action of these peptides (Figure 3).
  • B1EMb and B1Ema possess a central proline residue that appears to help promote the stability of their amphiphilic α-helical structure and the efficacy of their membranolytic biological action (Figure 3).
  • B1EMa and B1EMb B1EMb appears to require an intact Rana box to stabilize membrane interactions involved in its antimicrobial, anticancer and insulinotrophic action, whereas this does not appear to be a requirement for the biological activity of B1Ema.

5.2. Esculentin 2EM

Currently, E2EM (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC) is the best characterized of the AMPs produced by G. emeljanovi [55,86,289,290] and earlier studies showed that the peptide was 37 residues in length and possessed a net charge of +4 (Figure 1) [83]. In the subsequent work, the complete cDNA-encoding E2EM was isolated from a library constructed with mRNAs from the skin of G. emeljanovi and, similarly to B1EMa [84], this clone was a single open reading frame that encoded the precursor polypeptide of E2EM [84]. The deduced sequence of this precursor polypeptide comprised a tripartite organization that included an N-terminal signal sequence, followed by an acidic spacer region and the mature peptide at the C-terminus by [84]. Later studies elucidated the organization of the gene encoding E2EM and suggested that the expression of the peptide was induced in response to a microbial challenge by regulatory mechanisms that were similar to those used by insects and mammals for the induction of AMPs [291]. In contrast to B1EMa and B1EMb, E2EM does not appear to have been investigated for its anticancer action and insulinotrophic activity, although these properties have been recently demonstrated for other esculentin peptides [70,235]. Major examples of these peptides include esculentin-2Cha from Lithobates chiricahuensis (the Chiricahua leopard frog) and esculentin-2 HYba1 and 2 from Hydrophylax bahuvistara (Wide-spread fungoid frog) [292,293,294]. Currently, E2EM only appears to have been studied for its antimicrobial function in the defence of G. emeljanovi.

5.2.1. The Antimicrobial Role of Esculentin 2EM and Its Derivatives

Similarly to B1EMa and B1EMb, E2EM showed weak activity towards Gram-negative bacteria, fungi and protozoa, but potent efficacy towards a panel of Gram-positive bacteria (Table 6) [83,289,295,296], which suggested the potential for the development of this peptide and its derivatives as novel agents against these latter organisms [55,86,100,289,297,298]. A number of studies have shown that the reduced or linearized form of E2EM (E2EM-lin) has a preference for Gram-positive bacteria [172,295,299,300], which is highly similar to that of E2EM in relation to its efficacy and target spectrum (Table 6) [83,289,295,296]. For example, both E2EM and E2EM-lin killed Staphylococcus epidermidis at levels that were medically relevant (Table 6) [83,299] and comparable to those reported for other AMPs [301], such as temporin-1DRa and its homologues, which are derived from Rana draytoni (the California red-legged frog) [302]. Although generally considered a beneficial commensal organism of the human skin, increasingly, S. epidermidis is being recognized as a major nosocomial pathogen in early-onset neonatal sepsis, catheter-related bloodstream infections and other biomedical device-related infections [303,304]. In addition to its antibacterial activity [295,299,305], it has also been demonstrated that E2EM and E2EM-lin possesses similar activity against C. albicans and Saccharomyces cerevisiae, which suggests that these peptides have the potential for development as novel antifungal agents (Table 6) [83,172,289]. For example, as described above in Section 1, there is an urgent need for novel drugs to combat emerging infections caused by Candida spp [131,132] and, in particular, C. auris, which is increasingly responsible for invasive diseases with unusually high mortality rates across the globe [306,307]. It has also been shown that E2EM-lin is highly thermostable in the presence of fungal membranes [172] and a similar thermostability has been demonstrated for the peptide in the presence of bacterial membranes [290]. These observations reinforce the suggestion that the peptide has the potential for development as an agent against bacterial and fungal pathogens in the food industry [290,299]. This is the most prevalent use of AMPs and thermostability is essential for these peptides, given their involvement in processing procedures at temperatures of up to 90 °C [308,309,310]. However, many AMPs do not exhibit thermostability; for example, aurein 2.5, which is from Litoria aurea (the Green and Golden Bell frog), showed a high rate of denaturation at temperatures approaching 90 °C in the presence of bacterial membranes, whilst E2EM-lin maintained its structure under similar conditions [311].
A number of studies have been undertaken with the aim of both producing E2EM and derivatives of the peptide with antibacterial activity and addressing major problems associated with the development of AMPs (Table 6) [289,296,312,313,314]. It is well established that a variety of factors such as toxicity, a lack of structural stability, proteolytic susceptibility and high manufacturing costs have slowed the progress in realizing the therapeutic potential of AMPs [16,315,316,317]. One earlier investigation assessed the feasibility of expressing E2EM as a glutathione S-transferase (GST) fusion protein in an E. coli host, which showed that the purified recombinant peptide possessed a similar target specificity and antibacterial activity to native E2EM. No toxicity to host E. coli cells was detected, which appeared to be blocked by the presence of the GST moiety, and the peptide was produced in a high yield, apparently due to the preclusion of proteolysis [318]. This heterologous expression system has since been used in a number of other studies on E2EM [295], for example, the production of recombinant hybrids formed from the latter peptide and the human AMP, LL-37, which were found to possess potent activity against both Gram-positive and Gram-negative bacteria [314]. E. coli is the most frequently used bacterial host for the expression of AMPs and gene fusion technology has been widely used for the production and/or purification of these peptides in this host, offering decreased time and production costs as well as easy scale up [136]. Other heterologous expression systems used to produce E2EM and functionally characterize its antibacterial activity include Xenopus kidney epithelial cells and Xenopus oocytes [291].
In a series of studies, C-terminally truncated E2EM was used in an attempt to produce analogues with minimal sequences that maintained the antibacterial activity of the native peptide [289,296,312]. Currently, length is a major issue in the therapeutic development of AMPs, both in terms of their commercial cost of production and other factors, such as the efficient loading of drug delivery systems [16,315,316,317]. In general, C-terminally truncated analogues of E2EM with sequences longer than E2EM (1–23) were found to show some level of antimicrobial activity, whereas those with sequences equal to, or shorter than, E2EM (1–23) showed a complete loss of this activity [289,296,312]. However, the analogue, 23D16W, (GILDTLKQFAKGVGKWLVKGAAQ-NH2), which was essentially E2EM (1–23) with a D16 → W16 substitution possessed a spectrum of selective antibacterial activity that was similar to that of E2EM (Table 6) [296,312]. This analogue represented a reduction in the size of E2EM of around two fifths and was used as a basis for more recent studies, which attempted to enhance the proteolytic and chemical stability of shortened E2EM analogues through stapling, as discussed below in Section 5.3 [313].

5.2.2. Structure/Function Relationships of Esculentin 2EM and Its Derivatives

E2EM was largely unstructured in aqueous solution, but in a membrane mimetic environment, the peptide adopted an α-helical structure, although there was some dispute as to the precise location of this molecular architecture [289,295,319]. Several studies suggested that E2EM formed a structure comprising two amphihilic α-helices, which extended from residues 2 to 10 and from residues 16 to 32 and were connected by a flexible loop spanning residues 11 to 15 [295,319]. However, an alternative α-helical structure has been suggested for E2EM [289], which appears to be consistent with other experimental data and is the currently accepted topology for the peptide [55,86]. In this topology, E2EM adopts a structure comprising a long amphiphilic α-helix formed by residues 2–23 and a shorter amphiphilic α-helix consisting of residues 25–34 (Figure 4C,D). These two α-helices are connected by a glycine residue at position 24 of E2EM, which is responsible for a flexible hinge that allows the independent movement of both helices with a bending angle that was predicted to be from 60° to 150° (Figure 5D,E) [289]. It is well established that this residue possesses high conformational flexibility due to its lack of a side chain that enables it to introduce a break or kink into the α-helical structure of AMPs [117,320]. Similarly located internal glycine residues have been reported for many other α-helical AMPs [69], including those from amphibians [69,70,71], and it is known that the presence of a glycine kink in an α-helical structure can have a variable effect on the biological activity of AMPs [321,322,323,324,325]. In response, several truncation studies have shown that the presence of this residue is essential to both the antimicrobial and hemolytic action of E2EM [289,296] and interestingly, these studies also showed that potential or observed breaks in the α-helical structure of other AMPs is often also mediated by glycine or proline residues that are situated at, or near, sequence position 24 [289].
The glycine residue at position 24 of E2EM effectively divided the peptide into two regions, formed by residues 1–23 (E2EM (1–23)) and residues 25–37 (E2EM (25–37)), respectively (Figure 4C,D and Figure 5D,E) [55,86,289,297,299,300]. E2EM (25–37) included the C-terminal heptapeptide that constitutes the Rana box motif of the peptide and similar to B1EMa and B1EMb, formed a cysteine-stabilized, loop-like fold [83]. This loop-like fold was essentially an α-helical structure that was stabilized by a disulfide bond between cysteine residues at positions 31 and 37 of the peptide (Figure 1 and [289,295,319]. The presence of E2EM (25–37) appeared to be required for the optimal antibacterial efficacy of E2EM, playing a key role in maintaining the pore-forming activity of the peptide, although not directly participating in the pore formation itself [289,295,305]. It has been recently shown that E2EM (25–37) possesses an approximately constant distribution of hydrophobicity along the α-helical long axis over residues 25 to 37, which is indicative of an orientation parallel to the surface (Figure 4B) [300] and consistent with the studies, showing that this segment serves as a membrane anchor to stabilize pore formation by E2EM (Figure 5D,E) [289,295,305]). Similar observations have been made for nicomicin-1 from the small polychaeta Nicomache minor, which shows homology and structural similarities to E2EM, including a C-terminal Rana box-type motif comprising a six-residue loop stabilized by a disulfide bridge. Nicomicin-1 showed potent activity against Gram-positive bacteria and the region, including its Rana box-type motif, appeared to stabilize the membrane interactions of its N-terminal α-helical segment, which promoted the peptide’s membranolytic, antibacterial activity [326]. A number of studies have also investigated the role of the disulfide bond possessed by E2EM (25–37) and showed that the reduction of this bond to generate E2EM-lin (25–37) led to no significant loss of α-helicity in E2EM and had no discernible effect on either the membrane anchoring or antibacterial action of the peptide [295,299,305]. E2EM-lin also showed levels of α-helicity and efficacy against fungi [172] that were very close to those obtained for E2EM [83,289], which led to the suggestion that the disulfide bond possessed by E2EM (25–37) was not essential for either the antifungal activity of E2EM [172] or its broader antimicrobial action [86,300].
E2EM (1–13) formed an N-terminal amphiphilic α-helix, which possessed the potential to form a tilted peptide with an hydrophobicity gradient that extended in the C → N direction over residues 10 to 23 (Figure 4B) [299]. Many of these residues had high α-helix-forming propensities and it was predicted that the possession of these residues would promote a variety of intramolecular interactions that not only enhanced the structural stability of the peptide’s tilted architecture, but also contributed strongly to the thermostability of E2EM-lin [290]. The formation of the tilted structure by E2EM (1–23) was also proposed to help explain the results of several other studies on the membranolytic action of the parent peptide. As described above in Section 5.2.1, in isolation, E2EM (1–23) shows no antibacterial activity, but a D16 → W16 substitution to form 23D16W endowed the peptide with activity against Gram-positive bacteria and weaker action towards the Gram-negative (Table 6) [296,312]. It was proposed that this effect was promoted by the abilities of tryptophan to both anchor the analogue to the surface regions of the membrane and to stabilize its α-helical conformation [296], abilities that are well established for this residue [117]. However, it has also been proposed that this tryptophan substitution may have helped orientate and promote the formation of tilted structure by E2EM (1–23) [290], thereby contributing to the restored antibacterial ability of the peptide [296]. Similarly, it was also proposed by these latter authors that the stapling of E2EM (5–19) derivatives into an α-helical conformation may have promoted the formation of a tilted structure [290], thereby endowing these peptides with activity against Gram-positive bacteria [313,327].
In combination, the structural characteristics of the glycine-linked E2EM (1–13) and E2EM (25–37) facilitate the ability of E2EM to form pores in membranes, which appears to be the fundamental mechanism underlying the biological activity of the peptide (Figure 5D,E) [55,86,289,297,299,300]. Mechanisms underpinning the antifungal action of E2EM do not seem to have been investigated, but E2EM-lin appeared to kill C. albicans using a mode of action that involves the permeabilization of the organism’s CM via the adoption of a lipid-interactive α-helical structure [172]. Indeed, it is generally believed that the membranolytic mechanisms used by AMPs to kill fungi are similar to those used by these peptides to kill bacteria [23,42]. For example, the adoption of a lipid-interactive, α-helical structure is a strategy used by aurein 2.5 to disrupt membranes and kill both prokaryotic [311,328] and eukaryotic microbes [329,330]. In relation to the antibacterial activity of E2EM, earlier studies suggested that the peptide may be able to form pores in bacterial membranes [331], which was confirmed by work showing that this ability underpinned the action of the peptide against a variety of bacteria [297,305]. Higher efficacy in this ability appeared to drive the strong preference of E2EM for Gram-positive bacteria over Gram-negative bacteria and related to the differing compositions and topologies of membranes from these two bacterial classes [297,305]. The direct visualization of the effects of the E2EM action on cells of the Gram-positive bacterium, Micrococcus luteus, using transmission electron microscopy (TEM) clearly showed the leakage of intracellular contents through pore-like structures in the cell wall and CM of the organism [297]. The cell wall is a relatively porous mesh that does not represent a permeability barrier to most AMPs the size of E2EM (3.74 kDa [331]) and allows these peptides to access the CM of Gram-positive bacteria with their effective concentration not significantly reduced [157,158]. Upon accessing the CM of M. luteus, the high levels of anionic lipid in this membrane appeared to drive electrostatic interactions with E2EM that promoted pore formation and membrane permeabilization by the peptide, resulting in cell death [297,305]. In general, anionic lipids form around 70% or more of the lipid in the CM of Gram-positive bacteria [157,158,332] and it was proposed that the mechanism used by E2EM to kill M. luteus may represent the peptide’s general mode of action against bacteria [297,305].
TEM was also used to visualize the effects of E2EM on cells of the Gram-negative bacterium E. coli, which revealed bleb-like structures that appeared to be the outer membrane (OM) of the organism separating and distending from the damaged CM [297]. The disruptive action of E2EM on the OM of E. coli showed some similarities to that of other AMPs that cross the barrier posed by the CM to access and permeabilize the CM of target organisms [333,334,335], such as derivatives of porcine lactoferricin (LFs) [333] and cecropin B from H. cecropia [37,336]. However, TEM revealed no apparent formation of pores in the CM of E. coli by E2EM, although the peptide was clearly able to access and disrupt these membranes, which suggested that the peptide acted sequentially on the OM and then the CM [297]. Based on these observations it was proposed that a major factor underpinning the preference of E2EM for Gram-positive bacteria over Gram-negative bacteria was the barrier function of the OM reducing the effective concentration of the peptide able to access the CM [297]. A minor contribution to this preference appeared to come from the lower levels of anionic lipids found in the CM of E. coli and other Gram-negative bacteria [297], which form around 30% or less of the lipids in these membranes [23,332,337]. This relative decrease in anionic lipids appeared to reduce the capacity of E2EM to engage in electrostatic interactions with the CM of Gram-negative bacteria as compared to those of Gram-positive bacteria [297]. The process by which E2EM crossed the OM of E. coli was not determined, but a number of possibilities would appear to exist; for example, targeting LPS of the E. coli OM and uptake by the self-promoted pathway, which appears to be used by LFs [333] and cecropin B [37,336]. Other targets of AMPs appear to be OM protein 1 and OM lipoprotein of E. coli and other Gram-negative bacteria, which promote the uptake of both these peptides and their target proteins, resulting in the permeabilization of the CM and an attack on intracellular targets [334,335].
Attempts to characterize membrane pores formed by E2EM have shown that the peptide forms transient, heterogeneous channels with different sizes [305,331] and that the process of pore construction appears to involve the assembly of between five and ten monomers [86,298,312]. The peptide was sufficiently long to span a membrane in an α-helical conformation [86], which requires a minimum of circa 22 residues [42,338], and it was observed that E2EM possessed the potential to form barrel-stave pores (Figure 5E) [86,298]. According to this model, assembled monomers of E2EM would form a transmembrane pore with an orientation that lay approximately perpendicular to the bilayer surface. In this orientation, the hydrophobic residues of these assembled monomers interact with the lipid core of the membrane, forming the outer surface of the pore, whilst their hydrophilic residues line the pore interior (Figure 5E) [16,30,39,42]. The pore formed by E2EM showed some structural similarities to that described for alamethicin [298], which is an AMP that is produced by the fungus, Trichoderma viride, and is generally taken to be the prototypic former of barrel stave pores [339,340]. However, the ability to form barrel stave pores has only been conclusively demonstrated for a relatively small number of peptides other than alamethicin [341]; notably, pardaxin from fish [342], ceratoxins from insects [342] and DCD-1L from humans [343,344]. It has also been suggested by a recent computational study based on the activity determinants of α-helical AMPs that E2EM may utilize the carpet mechanism in its antimicrobial action [345], although this mechanism can be considered as a multiple toroidal pore formation [42]. Based on these observations, it was proposed that E2EM was more likely to form toroidal-type pores (Figure 5D) [86,289], which are known to be transient in nature and heterogeneous in size, and their formation is the most common membranolytic mechanism used by AMPs to kill microbes [16,30,39,42]. Indeed, it has been suggested that, similarly to AMPs with proline kinks, the glycine kink of peptides such as E2EM have a general tendency to disrupt the formation of barrel stave pores, but to stabilize the construction of toroidal pores [251]. Using the toroidal pore model, E2EM would insert perpendicularly into the bilayer, but in contrast to the barrel stave pore formation, the peptide would remain in close association with the membrane lipid head groups (Figure 5D). This form mode of insertion causes the membrane surface to cavitate inwards and to ultimately form a pore that is lined by polar lipid head groups and hydrophilic surfaces of E2EM (Figure 5D) [16,30,39,42]. Schemes to describe the use of both the barrel stave pore formation and toroidal pore formation in the antimicrobial action of E2EM have been presented [86,289], which have been updated by more recent work on E2EM-lin (Figure 5D,E) [172,290,299,300].
Based on the redundancy of the disulfide bond possessed by E2EM (25–37) and other results, a series of studies on E2EM and E2EM-lin have shown that these peptides use the same model of pore formation in their membrane interaction and antimicrobial activity and, for clarity, when describing these models, we refer to E2EM/E2EM-lin [86,172,290,295,299,300,305]. A model based on earlier studies proposed that in the initial stages of this model, the strong positive charge of unstructured E2EM/E2EM-lin targets negatively charged components of the bacterial cell membrane, including phosphatidylglycerol (PG) and cardiolipin (CL) (Figure 5A) [86,299], which are the major, negatively charged lipids in bacterial membranes [23,42]. The localization of the peptide to the interface of these membranes then promotes the adoption of a strongly amphiphilic α-helical structure, which facilitates the partitioning of E2EM/E2EM-lin into these membranes to engage in electrostatic associations with the lipid head-group region and hydrophobic interactions with the membrane acyl chain core (Figure 5B). In the next stages of this model, E2EM/E2EM-lin (24–37) lies on the membrane surface, anchoring the parent peptide, whilst the conformational flexibility provided by G(24) allows E2EM/E2EM-lin (1–23) to realign and adopt a transmembrane orientation. The association of these transmembrane regions of E2EM/E2EM-lin then leads to pore formation, membranolytic action and the death of the target bacteria [299], which is illustrated in Figure 5D,E using two monomers of the peptide for clarity, although, as described above in this section, it is believed that higher-order oligomers of E2EM/E2EM-lin participate in this process [86,298].
The model based on earlier studies also showed that the major peptide-based structure/function relationship underpinning the membranolytic action of E2EM/E2EM-lin appeared to be the formation of a tilted structure within E2EM/E2EM-lin (1–23). The formation of this tilted structure resulted from the adoption of an α-helical structure by the peptide (Figure 5B) and appeared to drive the transmembrane realignment of this N-terminal region of E2EM/E2EM-lin to engage in pore formation (Figure 5D,E) [86,299]. However, the hydrophobicity gradient associated with E2EM/E2EM-lin (1–23) appeared to decrease with the increasing depth of the angled membrane insertion (Figure 4B), which is in contrast to B1EMa, B1EMb (Figure 2B,C) and most tilted peptides and suggested functional relevance [262]. It has previously been proposed that in addition to promoting membrane insertion, the tilted structure possessed by E2EM/E2EM-lin (1–23) could play a more direct role in pore formation by the peptide [299] and it is known that a tilted structure is able to promote protein–protein interactions [262]. Interestingly, the first ten N-terminal residues of E2EM/E2EM-lin (1–23): GILDTLKQFA (E2EM/E2EM-lin (1–10)), which were predicted not to form a tilted structure (Figure 4B), showed significant homology with the N-terminal α-helical segment of hadrurin, [346]. Hadrurin is a membranolytic toxin found in the venom of the scorpion, Hadrurus aztecus [346], and by analogy, it is tempting to speculate that the strongly hydrophobic nature of E2EM/E2EM-lin (1–10) may help drive membrane insertion by the parent peptide (Figure 5). In this respect, E2EM/E2EM-lin would show similarities to B1EMa and B1EMb, which, as described above in Section 5.1.2, possess strongly hydrophobic N-terminal segments that appear to be required for the membranolytic and biological action of these AMPs [86,121,191,225].
Consistent with previous work [297,305], the model based on earlier studies showed that the membranolytic action of E2EM/E2EM-lin also depended upon membrane-based factors, namely the lipid composition of target microbial membranes [86,299]. Essentially, the ability of E2EM/E2EM-lin to form an α-helical/tilted structure was primarily mediated by PG in the case of Gram-positive bacteria and PE in that of Gram-negative bacteria (Figure 5B) [86,299]. It is well established that PG is generally the major component in membranes of the former organisms, whilst phosphatidylethanolamine (PE) is the predominant lipid in membranes of the latter bacteria [23,42]. Moreover, PG induced higher levels of an α-helical/tilted structure in E2EM/E2EM-lin than PE, which appeared to underpin the general preference shown by the peptide for action against Gram-positive bacteria over Gram-negative bacteria [86,299]. In contrast, CL is found in the membranes of both these bacterial classes to varying degrees [23,42] and although the lipid was able to induce an α-helical/tilted structure in E2EM/E2EM-lin with an efficacy that was similar to that of PG, the corresponding levels of lysis shown by the peptide were greatly reduced [86,299]. These results contrasted strongly with AMPs that specifically target CL to induce membranolysis [347] and it was proposed that CL may reduce the membranolytic action of E2EM/E2EM-lin by restricting but not abolishing the insertion of the peptide into target microbial membranes through high-affinity electrostatic binding [86,299]. Similar mechanisms involving electrostatic binding to PE have also been shown to inhibit the membranolytic action of a number of AMPs [348], for example, maximin H5 from the toad, Bombina maxima (the Giant Fire-Bellied toad) [349]. There is also the possibility that CL promotes the antibacterial activity of E2EM-lin through recently reported non-lytic mechanisms where the interactions of AMPs with CL-rich lipid microdomains perturbs the functional organization of bacterial membranes, thereby promoting lethal effects on cell metabolism [350,351]. However, currently, the mechanisms underpinning the contribution of CL to the antimicrobial action of E2EM-lin are an open question and await further investigation [86,299]. In relation to the membranolytic antifungal action of E2EM/E2EM-lin, the role of individual lipids was not investigated; however, it was observed that this action was generally comparable in the level and mode [172] to that observed when the peptide was directed against Gram-negative bacteria [299,300]. The CM of fungi resembles those of Gram-negative bacteria in that they are predominantly formed from PE and other zwitterionic lipids [23,42] and it was speculated that the PE induction of an α-helical/tilted structure in E2EM/E2EM-lin may feature in the antifungal action of the peptide [299]. There is also the possibility that changes to the structural characteristics of lipids could contribute to the membranolytic action of E2EM/E2EM-lin: it is well established that these intrinsic properties are primary determinants in the membrane interactions of AMPs [352]. In the case of PG, which is a lamellar lipid, it was concluded that changes to the structural characteristics of the lipid were unlikely to contribute to the membranolytic action of E2EM/E2EM-lin [86,299]. In the case of CL and PE, it is well established that these lipids are able to adopt non-lamellar structures and that this ability is able to influence the membranolytic action of AMPs in multiple ways [348,353], as previously described in relation to E2EM/E2EM-lin [86,299,300]. A full discussion of this ability is beyond the scope of this review; however, as an example, it has been shown that the cone shaped molecule formed by PE is able to promote negative membrane curvature and enhance the capacity of tilted AMPs to destabilize and permeabilize membranes [354,355,356]. In contrast, the ability of the cone-shaped molecule formed by CL to promote negative membrane curvature has been shown to counter the tendency of AMPs to induce positive membrane curvature and thereby inhibit pore formation by these peptides [357,358].
Most recently, the model for pore formation by E2EM/E2EM-lin was extended when it was shown that the membranolytic action of the peptide was pH-dependent with an alkaline optimum (Figure 5) [300], contrasting to the vast majority of pH-dependent AMPs so far reported, which show acid optima [223]. A major example of these latter AMPs is maximin H5, which would appear to be the only other known instance of pH-dependent AMPs using a tilted structure to drive their membranolytic action [223,359]. Indeed, a pH-dependent membranolytic action with an alkaline optimum places E2EM/E2EM-lin in a very small group of established AMPs [172]. For example, AWRK6, which is a derivative of Dy2 from the frog, Rana dybowskii (the Dybowski’s frog,) exhibited potent antibacterial activity under alkaline conditions [360] and has therapeutic potential for treating diabetes [361] and endotoxin-induced inflammatory responses [362]. An alkaline pH appeared to enhance the membranolytic action of E2EM/E2EM-lin by reducing the positive charge carried by the peptide, which is typical of pH-dependent AMPs with alkaline optima [290], as in the case of Dy2 and AWRK6 [360]. It was proposed that these lower levels of a positive charge would effectively increase the hydrophobicity of E2EM/E2EM-lin and its capacity for membrane insertion, as well as reducing the energetically unfavorable impact of repulsive electrostatic interactions between E2EM/E2EM-lin molecules involved in pore formation [300]. However, the primary mechanism by which an alkaline pH enhanced the membranolytic action of E2EM/E2EM-lin appeared to be to increase the levels of an α-helical/tilted structure adopted by the peptide (Figure 5C) [300] and analogous results have been shown for Dy2 and AWRK6 [360]. Similar to the work described above in this section that was conducted under neutral pH conditions [86,299], the ability of E2EM/E2EM-lin to adopt an α-helical/tilted structure under alkaline pH conditions was primarily mediated by PG in the case of Gram-positive bacteria and PE in that of Gram-negative bacteria (Figure 5B) [300]. Moreover, PG induced higher levels of an α-helical/tilted structure in E2EM/E2EM-lin than PE, indicating that the general preference shown by the peptide for action against Gram-positive bacteria over Gram-negative bacteria was maintained under alkaline pH conditions [300]. There is also the possibility that pH-related changes to the structural characteristics of lipids could contribute to the membranolytic action of E2EM/E2EM-lin, as previously suggested [223]. In the case of PG and PE, it was concluded that pH-related changes to their headgroup charge and morphology were unlikely to contribute to the enhanced membranolytic action of E2EM/E2EM-lin at an alkaline pH [300]. However, in the case of CL, the charge on the lipid increases from − 1 to − 2 under these pH conditions [363,364], which led to the suggestion that this pH-dependent charge effect could enhance the initial electrostatic interaction between E2EM/E2EM-lin and bacterial membranes [300]. Indeed, it was also proposed that this pH-dependent charge effect could help to compensate for the decreased net-positive charge of the peptide at an alkaline pH, as well as contributing to the increased binding affinity of E2EM/E2EM-lin for bacterial membranes under these pH conditions [300]. The morphology of CL also changes under alkaline conditions, resulting in electrostatic repulsion effects between its headgroups that promote looser lipid packing in membranes [363,364], which led to the suggestion that this ability could promote the access of E2EM/E2EM-lin to bacterial membranes [300]. In combination, these observations clearly suggest that changes to the intrinsic properties of CL have the potential to contribute to the pH-dependent membranolytic activity of E2EM-lin against both Gram-positive and Gram-negative bacteria. A summary of E2EM from G. emeljanovi is given in below in Box 5.
Table 6. Antimicrobial and haemolytic activity of E2EM and its derivatives.
Table 6. Antimicrobial and haemolytic activity of E2EM and its derivatives.
BacteriaE2EM E2EM-lin23D16W
MIC (µM)
S. aureusND3.14.4
M. luteus0.7<3.01.0
S. mutansND3.1ND
S. epidermidis2.73.1ND
B. subtilis2.76.320.2
S. pyogenesND6.3ND
K. pneumoniae6.7>6.010.3
K. aerogenesND200.0ND
S. dysenteriae6.7ND20.6
P. putida26.8NDND
P. aeruginosa28.775.051.5
E. coli20.6>20.010.3
P. mirabilis>53.0>50.0ND
S. marcescens>53.0ND>82.0
S. typhimurium53.6ND51.5
FungiMIC (µM)
C. albicans53.660.0ND
S. cerevisiae53.660.0ND
HemolysisMaximal levels (%)
Human erythrocytes<2.0<2.0<1.0
Table 6 was compiled from [83,172,289,295,296,299,327] and shows the minimum inhibitory concentration (MIC, µM) of E2EM (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC) and derivatives, E2EM-lin (E2EM with no disulfide bond) and 23D16W (GILDTLKQFAKGVGKWLVKGAAQ-NH2), from G. emeljanovi against a series of bacteria and fungi. Also shown is the activity of these peptides against human erythrocytes as the maximal % hemolysis achieved. ND denotes ‘not determined’.
Box 5. Esculentin 2EM from G. emeljanovi.
  • G. emeljanovi produces esculentin-2 EM (E2EM), which is cationic and possesses a C-terminal, heptapeptide and Rana box motif. E2EM and its derivatives have also been produced by heterologous expression systems.
  • E2EM and derivatives, including E2EM-lin and 23D16W, exhibit very low levels of hemolysis and are generally ineffective against Gram-negative bacteria, but exhibit potent activity towards the Gram-positive, showing the potential for development to treat infections due to these microbes (Table 6).
  • E2EM and E2EM-lin are thermostable and exhibit moderate activity against fungi, indicating the potential for development as antimicrobial agents in the food industry (Table 6).
  • E2EM/E2EM-lin exert their antibacterial and antifungal action using pH-dependent, membranolytic mechanisms that are enhanced by alkaline pH conditions (Figure 5).
  • E2EM appears not to require an intact Rana box for its membranolytic action and E2EM/E2EM-lin forms two juxtaposed, amphiphilic α-helical segments that are connected by a central glycine residue which promotes the molecular flexibility required for this action (Figure 5).
  • The membranolytic action of E2EM/E2EM-lin appears to be underpinned by the formation of a tilted/α-helical structure in its N-terminal region that promotes pore formation and is primarily mediated by PG in the case of Gram-positive bacteria and PE in that of Gram-negative bacteria (Figure 4 and Figure 5).

5.3. Stapled AMPs from G. emeljanovi

As described above in Section 5.1.1, peptide B, which was essentially the N-terminal sequence of B1EMa (1–13) with residue substitutions, was shown to possess antibacterial and antiviral activity [199]. In attempts to enhance this antimicrobial activity, isoforms of peptide B were generated with α-helical structures stabilized by hydrocarbon stapling (Figure 6A) [199], which has been increasingly used to generate novel AMPs since its introduction in 2000 [313,365,366,367]. In general, the stapling of AMPs involves the incorporation of two Cα-methyl, Cα-alkenyl residues with subsequent macrocyclization, which effectively covalently links the sidechains of these residues by hydrocarbon bridges [313,366]. In the case of peptide B isoforms, this stapling was achieved using oct-4-enyl bridges between residue sidechains at positions i and i + 4 of their α-helical conformations (Figure 6B) [199], which is regarded as the most effective crosslink for this purpose [368,369]. It was found that this stapling was able to enhance the biological activity of peptide B isoforms; however, this effect was strongly dependent on the location of staples and did not always correlate with staple-mediated α-helix stabilization [199]. This variation is commonly associated with stapled, α-helical AMPs and arises primarily from the hydrophobic nature of hydrocarbon staples and its effects on the levels and distribution of hydrophobicity and amphiphilicity on the surface of these peptides [365,367].
The stapled isoforms of peptide B, peptide B-5S and peptide B-sub5S were scanned for activity against hepatitis C virus, herpes simplex virus, retrovirus and lentivirus, which revealed an antiviral efficacy that was higher than that of peptide B [199]. In particular, peptide B-5S and peptide B-sub5S showed similar levels of potent activity against retrovirus and lentivirus that were accompanied by comparable levels of cytotoxicity to the human keratinocyte cells, HFK. In the case of retrovirus, the quantification of these levels of activity using a variety of infection models (Table 7) [189] showed them to be comparable to that of many other strongly antiviral AMPs [10]. Relative to peptide B, peptide B-5S was linked at positions L5 and A9 (FLGWLFKVASKVL-NH2), whilst peptide B-sub5S (FLRDLWKVASKVL-NH2) was both conjoined between positions L5 and A9 and possessed a number of residue substitutions (in bold) (Figure 6A) [199]. These peptides have been proposed as novel, alternative antiviral treatments [370] and an urgent need for agents to combat enveloped viruses is clear given three global pandemics due to highly pathogenic coronaviruses within the last two decades [371,372]. Studies on mechanisms underpinning the antiviral activity of peptide B, peptide B-sub5S and peptide B-5S indicated that a viral entry into host human cells may be a major site of action for these peptides [199]. It is well established that AMPs can target multiple steps in the replication cycle of viruses and host cell entry, which is an early step in this cycle and a common site of action for the membranolytic action of AMPs against enveloped viruses [10,373,374,375]. For example, the de novo designed peptide, brilacidin and the vespine peptide, MP7-NH2, were reported to induce the lysis of target viral envelopes, thereby blocking membrane fusion and the entry of these viruses into host cells [376,377]. In the case of peptide B, peptide B-sub5S and peptide B-5S, the disruption of the viral envelope appeared to lead to the aggregation of viral particles and, thereby, a loss of infectivity [199], which has been reported for other antiviral AMPs [10,378,379]. However, these observations clearly suggested that the antiviral action of peptide B, peptide B-sub5S and peptide B-5S was primarily driven by membranolytic mechanisms, which was strongly supported by their lack of activity against non-enveloped viruses [199]. It is generally accepted that due to the lack of a lipid envelope, non-enveloped viruses are either resistant to membranolytic AMPs or show susceptibility to these peptides via non-lytic mechanisms [10,379]. For example, α-defensins inhibited the activity of human papillomavirus by interfering with a post-binding step before endosome escape, whilst θ-defensins inhibited this activity by preventing viral binding and uptake by host cells [380,381].
Peptide B-sub5S and peptide B-5S were strongly membrane-interactive and appeared to inactivate enveloped viruses using membranolytic mechanisms that were driven by the amphiphilicity of their α-helical structures [199], which is the mode of action most commonly used by AMPs against these viruses [10,373,378,379]. However, compared to peptide B, peptide B-5S and peptide subB-5S possessed significantly higher levels of an α-helical structure and amphiphilicity, which corresponded to their generally higher antiviral efficacy (Table 3 and Table 7) [199]. These structural enhancements appeared to drive higher levels of interaction with viral envelopes and resulted primarily from the presence of oct-4-enyl staples within the structures of peptide B-5S and peptide subB-5S. Essentially, these staples increased the stability and levels of α-helical structures possessed by these peptides, whilst the hydrophobic properties of these staples promoted changes to the distribution of hydrophobicity on the surface of these structures [199], which is consistent with studies on other stapled AMPs [367]. In the case of peptide B-sub5S, higher levels of amphiphilicity were also promoted by residue substitutions designed to generate a more even balance between the distribution of hydrophobicity and hydrophilicity on the surface of the peptide’s α-helical structure [199]. As a result of these residue substitutions, the antiviral activity of peptide B-sub5S was enhanced in relation to peptide B-5S [199]; this form of ‘fine-tuning’ is a widely used strategy for optimizing the properties and biological activity of stapled AMPs [313,365,367].
Further studies on mechanisms underpinning the antiviral activity of peptide B, peptide B-5S and peptide B-sub5S compared this activity to the size of the target viruses, which suggested that the optimal size for the action of these peptides was circa 200 nM; however, these peptides were ineffective against the vaccinia virus, whose size is around 360 nM [199]. These observations suggested that the ability of these peptides to perturb viral envelopes might be related to high membrane curvature [199] and similar results have been reported for other membranolytic, α-helical AMPs with antiviral activity [373,378,382,383,384,385]. Studies on the AH and C5A peptides have suggested that the high curvature of the viral envelope enhances the ability of α-helical AMPs to directly engage in electrostatic and hydrophobic interactions with these envelopes, which could be the case for peptide B, peptide B-5S and peptide B-sub5S [378]. Studies on the AH and C5A peptides have also suggested that the perturbation of viral envelopes with high curvature by AMPs is promoted by two generic mechanisms involving membrane solubilization and/or pore formation, which, again, could be the case for peptide B, peptide B-5S and peptide B-sub5S [373]. Studies on the influenza virus [386] have suggested that AMPs are likely to solubilize viral envelopes using carpet-type mechanisms and form pores in these envelopes using toroidal pore-type models [16,30,39,42]; however, currently, the membranolytic mechanisms used by antiviral AMPs are poorly understood. [10,373,386]. In addition to their antiviral activity, peptide B-5S and peptide B-sub5S showed varying levels of activity against a variety of Gram-positive and Gram-negative bacteria, notably peptide B-sub5S killed MRSA at levels that were circa twofold higher (Table 7) than those of peptide B (Table 3) [199]. The antibacterial mechanisms of peptide B, peptide B-5S and peptide B-sub5S were not investigated, but given their membranolytic action against viruses, it would seem likely that their antibacterial mechanisms would also involve membrane disruption, as demonstrated for other stapled, α-helical AMPs [387,388].
Table 7. Antimicrobial and cytotoxic activity of stapled B1EMa and E2EM derivatives.
Table 7. Antimicrobial and cytotoxic activity of stapled B1EMa and E2EM derivatives.
Peptide B-5SPeptide B-sub5SE2EM15
W-S1
E2EM15
W-S2
E2EM15
W-S3
BacteriaMIC (µM)
B. subtilisNDND1.83.63.6
S. aureusNDND1.83.63.6
MRSA>50.06.3NDNDND
S. epidermidisNDND>120.0>120.060.0
E. coliNDND>120.060.060.0
S. dysenteriaeNDND>120.030.030.0
S. typhimuriumNDND>120.0>120>120.0
K. pneumoniaeNDND>120.030.030.0
P. aeruginosaNDND>120.0120.0>120.0
P. mirabilisNDND>120.0>120>120.0
VirusesEC50 (µM)
Retrovirus<8.0<5.0NDNDND
CytotoxicityCC50 (µM)
Human keratinocytes>8.0>6.0 NDNDND
Table 7 was compiled from [199,327] and shows the minimum inhibitory concentration (MIC, µM) of stapled AMPs from G. emeljanovi, against a series of bacteria, including the B1EMa derivatives, peptide B-5S (FLGWLFKVASKVL-NH2) and peptide B-sub5S (FLRDLWKVASKVL-NH2), and the E2EM derivatives, E2EM15W-S1 (TLKQFAKGVGKWLVK-NH2), E2EM15W-S2 (TLKQFAKGVGKDLVK-NH2) and E2EM15W-S3 (TLKQWAKGVGKWLVK-NH2). For each of these AMPs, stapled residues are underlined. Also shown for the same peptides is the half maximal effective concentration (EC50, µM) of their antiviral activity and the half maximal cytotoxicity concentrations (CC50, µM) for their cytotoxicity to keratinocytes. ND denotes ‘not determined’.
Antibacterial activity has also been demonstrated for stapled derivatives of E2EM, namely those derived from 23D16W, which, as described above in Section 5.2.2, was E2EM (1–23) with a D16 → W16 substitution (Table 6) [296,312]. These stapled derivatives were truncated forms of 23D16W, essentially variants of E2EM (5–19) with stapling characteristics [389] similar to those described above in this section for peptide B isoforms [199]. These stapled E2EM (5–19) derivatives were linked at positions A6 and G10 and were E2EM15W-S1 (TLKQFAKGVGKWLVK-NH2), E2EM15W-S2 (TLKQFAKGVGKDLVK-NH2) and E2EM15W-S3 (TLKQWAKGVGKWLVK-NH2). Compared to 23D16W, these peptides showed enhanced activity against Gram-positive bacteria, although no activity towards Gram-negative bacteria (Table 7) [327]. In particular, E2EM15W-S1 showed levels of activity against some Gram-positive bacteria (Table 7) that were over twenty-fold higher than that shown by 23D16W (Table 6) [327]. For example, this stapled peptide showed potent activity against B. subtilis (Table 7) [327] and although generally considered to be non-pathogenic, the resistance of the organism to conventional antibiotics is increasingly being reported [390,391,392]. Currently, B. subtilis, with the potential for pathogenicity, is increasingly prevalent in hospitalized patients [393] and can cause serious conditions, such as bacteremia and meningitis in those with underlying diseases or an immunocompromised state [394,395]. The mechanisms underpinning the antibacterial activity of peptide B-5S, peptide B-sub5S and E2EM15W-S1 were not extensively investigated but appeared to show general similarities to their antiviral mechanisms. Essentially, in the stapling in peptide B-5S, peptide B-sub5S appeared to enhance the stability and amphiphilic characteristics of their α-helical structures, thereby promoting the enhanced levels of the membranolytic, antibacterial activity compared to peptide B [199,327].
Taken in combination, these studies showed that stapled derivatives of AMPs from G. emeljanovi have a number of characteristics that are desirable for their development as antimicrobial agents. For example, peptide B-5S and peptide B-sub5S target enveloped viruses on their entry into host human cells [199] and the accessibility of this site of action makes these peptides an attractive proposition for therapeutic intervention [10,373,374]. In relation to both the antiviral and antibacterial activity, stapling enhanced the resistance of these peptides to proteolysis by shielding proteolytic-susceptible sites and reducing the flexibility of their α-helical conformations required for proteolytic action [199,327]. Similar results have been reported for other stapled, α-helical AMPs [367,396] and it is well known that the general susceptibility of unstapled AMPs to enzymatic degradation has largely limited their clinical use to topical applications [61,397]. In contrast, a major disadvantage of peptide B-5S and peptide B-sub5S was their significant cytotoxicity towards human cells, which led to a therapeutic index that was too low for therapeutic application [199]. This poor selectivity is a general problem encountered in the development of antiviral AMPs [373,398] and arises predominantly from the fact that the membrane associated with enveloped viruses is derived from host eukaryotic cells [200,399]. In response, it was proposed that the selectivity of peptide B-5S and peptide B-sub5S for enveloped viruses could be achieved through the further modulation of their amphiphilic properties [199], as demonstrated for other stapled antiviral AMPs [365,366,370]. Indeed, it has been proposed that the stapled AMPs from G. emeljanovi studied here (Table 7) could serve as a sequence template for the rational design of antiviral and antibacterial AMPs [199,327,370]. This approach has been highly effective in identifying novel α-helical AMPs [313,365,367,370,373,398] and the structure/function relationships revealed in studies on stapled analogues of E2EM sequences were major drivers in its development [400,401,402,403]. Work on E2EM is generally regarded as pioneering the development of hydrocarbon-stapled AMPs and their use not only in an antimicrobial context, but also in other capacities [313,366], ranging from the treatment of cancers to serving as cell-penetrating peptides [313,365,366,367,370,373,398]. Indeed, an increasing number of stapled α-helical AMPs are being reported [404], including orthologues of E2EM [367], and, most recently, stapled β-hairpin peptides with potent antimicrobial activity have been described [51]. A summary of stapled AMPs from G. emeljanovi is given below in Box 6.
Box 6. Stapled AMPs from G. emeljanovi.
  • Covalently linking the sidechains of residues in α-helical AMPs by hydrocarbon bridges is a general strategy used to enhance their structural stability and selective, antimicrobial activity.
  • α-Helical derivatives of B1Ema, peptide B-5S and peptide B-sub5S and E2EM, E2EM15W-S1, E2EM15W-S2 and E2EM15W-S3 were produced with conformations linked by oct-4-enyl staples at residue positions i and i + 4 (Figure 6).
  • E2EM15W-S1, E2EM15W-S2 and E2EM15W-S3 are ineffective against Gram-negative bacteria, but show potent activity towards Gram-positive bacteria, indicating the potential for development to treat infections due to these microbes (Table 7).
  • Peptide B-5S and peptide B-sub5S show moderate activity towards enveloped viruses, but also show significant cytotoxicity to human cells. Modified to reduce their cytotoxicity, these peptides show the potential for development to treat viral infections (Table 7).
    There is evidence to suggest that the antibacterial action of E2EM15W-S1, E2EM15W-S2 and E2EM15W-S3 and the antiviral action of peptide B-5S and peptide B-sub5S are primarily driven by the amphiphilic properties of these AMPs and membranolytic mechanisms.

6. Discussion

Frogs of the recently established Glandirana genus are found in locations spread over East Asia and include well-established members that were discovered in the late 1800s and 1900s, namely, G. rugosa, G. emeljanovi, G. tientaiensis and G. minima. More recent additions to this genus include G. susurra, which was identified around a decade ago [82,93], and several potentially new species of frog, including G. nakamurai and G. reliquia, that were reported in 2020 [87,96,97].
In common with many species of amphibians, populations of those from the Glandirana genus are in decline, as indicated by the IUCN Red List of threatened species. According to this list, populations of G. rugosa and G. emeljanovi are cases for the least concern, whilst those of G. tientaiensis, G. minima and G. susurra are endangered. In the case of G. nakamurai and G. reliquia, these frogs are not currently present on the IUCN list of threatened species; presumably their situation in this context is unknown due to the newness of their discovery [405]. Frogs of the Glandirana genus inhabit a variety of aqueous environments, such as marshes, rivers and wetlands, and the major threats to their existence derive from invasive predation and the result of human activities, ranging from pollution to the habitat modification that drives the loss of wet environments [82,405,406,407,408]. Although strategies to minimize these declines in amphibian populations are in operation, their loss represents a major threat to global biodiversity [409,410] and the depletion of a rich and valuable source of bioactive peptides and AMPs [70,71].
There have been limited investigations into the AMPs produced by frogs of the Glandirana genus and currently, only those produced by G. rugosa, G. susurra and G. emeljanovi have been sequenced and, to varying degrees, characterized both functionally and phylogenetically. Based on sequence similarity, these peptides have been assigned to various families of AMPs, including brevinin 1, brevinin 2, esculentin 2, ranateurin 2, granuliberin and bradykinin (Figure 1). In the case of AMPs from G. susurra and G. emeljanovi, it has been shown that the prepropeptides of these peptides have a tripartite organization [84,101], which is typical of preprodermaseptins [411]. Studies on the molecular evolution of preprodermaseptin genes from ranid frogs, including those of B1EMa and E2EM, have suggested that genetic diversification, driven by positive selection, had occurred within the C-terminal, AMPs-coding region of these prepropeptides. Based on these studies, it has been proposed that this diversification of the mature AMPs may form part of a strategy to accelerate the adaptation of host frogs and their immune response to changing ecological niches and microbial predators [411,412]. On this basis, it seems likely that AMPs from G. rugosa, G. susurra and G. emeljanovi and possibly peptides from other frogs in Glandirana arose from an ancestral gene, believed to be circa 150 million years old, that diversified by several rounds of duplication and a subsequent divergence of loci [2]. Interestingly, there is evidence to suggest that the diversity of these AMPs may have, in part, resulted from random substitutions involving the operation of a mutagenic error-prone DNA polymerase [2]. Similar DNA polymerases are increasingly being identified in other eukaryotes as well as prokaryotes and it is becoming increasingly clear that errors are a natural part of DNA replication that provide organisms with the opportunity to accelerate the evolution of genes and their products, with the potential to offer a selective advantage [413,414,415]. Several characteristics of AMPs from the Glandirana genus could potentially have resulted from the function of error-prone DNA polymerases, for example, the insertion of a premature stop codon in genes encoding brevinin-1 peptides that led to the production of GSSa (Figure 1) [101]. The fact that this truncated brevinin-1 peptide has been retained by G. susurra clearly suggests that the peptide’s biological activities have endowed the frog with a survival advantage. Another characteristic of AMPs from the Glandirana genus that could have involved error-prone DNA polymerases is their generation of suites of homologous peptides with diverse and multiple overlapping biological functions (Figure 1). These observations are consistent with the view that diversifying positive selection had accelerated the adaptation of these frogs and the suites of AMPs in their innate immune systems to changing environments. Indeed, the production of multiple homologous AMPs appears to be an adaptive strategy that is common to many amphibians [70,71] and a well-studied example is the two suites of peptides that were identified in the skin and brains of frogs belonging to Bombina spp. [19]. By analogy to these studies, it would be predicted that the production of suites of structurally related, multifunctional AMPs by G. rugosa, G. susurra and G. emeljanovi serves to maximize the breadth, efficacy and speed of their immune response to microbial threat and other stresses.
The biological activities exhibited by the AMPs and their derivatives obtained from G. rugosa, G. susurra and G. emeljanovi included antibacterial, antifungal, antiviral, anticancer, antioxidative, anti-endotoxin and insulinotrophic action (Table 1, Table 2, Table 3, Table 4, Table 5, Table 6 and Table 7). Several of these biological activities were non-antimicrobial and appeared to be related to the overall protection of the host amphibian’s skin, namely the antioxidant activity of R2SSa [101] and the insulinotophic action of B1EMb [225]. In vertebrate evolution, amphibians were the first creatures to develop a keratinized tegument, which allowed them to permanently abandon the aquatic environment and become fully terrestrial [416]. Indeed, the skin of amphibians is vital to their survival, not only representing physical protection from both endogenous and exogenous insults, but also serving a wide variety of functions related to respiration, osmoregulation and thermoregulation that are essential to their existence in a terrestrial environment [114,417]. B1EMb is the only AMP from frogs in the Glandirana genus that has been shown to possess insulinotophic activity [225], although this activity has been shown for a variety of other brevinins [70,71,288]. However, a peptide, KC-19, isolated from Rana saharica (the Sahara frog) showed insulinotropic activity and circa 68% homology with B2Ra [418]. Our own search of the Swissprot database showed that KC19 also shared comparable levels of homology with E2R and E2EM and based on these observations, it may be fruitful to investigate other AMPs from G. rugosa and G. emeljanovi for the possession of insulinotrophic activity [102]. The in vivo significance of the insulinotophic action shown by B1EMb was not investigated [225] and the biological role of this action appears to be poorly understood for amphibian AMPs in general [70,235,236]. However, there is evidence to suggest that insulin may play a role in the amphibian wound-healing process, which occurs much faster in amphibians than other vertebrates and appears to be an evolutionary adaptation favorable for survival in their life-styles [114,419]. Consistent with this suggestion, animal studies have shown that both systemic and topical insulin can rapidly improve wound closure, reduce the wound healing time and improve wound remodeling through modifying inflammation, accelerating epithelialization and neovascularization [420,421]. In relation to the antioxidant activity of R2SSa, this is the only AMP from frogs in Glandirana that has been shown to possess this activity [101], although the occurrence of other AMPs with these properties within the genus is likely, given their importance in protecting the host from oxidative stress and UV irradiation [111,114]. For example, it has been suggested that UV radiation is able to breach the skin barrier of amphibians and induce immunosuppression, increasing their susceptibility to microbial invasion and exposure to chemical contaminants, ultimately resulting in the death of the host creature [422,423]. Threats to amphibian skin from oxidative stress primarily come from reactive oxygen species [111], such as superoxide anions, peroxides, hydroxyl radicals and singlet oxygen, which are able to inflict damage on most biological molecules, including proteins, DNA, RNA and lipids, again ultimately leading to cell death [424,425]. Interestingly, studies on frogs and other amphibians led to the identification of a number of peptides that possessed antioxidant activity, but no antimicrobial activity, hemolytic action or cytotoxicity, and were found to promote wound healing, although the biological significance of these observations is currently unclear [426,427].
In relation to anticancer activity, B1EMa, B1EMb and a number of their derivatives were found to be non-toxic to mammalian cells and to kill a broad range of cancer cells (Table 5); notably, B1EMb and PTP7/12 showed potent activity against MDR cancer cells, suggesting the potential for development as anticancer agents (Table 3, Table 4 and Table 5) [121]. Currently, a number of AMPs are in clinical trials for the treatment of cancers [428]; for example, LL-37 has completed a phase I trial and LTX-315 is in a phase II trial to evaluate their efficacy against melanoma and solid tumors, respectively [429,430]. In contrast to B1EMa, B1EMb and their derivatives, B2SSb, R2SSa and GSSa were found to possess both anticancer activity and cytotoxicity to healthy mammalian cells (Table 2) and, in combination, these observations belie several major, open questions in relation to AMPs with anticancer activity. Essentially, these questions are what factors differentiate peptides with selectivity for cancer cells from those that do not and what factors endow AMPs with the ability to kill cancer cells? It is well established that not all AMPs possess anticancer activity [117,431,432]. Recent responses to these questions concluded that the anticancer action of AMPs depends upon varying contributions from each of a number of peptide-based and membrane-based factors, with no single factor alone responsible for this action [117,433]. Based on these observations, it was proposed that the anticancer action of AMPs parallels the ‘‘lock and key’’ model postulated for enzyme activity, where the molecular architecture of the peptide has to support its binding and insertion into a membrane of a given composition [117]. It would seem that, given their clear homology, AMPs from the Glandirana genus may be an appropriate paradigm to test this proposal. For example, the sequence of brevinine-1SSc (B1SSc) from G. susurra differs to that of B1EMb only in the C-terminal Rana box region (Table 1), which is believed to serve an anchoring function in the membrane interactions of the latter peptide (Figure 2). Currently, B1SSc has not been characterized and investigating this peptide for anticancer activity could illuminate the potential role and contributions of both its C-terminal region and that of B1EMb to such activity.
The vast majority of AMPs from G. rugosa, G. susurra and G. emeljanovi do not appear to have been investigated for antiviral activity, which has only been reported for derivatives of B1EMa from G. emeljanovi (Table 3 and Table 7). However, these peptides possessed the potential for development as novel antiviral agents and, currently, AMPs are viewed as possible therapies for viral infections or for use as prophylactic agents to prevent viral spread [10]. In contrast, antifungal activity has been demonstrated for most major AMPs and several of their derivatives in the case of G. rugosa, G. susurra and G. emeljanovi, although, in general, this research has been limited (Table 2, Table 3, Table 4 and Table 6). However, in the case of B2SSb, R2SSa and GSSa, it has been suggested that these the AMPs have the potential for development as novel agents to combat fungal phytopathogens in crop protection [101] and, in the case of E2EM-lin, it has been proposed that the peptide could be developed as a thermostable, antifungal agent in the food industry [290]. It is also interesting to note that another major cause in the global decline of amphibian species is infections due to Batrachochytrium dendrobatidis and this fungal pathogen has been reported throughout East Asia where many strains are believed to be endemic [434,435,436]. However, infections due to B. dendrobatidis appear to have only been reported for G. rugosa and G. emeljanovi and the prevalence of these infections is low [435,437]. Based on these observations, it is tempting to speculate that the antifungal AMPs and defence systems possessed by frogs of the Glandirana genus may help protect them from infection by B. dendrobatidis.
The vast majority of research on AMPs from frogs in Glandirana has focused on their antibacterial activity, which showed that peptides from G. rugosa and G. emeljanovi, including B2Ra, B2EMa, B2EMb, B1EMa, B1EMb, E2EM and their derivatives, generally possess a strong preference for Gram-positive bacteria and exhibit potent activity against a broad spectrum of these organisms (Table 2, Table 3, Table 4 and Table 6). Based on this preference, potential uses for these peptides include serving as: oral antibacterial agents in mouthwash [198,221], antibacterial packaging components in the food industry [290,299], lead compounds in the development of hydrocarbon-‘stapled’ antibacterial and antiviral peptides [313,370] and antimycobacterial and anti-staphylococcal agents, including MRSA, in nosocomial settings [190,199] (Table 2, Table 3, Table 4 and Table 6). Investigations into mechanisms underpinning the relative resistance of Gram-negative bacteria to AMPs from G. rugosa and G. emeljanovi appear to have been limited. However, studies on PTP7/12, E2EM and E2EM-lin have suggested that these mechanisms involve contributions from the barrier function of the OM and the decreased negative charge/levels of anionic lipids found in the CM of these organisms, as compared to Gram-positive organisms [211,297,300]. Studies on E2EM-lin have also suggested that potentially, the high affinity of the peptide for CL may attenuate its activity against both the latter organisms and Gram-positive bacteria, but in general, the ability of Gram-negative bacteria to resist the action of AMPs from frogs in Glandirana is poorly understood [300]. In contrast, a number of peptides from G. susurra and G. rugosa, including B2Rb and B2SSb, showed no particular bacterial preference and exhibited broad spectrum activity against both Gram-positive and Gram-negative bacteria (Table 1 and Table 2). In the case of B2SSb, this broad-spectrum antibacterial activity was accompanied by an ability to neutralize the endotoxins of these respective bacterial classes, namely LTA and LPS [82], which is known to lead to an anti-inflammatory effect and promote the process of wound healing [169,174,438], as demonstrated for the AMPs of other amphibians [171,439]. In particular, B2SSb showed a high affinity for LPS, suggesting that the peptide may have the potential for development as an agent to combat infections due to pathogenic Gram-negative bacteria, which currently pose a dire threat to human health [440,441]. For example, the peptide showed activity against P. aeruginosa (Table 2), which is the main cause of morbidity and mortality in cystic fibrosis (CF) patients, as well as being a leading nosocomial pathogen [442,443]. Indeed, it has been shown that in CF, this organism synthesizes LPS with structures that are unique to the airway environment and are able to both promote resistance to conventional antibiotic AMPs and generate increased or unique inflammatory responses [443,444,445]. Currently, P. aeruginosa is classed as a high-priority pathogen by the WHO [65] and there is an urgent requirement for novel agents to combat infections due to this organism [443,446,447].
An investigation into the antimicrobial, anticancer and insulinotrophic activities of AMPs produced by frogs in Glandirana have primarily focused on B1EMa, B1EMb and E2EM (Table 2, Table 3, Table 4, Table 5 and Table 6) and have shown that these peptides exhibit similar functional organization: an N-terminal, a membrane-penetrating domain flanked by a C-terminal anchoring region [55,86,119,120,121,122,225]. In each case, this latter region included a Rana box motif and the integrity of this motif appeared to be necessary for the biological activity of B1EMb [86,121,225], but not B1EMa or E2EM [55,86]. A similar functional promiscuity has been reported to exist for the Rana box motifs of other ranid AMPs and, in combination, these results reinforce the view that the integrity of this motif is not a universal requirement for the biological action of these peptides [71,103]. The seven-residue structural arrangement for the Rana boxes of AMPs produced by G. rugosa, G. emeljanovi and most of those identified in G. sussura is the general case for ranid frogs. However, reflecting evolutionary divergence, G. sussura also produced AMPs with Rana box motifs that had shorter lengths and others that were devoid of this C-terminal moiety (Figure 1). Interestingly, as described above in Section 5.1.2 and Section 5.2.2, Rana box-type sequences with functional and structural similarities to the Rana box regions of B1EMa and E2EM have been identified in AMPs produced by organisms in other phyla, namely, thanatin from insects [265] and nicomicin-1 from marine worms [326]. It has been proposed that this coincidence of structure/function relationships arose through convergent evolution [448] and similar examples have been reported in other AMPs, including muscin from the house fly Musca domestica [449], oxyopinin 4a, from the lynx spider, Oxyopes takobius, [448] and kaliocin-1, which is derived from the human protein, lactoferrin [450,451].
The N-terminal, membrane-penetrating domain of B1EMa, B1EMb and E2EM showed some similarities in their functional organization, with each possessing a lipid-interactive α-helical structure that included a putative tilted segment and was terminated by a flanking cluster of strongly hydrophobic residues (Figure 3). In concert with their C-terminal anchoring regions, these N-terminal domains promoted the ability of B1EMa, B1EMb and E2EM to induce membrane lysis via pore formation and in each case, it has been suggested that these peptides may utilize a toroidal pore-type mechanism [86,251,289]. In the case of B1EMa and B1EMb, these peptides are believed to interact with membranes via the formation of a continuous, curved amphiphilic α-helix, primarily induced by a proline kink at position 14 of their sequences (Figure 3). In general, the mechanisms underpinning pore formation by B1EMa and B1EMb are poorly understood [86,119,120,121,122,225], although the differing structural characteristics of these peptides suggest that there may be differences between these mechanisms [86]. For example, compared to B1EMa (1–13), B1EMb (1–13) has much greater hydrophobicity and far lower amphiphilicity, which could clearly lead to differences in the ability of these peptides for tilted insertion and the formation of toroidal pores in membranes (Figure 2). In addition, the positive charge of both peptides results from the presence of lysine residues in their primary structure and the differing number and distribution of these residues in B1EMa and B1EMb could also lead to differences in the ability of these peptides to interact with membranes. B1EMb possesses three fewer lysine residues than B1EMa, which could reduce its relative ability to target and bind membranes, as well as decreasing the potential of the peptide to utilize the snorkeling mechanism compared to that of B1EMa (Figure 1, Figure 2 and Figure 3).
In contrast to B1EMa and B1EMb, E2EM-lin forms two discontinuous amphiphilic α-helical domains that appear to interact with the membrane such that its N-terminal α-helical domain lines the lumen of toroidal pores (Figure 5D,E). The membrane interactions of E2EM-lin were enhanced by the alkaline pH via mechanisms that appeared to involve the formation of increased levels of a tilted structure in its N-terminal domain under these pH conditions [290,299,300]. Currently, the biological significance of this pH dependence is unclear, but one possibility may be that the peptide has a role in controlling wound-associated infections; it is well established that an alkaline pH promotes the microbial colonization of wound sites [452,453]. Indeed, it has previously been suggested that E2EM-lin has the potential for development as a therapeutic agent to treat not only wounds, but also other diseases and conditions that are associated with an alkaline pH [290], such as bacterial prostatitis, psoriasis, acne, atopic dermatitis and urinary infections [454,455,456]. The pH-dependent antibacterial activity shown by E2EM-lin (Figure 5) [299,300], taken with its antifungal activity and high thermostability [172], could also enhance the previously proposed potential of the peptide for development as an antimicrobial in the food industry [290,299]. A variety of fungi and Gram-positive bacteria with tolerance to a high pH and temperatures are known to act as food-spoilage organisms [457] and a number of AMPs with alkaline optima have been investigated for their ability to serve as antimicrobials within this context [172,458,459,460,461]. Based on these observations, it can be envisaged that E2EM-lin, or its derivatives, may find application in active packaging materials that are being developed by food preservation technology to help maintain the safety and quality of food. These packaging materials are formed from polymers which incorporate AMPs and are able to prolong the shelf life of the food product by inhibiting microbial growth on the surface of the product or the headspace inside the packaging [462,463]. Given that E2EM/E2EM-lin are members of the family of esculentin 2 peptides, and therefore show homology with other amphibian AMPs, it seems possible that peptides both within and without the Glandirana genus could show a similar pH dependency [70,76]. Within the Glandirana genus, E2R and E2SSa are the only other known esculentin 2 peptides and they show a very high homology with E2EM/E2EM-lin (Figure 1). E2R and E2SSa also show a similar sequence organization to E2EM/E2EM-lin with an N-terminal domain and a C-terminal Rana box region that are separated by a glycine residue at position 24 (Figure 1), although, as described above in Section 3 and Section 4, these peptide have yet to be fully characterized [85,86,101]. However, outside of this genus, the only known pH-dependent amphibian AMP with an alkaline optimum for antibacterial activity and homology to E2EM/E2EM-lin is FL9, which is a derivative of fallaxin, from Leptodactylus fallax (the Mountain Chicken frog) [459,460]. FL9 shows the potential to form a tilted structure that possesses a homology with the N-terminal tilted region of E2EM/E2EM-lin, which led to the suggestion that the antimicrobial action of FL9 may show similarities to that of E2EM/E2EM-lin [172,290]. Indeed, studies on E2EM-lin have clearly demonstrated and emphasized the importance of considering pH when characterizing the antimicrobial action of not only this peptide, but also AMPs in general [290,299], given that the data cited in the literature to describe the action of AMPs is usually determined under neutral pH conditions [118]. It is suggested that a more holistic approach to characterizing the antimicrobial action of AMPs would be appropriate and should include determining the optimal pH for the action of these peptides as a matter of course [464,465].
In summary, this review has shown that peptides from frogs of the Glandirana genus provide a comprehensive paradigm for the antimicrobial, anticancer and other biological activities of AMPs, as well as the potential therapeutic and biotechnical uses of these peptides. This review also includes extensive tabulated data on the homology and biological activities of AMPs from frogs of the Glandirana genus, allowing comparisons between the structure/function relationships of these peptides, both those within a given species and between those of multiple species. Potentially, these data may also aid the elucidation of structure/function relationships in AMPs from newly identified frogs, both those from Glandirana, such as G. nakamurai and G. reliquia (Section 2) [87,96,97], and those from other genera, such as recently reported members of the Boophis genus in Madagascar [466]. Indeed, currently, over 7700 species of frogs are known and well over half of these have been described since the mid-1980s [80], which is around the time that the first AMPs from frogs were reported by Zasloff and colleagues [15]. It would seem that not only frogs of the Glandirana genus, but anurans in general represent an untapped source of many more novel AMPs and biologically active peptides with the potential for medical and commercial exploitation.

Author Contributions

F.H. and S.R.D., writing—original draft preparation; S.R.D., F.H. and D.A.P., writing—review and editing. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Data Availability Statement

Not Applicable.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Cederlund, A.; Gudmundsson, G.H.; Agerberth, B. Antimicrobial peptides important in innate immunity. FEBS J. 2011, 278, 3942–3951. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Phoenix, D.A.; Dennison, S.R.; Harris, F. Antimicrobial Peptides: Their History, Evolution, and Functional Promiscuity. In Antimicrobial Peptides; Wiley-VCH Verlag GmbH & Co: Weinheim, Germany; IUCN: Darmstadt, Germany, 2013; pp. 1–37. [Google Scholar]
  3. George, B.; Pooja, S.; Suchithra, T.V.; Sebastian, D. 1—Historical developments of antimicrobial peptide research. In Antimicrobial Peptides; Ajesh, K., Sreejith, K., Eds.; Academic Press: London, UK, 2023; pp. 1–16. [Google Scholar]
  4. Hirsch, J.G. Phagocytin: A bactericidal substance from polymorphonuclear leucocytes. J. Exp. Med. 1956, 103, 589–611. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Zeya, H.I.; Spitznagel, J.K. Cationic proteins of polymorphonuclear leukocyte lysosomes. II. Composition, properties, and mechanism of antibacterial action. J. Bacteriol. 1966, 91, 755–762. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Hultmark, D.; Steiner, H.; Rasmuson, T.; Boman, H.G. Insect immunity—purification and properties of 3 inducible bactericidal proteins from hemolymph of immunized pupae of Hyalophora cecropia. Eur. J. Biochem. 1980, 106, 7–16. [Google Scholar] [CrossRef] [Scilit]
  7. Steiner, H.; Hultmark, D.; Engstrom, A.; Bennich, H.; Boman, H.G. Sequence and specificity of 2 anti-bacterial proteins involved in insect immunity. Nature 1981, 292, 246–248. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Sharrock, J.; Sun, J.C. Innate immunological memory: From plants to animals. Curr. Opin. Immunol. 2020, 62, 69–78. [Google Scholar] [CrossRef] [Scilit]
  9. Lanz-Mendoza, H.; Gálvez, D.; Contreras-Garduño, J. The plasticity of immune memory in invertebrates. J. Exp. Biol. 2024, 227, jeb246158. [Google Scholar] [CrossRef] [Scilit]
  10. Urmi, U.L.; Vijay, A.K.; Kuppusamy, R.; Islam, S.; Willcox, M.D.P. A review of the antiviral activity of cationic antimicrobial peptides. Peptides 2023, 166, 171024. [Google Scholar] [CrossRef] [Scilit]
  11. Ji, S.; An, F.; Zhang, T.; Lou, M.; Guo, J.; Liu, K.; Zhu, Y.; Wu, J.; Wu, R. Antimicrobial peptides: An alternative to traditional antibiotics. Eur. J. Med. Chem. 2024, 265, 116072. [Google Scholar] [CrossRef] [Scilit]
  12. Fernández de Ullivarri, M.; Arbulu, S.; Garcia-Gutierrez, E.; Cotter, P.D. Antifungal Peptides as Therapeutic Agents. Front. Cell. Infect. Microbiol. 2020, 10, 105. [Google Scholar] [CrossRef] [Scilit]
  13. Nogrado, K.; Adisakwattana, P.; Reamtong, O. Antimicrobial peptides: On future antiprotozoal and anthelminthic applications. Acta Trop. 2022, 235, 106665. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Dennison, S.R.; Harris, F.; Phoenix, D.A. Magainins – A Model for Development of Eukaryotic Antimicrobial Peptides (AMPs). In Novel Antimicrobial Agents and Strategies; Vch Pub: Hoboken, NJ, USA, 2014; pp. 47–70. [Google Scholar]
  15. Zasloff, M. Maganins a class of antimicrobial peptides drom Xenopus skin—isolation, characterization of 2 active forms, partial cDNA sequence of a precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef] [Scilit]
  16. Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial peptides: Promising alternatives in the post feeding antibiotic era. Med. Res. Rev. 2019, 39, 831–859. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Ebenhan, T.; Gheysens, O.; Kruger, H.G.; Zeevaart, J.R.; Sathekge, M.M. Antimicrobial Peptides: Their Role as Infection-Selective Tracers for Molecular Imaging. In Biomed Research International; Hindawi Pub. Co.: New York, NY, USA, 2014. [Google Scholar] [CrossRef] [Scilit]
  18. Brogden, K.A.; Ackermann, M.; Huttner, K.M. Small, anionic, and charge-neutralizing propeptide fragments of zymogens are antimicrobial. Antimicrob. Agents Chemother. 1997, 41, 1615–1617. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Dennison, S.R.; Harris, F.; Mura, M.; Phoenix, D.A. An atlas of anionic antimicrobial peptides from amphibians. Curr. Protein Pept. Sci. 2018, 19, 823–838. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  20. Harris, F.; Dennison, S.R.; Phoenix, D.A. Anionic Antimicrobial Peptides from Eukaryotic Organisms. Curr. Protein Pept. Sci. 2009, 10, 585–606. [Google Scholar] [CrossRef] [Scilit]
  21. Prabhu, S.; Dennison, S.R.; Lea, B.; Snape, T.J.; Nicholl, I.D.; Radecka, I.; Harris, F. Anionic Antimicrobial and Anticancer Peptides from Plants. Crit. Rev. Plant Sci. 2013, 32, 303–320. [Google Scholar] [CrossRef] [Scilit]
  22. Harris, F.; Dennison, S.R.; Phoenix, D.A. Anionic Antimicrobial Peptides from Eukaryotic Organisms and their Mechanisms of Action. Curr. Chem. Biol. 2011, 5, 142–153. [Google Scholar] [CrossRef] [Scilit]
  23. Ciumac, D.; Gong, H.; Hu, X.; Lu, J.R. Membrane targeting cationic antimicrobial peptides. J. Colloid Interface Sci. 2019, 537, 163–185. [Google Scholar] [CrossRef] [Scilit]
  24. Eisenberg, D.; Weiss, R.M.; Terwilliger, T.C. The helical hydrophobic moment: A measure of the amphiphilicity of a helix. Nature 1982, 299, 371–374. [Google Scholar] [CrossRef] [Scilit]
  25. Eisenberg, D.; Weiss, R.M.; Terwillinger, T.C.; Wilcox, W. Hydrophobic moment and protein structure. Faraday Symp. Chem. Soc. 1982, 17, 109–120. [Google Scholar] [CrossRef] [Scilit]
  26. Phoenix, D.A.; Harris, F. The hydrophobic moment and its use in the classification of amphiphilic structures (review). Mol. Membr. Biol. 2002, 19, 1–10. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Phoenix, D.A.; Harris, F.; Daman, O.A.; Wallace, J. The prediction of amphiphilic alpha-helices. Curr. Protein Pept. Sci. 2002, 3, 201–221. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  28. Eisenberg, D.; Wilcox, W.; McLachlan, A.D. Hydrophobicity and amphiphilicity in protein structure. J. Cell. Biochem. 1986, 31, 11–17. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  29. Eisenberg, D.; Schwarz, E.; Komaromy, M.; Wall, R. Analysis of membrane and surface protein sequences with the hydrophobic moment plot. J. Mol. Biol. 1984, 179, 125–142. [Google Scholar] [CrossRef] [Scilit]
  30. Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [Scilit]
  31. Yeaman, M.R.; Yount, N.Y. Mechanisms of antimicrobial peptide action and resistance. Pharmacol. Rev. 2003, 55, 27–55. [Google Scholar] [CrossRef] [Scilit]
  32. Phoenix, D.A.; Dennison, S.R.; Harris, F. Graphical techniques to visualize the amphiphilic structures of antimicrobial peptides. In Antimicrobial Peptides; Wiley-VCH: Weinheim, Germany; Verlag GmbH & Co.: Weinheim, Germany; KGaA: Darmstadt, Germany, 2013; pp. 115–144. [Google Scholar]
  33. Harris, F.; Wallace, J.; Phoenix, D.A. Use of hydrophobic moment plot methodology to aid the identification of oblique orientated alpha-helices. Mol. Membr. Biol. 2000, 17, 201–207. [Google Scholar]
  34. Le, C.-F.; Fang, C.-M.; Sekaran, S.D. Intracellular Targeting Mechanisms by Antimicrobial Peptides. Antimicrob. Agents Chemother. 2017, 61, e02340-16. [Google Scholar] [CrossRef] [Scilit]
  35. Cardoso, M.H.; Meneguetti, B.T.; Costa, B.O.; Buccini, D.F.; Oshiro, K.G.N.; Preza, S.L.E.; Carvalho, C.M.E.; Migliolo, L.; Franco, O.L. Non-Lytic Antibacterial Peptides That Translocate Through Bacterial Membranes to Act on Intracellular Targets. Int. J. Mol. Sci. 2019, 20, 4877. [Google Scholar] [CrossRef] [Scilit]
  36. Bechinger, B.; Gorr, S.U. Antimicrobial Peptides: Mechanisms of Action and Resistance. J. Dent. Res. 2017, 96, 254–260. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Ebbensgaard, A.; Mordhorst, H.; Aarestrup, F.M.; Hansen, E.B. The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides. Front. Microbiol. 2018, 9, 2153. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Hancock, R.E. Peptide antibiotics. Lancet 1997, 349, 418–422. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  39. Li, J.; Koh, J.-J.; Liu, S.; Lakshminarayanan, R.; Verma, C.S.; Beuerman, R.W. Membrane Active Antimicrobial Peptides: Translating Mechanistic Insights to Design. Front. Neurosci. 2017, 11, 73. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  40. Zhang, G.; Meredith, T.C.; Kahne, D. On the essentiality of lipopolysaccharide to Gram-negative bacteria. Curr. Opin. Microbiol. 2013, 16, 779–785. [Google Scholar] [CrossRef] [Scilit]
  41. Bertani, B.; Ruiz, N. Function and Biogenesis of Lipopolysaccharides. EcoSal Plus 2018, 8, 10–128. [Google Scholar] [CrossRef] [Scilit]
  42. Phoenix, D.A.; Dennison, S.R.; Harris, F. Models for the Membrane Interactions of Antimicrobial Peptides. In Antimicrobial Peptides; Wiley-VCH: Weinheim, Germany; Verlag GmbH & Co.: Weinheim, Germany; KGaA: Darmstadt, Germany, 2013; pp. 145–180. [Google Scholar]
  43. Steinbuch, K.B.; Fridman, M. Mechanisms of resistance to membrane-disrupting antibiotics in Gram-positive and Gram-negative bacteria. MedChemComm 2016, 7, 86–102. [Google Scholar] [CrossRef] [Scilit]
  44. Abdi, M.; Mirkalantari, S.; Amirmozafari, N. Bacterial resistance to antimicrobial peptides. J. Pept. Sci. 2019, 25, e3210. [Google Scholar] [CrossRef] [Scilit]
  45. Lewies, A.; Du Plessis, L.H.; Wentzel, J.F. Antimicrobial Peptides: The Achilles’ Heel of Antibiotic Resistance? Probiotics Antimicrob. Proteins 2019, 11, 370–381. [Google Scholar] [CrossRef] [Scilit]
  46. Spohn, R.; Daruka, L.; Lázár, V.; Martins, A.; Vidovics, F.; Grézal, G.; Méhi, O.; Kintses, B.; Számel, M.; Jangir, P.K.; et al. Integrated evolutionary analysis reveals antimicrobial peptides with limited resistance. Nat. Commun. 2019, 10, 4538. [Google Scholar] [CrossRef] [Scilit]
  47. Kubicek-Sutherland, J.Z.; Lofton, H.; Vestergaard, M.; Hjort, K.; Ingmer, H.; Andersson, D.I. Antimicrobial peptide exposure selects for Staphylococcus aureus resistance to human defence peptides. J. Antimicrob. Chemother. 2017, 72, 115–127. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Andersson, D.I.; Hughes, D.; Kubicek-Sutherland, J.Z. Mechanisms and consequences of bacterial resistance to antimicrobial peptides. Drug Resist. Updates 2016, 26, 43–57. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  49. Aslam, B.; Wang, W.; Arshad, M.I.; Khurshid, M.; Muzammil, S.; Rasool, M.H.; Nisar, M.A.; Alvi, R.F.; Aslam, M.A.; Qamar, M.U.; et al. Antibiotic resistance: A rundown of a global crisis. Infect. Drug Resist. 2018, 11, 1645–1658. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Morehead, M.S.; Scarbrough, C. Emergence of Global Antibiotic Resistance. Prim. Care Clin. Off. Pract. 2018, 45, 467–484. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  51. Jacob, L.; Zasloff, M. Potential therapeutic applications of Magainins and other antimicrobial agents of animal origin. In Antimicrobial Peptides; Marsh, J., Goode, J.A., Eds.; Ciba Foundation Symposia: London, UK, 1994; Volume 186, pp. 197–216. [Google Scholar]
  52. Chopra, I. The Magainins—antimicrobial peptides with potential for tropical application. J. Antimicrob. Chemother. 1993, 32, 351–353. [Google Scholar] [CrossRef] [Scilit]
  53. Islam, K.; Hawser, S.P. MSI-78 Magainin Pharmaceuticals. IDrugs 1998, 1, 605–609. [Google Scholar]
  54. Gottler, L.M.; Ramamoorthy, A. Structure, membrane orientation, mechanism, and function of pexiganan—A highly potent antimicrobial peptide designed from magainin. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1680–1686. [Google Scholar] [CrossRef] [Scilit]
  55. Haney, E.F.; Hunter, H.N.; Matsuzaki, K.; Vogel, H.J. Solution NMR studies of amphibian antimicrobial peptides: Linking structure to function? Biochim. Biophys. Acta Biomembr. 2009, 1788, 1639–1655. [Google Scholar] [CrossRef] [Scilit]
  56. Tamba, Y.; Ariyama, H.; Levadny, V.; Yamazaki, M. Kinetic Pathway of Antimicrobial Peptide Magainin 2-Induced Pore Formation in Lipid Membranes. J. Phys. Chem. B 2010, 114, 12018–12026. [Google Scholar] [CrossRef] [Scilit]
  57. Giuliani, A.; Pirri, G.; Nicoletto, S.F. Antimicrobial peptides: An overview of a promising class of therapeutics. Open Life Sci. 2007, 2, 1–33. [Google Scholar] [CrossRef] [Scilit]
  58. Fjell, C.D.; Hiss, J.A.; Hancock, R.E.; Schneider, G. Designing antimicrobial peptides: Form follows function. Nat. Rev. Drug Discov. 2012, 11, 37–51. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Conlon, J.M.; Sonnevend, A. Clinical Applications of Amphibian Antimicrobial Peptides. Hamdan Med. J. 2011, 4, 62–72. [Google Scholar] [CrossRef] [Scilit]
  60. Lipsky, B.A.; Holroyd, K.J.; Zasloff, M. Topical versus systemic antimicrobial therapy for treating mildly infected diabetic foot ulcers: A randomized, controlled, double-blinded, multicenter trial of pexiganan cream. Clin. Infect. Dis. 2008, 47, 1537–1545. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Gan, B.H.; Gaynord, J.; Rowe, S.M.; Deingruber, T.; Spring, D.R. The multifaceted nature of antimicrobial peptides: Current synthetic chemistry approaches and future directions. Chem. Soc. Rev. 2021, 50, 7820–7880. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  62. Browne, K.; Chakraborty, S.; Chen, R.; Willcox, M.D.; Black, D.S.; Walsh, W.R.; Kumar, N. A New Era of Antibiotics: The Clinical Potential of Antimicrobial Peptides. Int. J. Mol. Sci. 2020, 21, 7047. [Google Scholar] [CrossRef] [Scilit]
  63. Divyashree, M.; Mani, M.K.; Reddy, D.; Kumavath, R.; Ghosh, P.; Azevedo, V.; Barh, D. Clinical Applications of Antimicrobial Peptides (AMPs): Where do we Stand Now? Protein Pept. Lett. 2020, 27, 120–134. [Google Scholar] [CrossRef] [Scilit]
  64. Neshani, A.; Sedighian, H.; Mirhosseini, S.A.; Ghazvini, K.; Zare, H.; Jahangiri, A. Antimicrobial peptides as a promising treatment option against Acinetobacter baumannii infections. Microb. Pathog. 2020, 146, 104238. [Google Scholar] [CrossRef] [Scilit]
  65. World Health Organization. WHO Bacterial Priority Pathogens List, 2024; World Health Organization: Geneva, Switzerland, 2024. [Google Scholar]
  66. Ayoub Moubareck, C.; Hammoudi Halat, D. Insights into Acinetobacter baumannii: A Review of Microbiological, Virulence, and Resistance Traits in a Threatening Nosocomial Pathogen. Antibiotics 2020, 9, 119. [Google Scholar] [CrossRef] [Scilit]
  67. Weinberg, S.E.; Villedieu, A.; Bagdasarian, N.; Karah, N.; Teare, L.; Elamin, W.F. Control and management of multidrug resistant Acinetobacter baumannii: A review of the evidence and proposal of novel approaches. Infect. Prev. Pract. 2020, 2, 100077. [Google Scholar] [CrossRef] [Scilit]
  68. Stanley, C.N.; Awanye, A.M.; Ogbonnaya, U.C. Acinetobacter baumannii: Epidemiology, Clinical Manifestations and Associated Infections. In Acinetobacter baumannii—The Rise of a Resistant Pathogen; Rangel, K., De-Simone, S., Eds.; IntechOpen: London, UK, 2023; pp. 1–23. [Google Scholar]
  69. Wang, G.S.; Li, X.; Wang, Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef] [Scilit]
  70. Xu, X.Q.; Lai, R. The Chemistry and Biological Activities of Peptides from Amphibian Skin Secretions. Chem. Rev. 2015, 115, 1760–1846. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  71. Patocka, J.; Nepovimova, E.; Klimova, B.; Wu, Q.; Kuca, K. Antimicrobial Peptides: Amphibian Host Defense Peptides. Curr. Med. Chem. 2019, 26, 5924–5946. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  72. Nascimento, A.C.; Fontes, W.; Sebben, A.; Castro, M.S. Antimicrobial peptides from anurans skin secretions. Protein Pept. Lett. 2003, 10, 227–238. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  73. Ladram, A.; Nicolas, P. Antimicrobial peptides from frog skin: Biodiversity and therapeutic promises. Front. Biosci. 2016, 21, 1341–1371. [Google Scholar] [CrossRef] [Scilit]
  74. Konig, E.; Bininda-Emonds, O.R.; Shaw, C. The diversity and evolution of anuran skin peptides. Peptides 2015, 63, 96–117. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Frost, D.R. Amphibian Species of the World: An Online Reference. Version 6.2 (05.12.2024). Electronic Database. American Museum of Natural History, New York, USA. 2024. Available online: https://amphibiansoftheworld.amnh.org/index.php (accessed on 5 December 2024). [CrossRef]
  76. Conlon, J.M. Reflections on a systematic nomenclature for antimicrobial peptides from the skins of frogs of the family Ranidae. Peptides 2008, 29, 1815–1819. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  77. Alexander Pyron, R.; Wiens, J.J. A large-scale phylogeny of Amphibia including over 2800 species, and a revised classification of extant frogs, salamanders, and caecilians. Mol. Phylogenetics Evol. 2011, 61, 543–583. [Google Scholar] [CrossRef] [Scilit]
  78. Frost, D.R.; Grant, T.; Faivovich, J.; Bain, R.H.; Haas, A.; Haddad, C.F.B.; De Sa, R.A.; Channing, A.; Wilkinson, M.; Donnellan, S.C.; et al. The Amphibian Tree of Life. Bull. Am. Mus. Nat. Hist. 2006, 297, 1–291. [Google Scholar] [CrossRef] [Scilit]
  79. Yuan, Z.-Y.; Zhou, W.-W.; Chen, X.; Poyarkov, J.N.A.; Chen, H.-M.; Jang-Liaw, N.-H.; Chou, W.-H.; Matzke, N.J.; Iizuka, K.; Min, M.-S.; et al. Spatiotemporal Diversification of the True Frogs (Genus Rana): A Historical Framework for a Widely Studied Group of Model Organisms. Syst. Biol. 2016, 65, 824–842. [Google Scholar] [CrossRef] [Scilit]
  80. AmphibiaWeb. Available online: https://amphibiaweb.org (accessed on 8 November 2024).
  81. Che, J.; Pang, J.; Zhao, H.; Wu, G.F.; Zhao, E.M.; Zhang, Y.P. Phylogeny of Raninae (Anura: Ranidae) inferred from mitochondrial and nuclear sequences. Mol. Phylogenetics Evol. 2007, 43, 1–13. [Google Scholar] [CrossRef] [Scilit]
  82. Sekiya, K.; Miura, I.; Ogata, M. A new frog species of the genus Rugosa from Sado Island, Japan (Anura, Ranidae). Zootaxa 2012, 3575, 49–62. [Google Scholar] [CrossRef] [Scilit]
  83. Park, J.M.; Jung, J.E.; Lee, B.J. Antimicrobial peptides from the skin of a Korean frog, Rana rugosa. Biochem. Biophys. Res. Commun. 1994, 205, 948–954. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Park, J.M.; Lee, J.Y.; Moon, H.M.; Lee, B.J. Molecular cloning of cDNAs encoding precursors of frog skin antimicrobial peptides from Rana rugosa. Biochim. Biophys. Acta Gene Struct. Expr. 1995, 1264, 23–25. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  85. Suzuki, S.; Ohe, Y.; Okubo, T.; Kakegawa, T.; Tatemoto, K. Isolation and Characterization of Novel Antimicrobial Peptides, Rugosins A, B, and C, from the Skin of the Frog, Rana rugosa. Biochem. Biophys. Res. Commun. 1995, 212, 249–254. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  86. Won, H.-S.; Kang, S.-J.; Lee, B.-J. Action mechanism and structural requirements of the antimicrobial peptides, gaegurins. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1620–1629. [Google Scholar] [CrossRef] [Scilit]
  87. Mochizuki, M.; Nakamura, Y.; Nakamura, M. Taxonomic identity of four groups of Glandirana rugosa (Anura, Ranidae) in Japan revealed by the complete mitochondrial genome sequence analysis. Mitochondrial DNA Part B 2020, 5, 3721–3722. [Google Scholar] [CrossRef] [Scilit]
  88. Kuzmin, S.; Matsui, M.; Wenge, Z.; Kaneko, Y. Glandirana emeljanovi. In IUCN Red List of Threatened Species; IUCN: Gland, Switzerland, 2004. [Google Scholar]
  89. Eo, S.H.; Lee, B.-J.; Park, C.-D.; Jung, J.-H.; Hong, N.; Lee, W.-S. Taxonomic identity of the Glandirana emeljanovi (Anura, Ranidae) in Korea revealed by the complete mitochondrial genome sequence analysis. Mitochondrial DNA Part B 2019, 4, 961–962. [Google Scholar] [CrossRef] [Scilit]
  90. Xia, Y.; Zheng, Y.C.; Miura, I.; Wong, P.B.Y.; Murphy, R.W.; Zeng, X.M. The evolution of mitochondrial genomes in modern frogs (Neobatrachia): Nonadaptive evolution of mitochondrial genome reorganization. BMC Genom. 2014, 15, 691. [Google Scholar] [CrossRef] [Scilit]
  91. Liu, W.L.; Tao, J.C.; Wang, H.; Zhao, W.G.; Liu, P. Sequencing and analysis of the complete mitochondrial genome of Rugosa emeljanovi (Anura: Ranidae). Mitochondrial DNA Part B 2017, 2, 383–384. [Google Scholar] [CrossRef] [Scilit]
  92. Yan, L.; Geng, Z.Z.; Yan, P.; Wu, X.B. The complete mitochondrial genome of Glandirana tientaiensis (Ranidae, Anura). Mitochondrial DNA Part A 2016, 27, 1154–1155. [Google Scholar] [CrossRef] [Scilit]
  93. Shimada, T. A Comparison of Iris Color Pattern between Glandirana susurra and G. rugosa (Amphibia, Anura, Ranidae). Curr. Herpetol. 2015, 34, 80–84. [Google Scholar] [CrossRef] [Scilit]
  94. Sekiya, K.; Ohtani, H.; Ogata, M.; Miura, I. Phyletic Diversity in the Frog Rana rugosa (Anura: Ranidae) with Special Reference to a Unique Morphotype Found from Sado Island, Japan. Curr. Herpetol. 2010, 29, 69–78. [Google Scholar]
  95. Jackway, R.J.; Pukala, T.L.; Donnellan, S.C.; Sherman, P.J.; Tyler, M.J.; Bowie, J.H. Skin peptide and cDNA profiling of Australian anurans: Genus and species identification and evolutionary trends. Peptides 2011, 32, 161–172. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Masahisa Nakamura; Yoriko Nakamura; Akira Oike; Koji Tojo; Tomoya Suzuki; Ito, E. A New Frog Species of the Genus Glandirana from Southeastern Kyushu, Japan (Anura Ranidae). EC Vet. Sci. 2022, 7, 11–23. [Google Scholar]
  97. Oike, A.; Mochizuki, M.; Tojo, K.; Matsuo, T.; Nakamura, Y.; Yasumasu, S.; Ito, E.; Arai, T.; Nakamura, M. A Phylogenetically Distinct Group of Glandirana rugosa Found in Kyushu, Japan. Zool. Sci. 2020, 37, 193–202. [Google Scholar] [CrossRef] [Scilit]
  98. Thomas, P.; Kumar, T.V.; Reshmy, V.; Kumar, K.S.; George, S. A mini review on the antimicrobial peptides isolated from the genus Hylarana (Amphibia: Anura) with a proposed nomenclature for amphibian skin peptides. Mol. Biol. Rep. 2012, 39, 6943–6947. [Google Scholar] [CrossRef] [Scilit]
  99. Conlon, J.M. A proposed nomenclature for antimicrobial peptides from frogs of the genus Leptodactylus. Peptides 2008, 29, 1631–1632. [Google Scholar] [CrossRef] [Scilit]
  100. Kumar, V.T.; Holthausen, D.; Jacob, J.; George, S. Host defense peptides from Asian frogs as potential clinical therapies. Antibiotics 2015, 4, 136–159. [Google Scholar] [CrossRef] [Scilit]
  101. Ogawa, D.; Suzuki, M.; Inamura, Y.; Saito, K.; Hasunuma, I.; Kobayashi, T.; Kikuyama, S.; Iwamuro, S. Antimicrobial Property and Mode of Action of the Skin Peptides of the Sado Wrinkled Frog, Glandirana susurra, against Animal and Plant Pathogens. Antibiotics 2020, 9, 457. [Google Scholar] [CrossRef] [Scilit]
  102. Consortium, T.U. UniProt: The Universal Protein Knowledgebase in 2023. Nucleic Acids Res. 2022, 51, D523–D531. [Google Scholar] [CrossRef] [Scilit]
  103. Xiao, Y.; Liu, C.; Lai, R. Antimicrobial peptides from amphibians. BioMolecular Concepts 2011, 2, 27. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. Ohtani, H.; Sekiya, K.; Ogata, M.; Miura, I. The Postzygotic Isolation of a Unique Morphotype of Frog Rana rugosa (Ranidae) Found on Sado Island, Japan. J. Herpetol. 2012, 46, 325–330. [Google Scholar] [CrossRef] [Scilit]
  105. Yasuhara, T.; Ishikawa, O.; Nakajima, T.; Araki, K.; Tachibana, S. The Studies on the Active Peptide on Smooth Muscle in the Skin of Rana rugosa, Bradykinin and Its Analogous Peptide, Ranakinin-R. Chem. Pharm. Bull. 1979, 27, 486–491. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  106. Xi, X.; Li, B.; Chen, T.; Kwok, H.F. A review on bradykinin-related peptides isolated from amphibian skin secretion. Toxins 2015, 7, 951–970. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  107. Wang, G. Bioinformatic Analysis of 1000 Amphibian Antimicrobial Peptides Uncovers Multiple Length-Dependent Correlations for Peptide Design and Prediction. Antibiotics 2020, 9, 491. [Google Scholar] [CrossRef] [Scilit]
  108. Lehrer, R.I.; Cole, A.M.; Selsted, M.E. θ-Defensins: Cyclic peptides with endless potential. J. Biol. Chem. 2012, 287, 27014–27019. [Google Scholar] [CrossRef] [Scilit]
  109. Eva Edilia, A. Functions of Antimicrobial Peptides in Vertebrates. Curr. Protein Pept. Sci. 2017, 18, 1098–1119. [Google Scholar] [CrossRef] [Scilit]
  110. Bartels, E.J.H.; Dekker, D.; Amiche, M. Dermaseptins, Multifunctional Antimicrobial Peptides: A Review of Their Pharmacology, Effectivity, Mechanism of Action, and Possible Future Directions. Front. Pharmacol. 2019, 10, 1421. [Google Scholar] [CrossRef] [Scilit]
  111. Demori, I.; Rashed, Z.E.; Corradino, V.; Catalano, A.; Rovegno, L.; Queirolo, L.; Salvidio, S.; Biggi, E.; Zanotti-Russo, M.; Canesi, L.; et al. Peptides for Skin Protection and Healing in Amphibians. Molecules 2019, 24, 347. [Google Scholar] [CrossRef] [Scilit]
  112. Conlon, J.M.; Mechkarska, M.; Lukic, M.L.; Flatt, P.R. Potential therapeutic applications of multifunctional host-defense peptides from frog skin as anti-cancer, anti-viral, immunomodulatory, and anti-diabetic agents. Peptides 2014, 57, 67–77. [Google Scholar] [CrossRef] [Scilit]
  113. Moreira, D.C.; Venancio, L.P.R.; Sabino, M.; Hermes-Lima, M. How widespread is preparation for oxidative stress in the animal kingdom? Comp. Biochem. Physiol. Part A Mol. Integr. Physiol. 2016, 200, 64–78. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  114. Varga, J.F.A.; Bui-Marinos, M.P.; Katzenback, B.A. Frog Skin Innate Immune Defences: Sensing and Surviving Pathogens. Front. Immunol. 2019, 9, 3128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  115. Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.-H.; Zhang, Y. Rich diversity and potency of skin antioxidant peptides revealed a novel molecular basis for high-altitude adaptation of amphibians. Sci. Rep. 2016, 6, 19866. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  116. Oelkrug, C.; Hartke, M.; Schubert, A. Mode of Action of Anticancer Peptides (ACPs) from Amphibian Origin. Anticancer Res. 2015, 35, 635–643. [Google Scholar] [PubMed]
  117. Harris, F.; Dennison, S.R.; Singh, J.; Phoenix, D.A. On the selectivity and efficacy of defense peptides with respect to cancer cells. Med. Res. Rev. 2013, 33, 190–234. [Google Scholar] [CrossRef] [Scilit]
  118. Felício, M.R.; Silva, O.N.; Gonçalves, S.; Santos, N.C.; Franco, O.L. Peptides with Dual Antimicrobial and Anticancer Activities. Front. Chem. 2017, 5, 5. [Google Scholar] [CrossRef] [Scilit]
  119. Kang, S.J.; Ji, H.Y.; Lee, B.J. Anticancer activity of undecapeptide analogues derived from antimicrobial peptide, brevinin-1EMa. Arch. Pharm. Res. 2012, 35, 791–799. [Google Scholar] [CrossRef] [Scilit]
  120. Won, H.S.; Seo, M.D.; Jung, S.J.; Lee, S.J.; Kang, S.J.; Son, W.S.; Kim, H.J.; Park, T.K.; Park, S.J.; Lee, B.J. Structural determinants for the membrane interaction of novel bioactive undecapeptides derived from gaegurin 5. J. Med. Chem. 2006, 49, 4886–4895. [Google Scholar] [CrossRef] [Scilit]
  121. Kim, S.; Kim, S.S.; Bang, Y.-J.; Kim, S.-J.; Lee, B.J. In vitro activities of native and designed peptide antibiotics against drug sensitive and resistant tumor cell lines. Peptides 2003, 24, 945–953. [Google Scholar] [CrossRef] [Scilit]
  122. Ghaly, G.; Tallima, H.; Dabbish, E.; Badr ElDin, N.; Abd El-Rahman, M.K.; Ibrahim, M.A.A.; Shoeib, T. Anti-Cancer Peptides: Status and Future Prospects. Molecules 2023, 28, 1148. [Google Scholar] [CrossRef] [Scilit]
  123. Kordi, M.; Borzouyi, Z.; Chitsaz, S.; Asmaei, M.h.; Salami, R.; Tabarzad, M. Antimicrobial peptides with anticancer activity: Today status, trends and their computational design. Arch. Biochem. Biophys. 2023, 733, 109484. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  124. Gao, Y.; Fang, H.; Fang, L.; Liu, D.; Liu, J.; Su, M.; Fang, Z.; Ren, W.; Jiao, H. The Modification and Design of Antimicrobial Peptide. Curr. Pharm. Des. 2018, 24, 904–910. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  125. Torres, M.D.T.; Sothiselvam, S.; Lu, T.K.; de la Fuente-Nunez, C. Peptide Design Principles for Antimicrobial Applications. J. Mol. Biol. 2019, 431, 3547–3567. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  126. Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  127. Li, W.; Separovic, F.; O’Brien-Simpson, N.M.; Wade, J.D. Chemically modified and conjugated antimicrobial peptides against superbugs. Chem. Soc. Rev. 2021, 50, 4932–4973. [Google Scholar] [CrossRef] [Scilit]
  128. Bobone, S.; Stella, L. Selectivity of Antimicrobial Peptides: A Complex Interplay of Multiple Equilibria. In Antimicrobial Peptides: Basics for Clinical Application; Matsuzaki, K., Ed.; Springer Singapore: Singapore, 2019; pp. 175–214. [Google Scholar]
  129. Liang, Y.; Zhang, X.; Yuan, Y.; Bao, Y.; Xiong, M. Role and modulation of the secondary structure of antimicrobial peptides to improve selectivity. Biomater. Sci. 2020, 8, 6858–6866. [Google Scholar] [CrossRef] [Scilit]
  130. Matsuzaki, K. Control of cell selectivity of antimicrobial peptides. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1687–1692. [Google Scholar] [CrossRef] [Scilit]
  131. Kabir, M.A.; Hussain, M.A.; Ahmad, Z. Candida albicans: A Model Organism for Studying Fungal Pathogens. ISRN Microbiol. 2012, 2012, 538694. [Google Scholar] [CrossRef] [Scilit]
  132. Dadar, M.; Tiwari, R.; Karthik, K.; Chakraborty, S.; Shahali, Y.; Dhama, K. Candida albicans—Biology, molecular characterization, pathogenicity, and advances in diagnosis and control—An update. Microb. Pathog. 2018, 117, 128–138. [Google Scholar] [CrossRef] [Scilit]
  133. Ksiezopolska, E.; Gabaldón, T. Evolutionary Emergence of Drug Resistance in Candida Opportunistic Pathogens. Genes 2018, 9, 461. [Google Scholar] [CrossRef] [Scilit]
  134. Arendrup, M.C.; Patterson, T.F. Multidrug-Resistant Candida: Epidemiology, Molecular Mechanisms, and Treatment. J. Infect. Dis. 2017, 216, S445–S451. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  135. Breen, S.; Solomon, P.S.; Bedon, F.; Vincent, D. Surveying the potential of secreted antimicrobial peptides to enhance plant disease resistance. Front. Plant Sci. 2015, 6, 900. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  136. Sinha, R.; Shukla, P. Antimicrobial Peptides: Recent Insights on Biotechnological Interventions and Future Perspectives. Protein Pept. Lett. 2019, 26, 79–87. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  137. Sharma, P.; Bora, L.C.; Puzari, K.; Baruah, A.M.; Baruah, R.; Talukdar, K.; Kataky, L.; Phukan, A. Review on Bacterial Blight of Rice Caused by Xanthomonas oryzae pv. oryzae: Different Management Approaches and Role of Pseudomonas fluorescens As A Potential Biocontrol Agent. Int. J. Curr. Microbiol. Appl. Sci. 2017, 6, 982–1005. [Google Scholar]
  138. Eichenlaub, R.; Gartemann, K.H. The Clavibacter michiganensis subspecies: Molecular investigation of gram-positive bacterial plant pathogens. Annu. Rev. Phytopathol. 2011, 49, 445–464. [Google Scholar] [CrossRef] [Scilit]
  139. Law, J.W.-F.; Ser, H.-L.; Khan, T.M.; Chuah, L.-H.; Pusparajah, P.; Chan, K.-G.; Goh, B.-H.; Lee, L.-H. The Potential of Streptomyces as Biocontrol Agents against the Rice Blast Fungus, Magnaporthe oryzae (Pyricularia oryzae). Front. Microbiol. 2017, 8, 3. [Google Scholar] [CrossRef] [Scilit]
  140. Company, N.; Nadal, A.; La Paz, J.-L.; Martínez, S.; Rasche, S.; Schillberg, S.; Montesinos, E.; Pla, M. The production of recombinant cationic α-helical antimicrobial peptides in plant cells induces the formation of protein bodies derived from the endoplasmic reticulum. Plant Biotechnol. J. 2014, 12, 81–92. [Google Scholar] [CrossRef] [Scilit]
  141. Vilà, S.; Badosa, E.; Montesinos, E.; Planas, M.; Feliu, L. Synthetic Cyclolipopeptides Selective against Microbial, Plant and Animal Cell Targets by Incorporation of D-Amino Acids or Histidine. PLoS ONE 2016, 11, e0151639. [Google Scholar] [CrossRef] [Scilit]
  142. Badosa, E.; Moiset, G.; Montesinos, L.; Talleda, M.; Bardají, E.; Feliu, L.; Planas, M.; Montesinos, E. Derivatives of the antimicrobial peptide BP100 for expression in plant systems. PLoS ONE 2013, 8, e85515. [Google Scholar] [CrossRef] [Scilit]
  143. Mishra, R.K.; Bohra, A.; Kamaal, N.; Kumar, K.; Gandhi, K.; Gk, S.; Saabale, P.R.; Sj, S.N.; Sarma, B.K.; Kumar, D.; et al. Utilization of biopesticides as sustainable solutions for management of pests in legume crops: Achievements and prospects. Egypt. J. Biol. Pest Control 2018, 28, 3. [Google Scholar] [CrossRef] [Scilit]
  144. Lukmanul Hakim, S.; Usman Sumo Friend, T. Biopesticides as Promising Alternatives to Chemical Pesticides: A Review of Their Current and Future Status. Online J. Biol. Sci. 2020, 20, 66–76. [Google Scholar] [CrossRef] [Scilit]
  145. Zeitler, B.; Herrera Diaz, A.; Dangel, A.; Thellmann, M.; Meyer, H.; Sattler, M.; Lindermayr, C. De-novo design of antimicrobial peptides for plant protection. PLoS ONE 2013, 8, e71687. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  146. Leite, M.L.; Sampaio, K.B.; Costa, F.F.; Franco, O.L.; Dias, S.C.; Cunha, N.B. Molecular farming of antimicrobial peptides: Available platforms and strategies for improving protein biosynthesis using modified virus vectors. An. Acad. Bras. Ciências 2019, 91, e20180124. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  147. Sundin, G.W.; Wang, N. Antibiotic Resistance in Plant-Pathogenic Bacteria. Annu. Rev. Phytopathol. 2018, 56, 161–180. [Google Scholar] [CrossRef] [Scilit]
  148. Raman, M.N.; Easwaran, M.; Kaul, R.; Bharti, J.; Motelb, K.F.A.; Kaul, T. Antimicrobial Resistance with Special Emphasis on Pathogens in Agriculture. In Antimicrobial Resistance: A One Health Perspective; Intechopen: Rijeka, Croatia, 2020. [Google Scholar] [CrossRef] [Scilit]
  149. Zou, T.-B.; He, T.-P.; Li, H.-B.; Tang, H.-W.; Xia, E.-Q. The Structure-Activity Relationship of the Antioxidant Peptides from Natural Proteins. Molecules 2016, 21, 72. [Google Scholar] [CrossRef] [Scilit]
  150. Xu, N.; Chen, G.; Liu, H. Antioxidative Categorization of Twenty Amino Acids Based on Experimental Evaluation. Molecules 2017, 22, 2066. [Google Scholar] [CrossRef] [Scilit]
  151. Karami, Z.; Akbari-Adergani, B. Bioactive food derived peptides: A review on correlation between structure of bioactive peptides and their functional properties. J. Food Sci. Technol. 2019, 56, 535–547. [Google Scholar] [CrossRef] [Scilit]
  152. Li, Y.; Yu, J. Research progress in structure-activity relationship of bioactive peptides. J. Med. Food 2015, 18, 147–156. [Google Scholar] [CrossRef] [Scilit]
  153. Yang, H.; Wang, X.; Liu, X.; Wu, J.; Liu, C.; Gong, W.; Zhao, Z.; Hong, J.; Lin, D.; Wang, Y.; et al. Antioxidant peptidomics reveals novel skin antioxidant system. Mol. Cell. Proteom. 2009, 8, 571–583. [Google Scholar] [CrossRef] [Scilit]
  154. Guo, C.; Hu, Y.; Li, J.; Liu, Y.; Li, S.; Yan, K.; Wang, X.; Liu, J.; Wang, H. Identification of multiple peptides with antioxidant and antimicrobial activities from skin and its secretions of Hylarana taipehensis, Amolops lifanensis, and Amolops granulosus. Biochimie 2014, 105, 192–201. [Google Scholar] [CrossRef] [Scilit]
  155. Plácido, A.; Bueno, J.; Barbosa, E.A.; Moreira, D.C.; Dias, J.d.N.; Cabral, W.F.; Albuquerque, P.; Bessa, L.J.; Freitas, J.; Kuckelhaus, S.A.S.; et al. The Antioxidant Peptide Salamandrin-I: First Bioactive Peptide Identified from Skin Secretion of Salamandra Genus (Salamandra salamandra). Biomolecules 2020, 10, 512. [Google Scholar] [CrossRef] [Scilit]
  156. Meng, P.; Yang, S.; Shen, C.; Jiang, K.; Rong, M.; Lai, R. The first salamander defensin antimicrobial peptide. PLoS ONE 2013, 8, e83044. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  157. Malanovic, N.; Lohner, K. Gram-positive bacterial cell envelopes: The impact on the activity of antimicrobial peptides. Biochim. Biophys. Acta Biomembr. 2016, 1858, 936–946. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  158. Malanovic, N.; Lohner, K. Antimicrobial Peptides Targeting Gram-Positive Bacteria. Pharmaceuticals 2016, 9, 59. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  159. Percy, M.G.; Gründling, A. Lipoteichoic Acid Synthesis and Function in Gram-Positive Bacteria. Annu. Rev. Microbiol. 2014, 68, 81–100. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  160. Schneewind, O.; Missiakas, D. Lipoteichoic Acid Synthesis and Function in Gram-Positive Bacteria. In Biogenesis of Fatty Acids, Lipids and Membranes; Geiger, O., Ed.; Springer International Publishing: Cham, German, 2017; pp. 1–18. [Google Scholar]
  161. Dickson, K.; Lehmann, C. Inflammatory Response to Different Toxins in Experimental Sepsis Models. Int. J. Mol. Sci. 2019, 20, 4341. [Google Scholar] [CrossRef] [Scilit]
  162. de Tejada, G.M.; Heinbockel, L.; Ferrer-Espada, R.; Heine, H.; Alexander, C.; Bárcena-Varela, S.; Goldmann, T.; Correa, W.; Wiesmüller, K.-H.; Gisch, N.; et al. Lipoproteins/peptides are sepsis-inducing toxins from bacteria that can be neutralized by synthetic anti-endotoxin peptides. Sci. Rep. 2015, 5, 14292. [Google Scholar] [CrossRef] [Scilit]
  163. Zähringer, U.; Lindner, B.; Inamura, S.; Heine, H.; Alexander, C. TLR2—promiscuous or specific? A critical re-evaluation of a receptor expressing apparent broad specificity. Immunobiology 2008, 213, 205–224. [Google Scholar] [CrossRef] [Scilit]
  164. Rockel, C.; Hartung, T. Systematic review of membrane components of gram-positive bacteria responsible as pyrogens for inducing human monocyte/macrophage cytokine release. Front. Pharmacol. 2012, 3, 56. [Google Scholar] [CrossRef] [Scilit]
  165. Mallat, J.; Leone, S.; Cascella, M.; Fiore, M. Should endotoxin be a research priority in Gram-negative sepsis and septic shock? Expert Rev. Clin. Pharmacol. 2019, 12, 697–699. [Google Scholar] [CrossRef] [Scilit]
  166. Virzì, G.M.; Clementi, A.; Brocca, A.; Ronco, C. Endotoxin Effects on Cardiac and Renal Functions and Cardiorenal Syndromes. Blood Purif. 2017, 44, 314–326. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  167. Pantic, J.M.; Jovanovic, I.P.; Radosavljevic, G.D.; Arsenijevic, N.N.; Conlon, J.M.; Lukic, M.L. The Potential of Frog Skin-Derived Peptides for Development into Therapeutically-Valuable Immunomodulatory Agents. Molecules 2017, 22, 2071. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  168. Pantic, J.M.; Mechkarska, M.; Lukic, M.L.; Conlon, J.M. Effects of tigerinin peptides on cytokine production by mouse peritoneal macrophages and spleen cells and by human peripheral blood mononuclear cells. Biochimie 2014, 101, 83–92. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  169. Brandenburg, K.; Heinbockel, L.; Correa, W.; Lohner, K. Peptides with dual mode of action: Killing bacteria and preventing endotoxin-induced sepsis. Biochim. Biophys. Acta Biomembr. 2016, 1858, 971–979. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  170. Dong, W.; Mao, X.; Guan, Y.; Kang, Y.; Shang, D. Antimicrobial and anti-inflammatory activities of three chensinin-1 peptides containing mutation of glycine and histidine residues. Sci. Rep. 2017, 7, 40228. [Google Scholar] [CrossRef] [Scilit]
  171. Mu, L.; Zhou, L.; Yang, J.; Zhuang, L.; Tang, J.; Liu, T.; Wu, J.; Yang, H. The first identified cathelicidin from tree frogs possesses anti-inflammatory and partial LPS neutralization activities. Amino Acids 2017, 49, 1571–1585. [Google Scholar] [CrossRef] [Scilit]
  172. Phoenix, D.A.; Harris, F.; Dennison, S.R. Antimicrobial peptides with pH dependent activity and alkaline optima: Their origins, mechanisms of action and potential applications. Curr. Protein Pept. Biol. 2021, 22, 775–799. [Google Scholar] [CrossRef] [Scilit]
  173. Sun, Y.; Shang, D. Inhibitory Effects of Antimicrobial Peptides on Lipopolysaccharide-Induced Inflammation. Mediat. Inflamm. 2015, 2015, 167572. [Google Scholar] [CrossRef] [Scilit]
  174. Schuerholz, T.; Brandenburg, K.; Marx, G. Antimicrobial peptides and their potential application in inflammation and sepsis. Crit. Care 2012, 16, 207. [Google Scholar] [CrossRef] [Scilit]
  175. Martin, L.; van Meegern, A.; Doemming, S.; Schuerholz, T. Antimicrobial Peptides in Human Sepsis. Front. Immunol. 2015, 6, 404. [Google Scholar] [CrossRef] [Scilit]
  176. Lepper, P.; Held, T.; Schneider, E.; Bölke, E.; Gerlach, H.; Trautmann, M. Clinical implications of antibiotic-induced endotoxin release in septic shock. Intensive Care Med. 2002, 28, 824–833. [Google Scholar] [CrossRef] [Scilit]
  177. Holzheimer, R.G. Antibiotic induced endotoxin release and clinical sepsis: A review. J. Chemother. 2001, 13, 159–172. [Google Scholar] [CrossRef] [Scilit]
  178. van Groenendael, R.; Beunders, R.; Kox, M.; van Eijk, L.T.; Pickkers, P. The Human Chorionic Gonadotropin Derivate EA-230 Modulates the Immune Response and Exerts Renal Protective Properties: Therapeutic Potential in Humans. Semin. Nephrol. 2019, 39, 496–504. [Google Scholar] [CrossRef] [Scilit]
  179. Koo, H.B.; Seo, J. Antimicrobial peptides under clinical investigation. Pept. Sci. 2019, 111, e24122. [Google Scholar] [CrossRef] [Scilit]
  180. Gyawali, B.; Ramakrishna, K.; Dhamoon, A.S. Sepsis: The evolution in definition, pathophysiology, and management. SAGE Open Med. 2019, 7, 2050312119835043. [Google Scholar] [CrossRef] [Scilit]
  181. Rudd, K.E.; Johnson, S.C.; Agesa, K.M.; Shackelford, K.A.; Tsoi, D.; Kievlan, D.R.; Colombara, D.V.; Ikuta, K.S.; Kissoon, N.; Finfer, S.; et al. Global, regional, and national sepsis incidence and mortality, 1990–2017: Analysis for the Global Burden of Disease Study. Lancet 2020, 395, 200–211. [Google Scholar] [CrossRef] [Scilit]
  182. Moreno, M.; Giralt, E. Three valuable peptides from bee and wasp venoms for therapeutic and biotechnological use: Melittin, apamin and mastoparan. Toxins 2015, 7, 1126–1150. [Google Scholar] [CrossRef] [Scilit]
  183. Touchard, A.; Aili, S.R.; Fox, E.G.P.; Escoubas, P.; Orivel, J.; Nicholson, G.M.; Dejean, A. The Biochemical Toxin Arsenal from Ant Venoms. Toxins 2016, 8, 30. [Google Scholar] [CrossRef] [Scilit]
  184. Schmidt, J.O. Clinical consequences of toxic envenomations by Hymenoptera. Toxicon 2018, 150, 96–104. [Google Scholar] [CrossRef] [Scilit]
  185. Schmidt, J.O. Evolutionary responses of solitary and social Hymenoptera to predation by primates and overwhelmingly powerful vertebrate predators. J. Hum. Evol. 2014, 71, 12–19. [Google Scholar] [CrossRef] [Scilit]
  186. Raaymakers, C.; Verbrugghe, E.; Hernot, S.; Hellebuyck, T.; Betti, C.; Peleman, C.; Claeys, M.; Bert, W.; Caveliers, V.; Ballet, S.; et al. Antimicrobial peptides in frog poisons constitute a molecular toxin delivery system against predators. Nat. Commun. 2017, 8, 1495. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  187. Raaymakers, C.; Verbrugghe, E.; Stijlemans, B.; Martel, A.; Pasmans, F.; Roelants, K. The anuran skin peptide bradykinin mediates its own absorption across epithelial barriers of the digestive tract. Peptides 2018, 103, 84–89. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  188. Bowie, J.H.; Tyler, M.J. CHAPTER 43—Host Defense Peptides from Australian Amphibians: Caerulein and Other Neuropeptides. In Handbook of Biologically Active Peptides; Kastin, A.J., Ed.; Academic Press: Burlington, NJ, USA, 2006; pp. 283–289. [Google Scholar]
  189. Park, S.-H.; Kim, H.-E.; Kim, C.-M.; Yun, H.-J.; Choi, E.-C.; Lee, B.-J. Role of proline, cysteine and a disulphide bridge in the structure and activity of the anti-microbial peptide gaegurin 5. Biochem. J. 2002, 368, 171–182. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  190. Lee, K.H.; Hong, S.Y.; Oh, J.E.; Lee, B.J.; Choi, B.S. Antimicrobial activity and conformation of gaegurin-6 amide and its analogs. Peptides 1998, 19, 1653–1658. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  191. Won, H.S.; Jung, S.J.; Kim, H.E.; Seo, M.D.; Lee, B.J. Systematic peptide engineering and structural characterization to search for the shortest antimicrobial peptide analogue of gaegurin 5. J. Biol. Chem. 2004, 279, 14784–14791. [Google Scholar] [CrossRef] [Scilit]
  192. Abbas, M.; Paul, M.; Huttner, A. New and improved? A review of novel antibiotics for Gram-positive bacteria. Clin. Microbiol. Infect. 2017, 23, 697–703. [Google Scholar] [CrossRef] [Scilit]
  193. Woodford, N.; Livermore, D.M. Infections caused by Gram-positive bacteria: A review of the global challenge. J. Infect. 2009, 59, S4–S16. [Google Scholar] [CrossRef] [Scilit]
  194. Arthur, P.K.; Amarh, V.; Cramer, P.; Arkaifie, G.B.; Blessie, E.J.S.; Fuseini, M.S.; Carilo, I.; Yeboah, R.; Asare, L.; Robertson, B.D. Characterization of Two New Multidrug-Resistant Strains of Mycobacterium smegmatis: Tools for Routine In Vitro Screening of Novel Anti-Mycobacterial Agents. Antibiotics 2019, 8, 4. [Google Scholar] [CrossRef] [Scilit]
  195. Shiloh, M.U.; Champion, P.A.D. To catch a killer. What can mycobacterial models teach us about Mycobacterium tuberculosis pathogenesis? Curr. Opin. Microbiol. 2010, 13, 86–92. [Google Scholar] [CrossRef] [Scilit]
  196. Furin, J.; Cox, H.; Pai, M. Tuberculosis. Lancet 2019, 393, 1642–1656. [Google Scholar] [CrossRef] [Scilit]
  197. Won, H.-S.; Kang, S.-J.; Choi, W.-S.; Lee, B.-J. Activity optimization of an undecapeptide analogue derived from a frog-skin antimicrobial peptide. Mol. Cells 2011, 31, 49–54. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  198. Kim, S.S.; Kim, S.; Kim, E.; Hyun, B.; Kim, K.K.; Lee, B.J. Synergistic inhibitory effect of cationic peptides and antimicrobial agents on the growth of oral streptococci. Caries Res. 2003, 37, 425–430. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  199. Kim, M.I.; Pham, T.K.; Kim, D.; Park, M.; Kim, B.-O.; Cho, Y.-H.; Kim, Y.-W.; Lee, C. Identification of brevinin-1EMa-derived stapled peptides as broad-spectrum virus entry blockers. Virology 2021, 561, 6–16. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  200. Zeng, L.; Li, J.; Lv, M.; Li, Z.; Yao, L.; Gao, J.; Wu, Q.; Wang, Z.; Yang, X.; Tang, G.; et al. Environmental Stability and Transmissibility of Enveloped Viruses at Varied Animate and Inanimate Interfaces. Environ. Health 2023, 1, 15–31. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  201. Pletan, M.L.; Tsai, B. Non-enveloped virus membrane penetration: New advances leading to new insights. PLoS Pathog. 2022, 18, e1010948. [Google Scholar] [CrossRef] [Scilit]
  202. Bamford, D.H.; Zuckerman, M. Encyclopedia of Virology; Elsevier Science: Amsterdam, The Netherlands, 2021. [Google Scholar]
  203. Timmons, P.B.; Hewage, C.M. HAPPENN is a novel tool for hemolytic activity prediction for therapeutic peptides which employs neural networks. Sci. Rep. 2020, 10, 10869. [Google Scholar] [CrossRef] [Scilit]
  204. Rubinchik, E.; Dugourd, D. Omiganan Pentahydrochloride: A Novel, Broad-Spectrum Antimicrobial Peptide for Topical Use. In Peptide Drug Discovery and Development; Castanho, M., Santos, N., Eds.; Wiley-VCH: Weinheim, Germany, 2011. [Google Scholar]
  205. Vakharia, P.P.; Silverberg, J.I. New therapies for atopic dermatitis: Additional treatment classes. J. Am. Acad. Dermatol. 2018, 78, S76–S83. [Google Scholar] [CrossRef] [Scilit]
  206. Ng, S.M.S.; Teo, S.W.; Yong, Y.E.; Ng, F.M.; Lau, Q.Y.; Jureen, R.; Hill, J.; Chia, C.S.B. Preliminary investigations into developing all-D Omiganan for treating Mupirocin-resistant MRSA skin infections. Chem. Biol. Drug Des. 2017, 90, 1155–1160. [Google Scholar] [CrossRef] [Scilit]
  207. Dennison, S.R.; Harris, F.; Bhatt, T.; Singh, J.; Phoenix, D.A. The effect of C-terminal amidation on the efficacy and selectivity of antimicrobial and anticancer peptides. Mol. Cell. Biochem. 2009, 332, 43–50. [Google Scholar] [CrossRef] [Scilit]
  208. Turner, N.A.; Sharma-Kuinkel, B.K.; Maskarinec, S.A.; Eichenberger, E.M.; Shah, P.P.; Carugati, M.; Holland, T.L.; Fowler, V.G., Jr. Methicillin-resistant Staphylococcus aureus: An overview of basic and clinical research. Nat. Rev. Microbiol. 2019, 17, 203–218. [Google Scholar] [CrossRef] [Scilit]
  209. Lee, A.S.; de Lencastre, H.; Garau, J.; Kluytmans, J.; Malhotra-Kumar, S.; Peschel, A.; Harbarth, S. Methicillin-resistant Staphylococcus aureus. Nat. Rev. Dis. Primers 2018, 4, 18033. [Google Scholar] [CrossRef] [Scilit]
  210. Shoaib, M.; Aqib, A.I.; Muzammil, I.; Majeed, N.; Bhutta, Z.A.; Kulyar, M.F.; Fatima, M.; Zaheer, C.-N.F.; Muneer, A.; Murtaza, M.; et al. MRSA compendium of epidemiology, transmission, pathophysiology, treatment, and prevention within one health framework. Front. Microbiol. 2023, 13, 1067284. [Google Scholar] [CrossRef] [Scilit]
  211. Kim, S.; Kim, S.S.; Lee, B.J. Correlation between the activities of α-helical antimicrobial peptides and hydrophobicities represented as RP HPLC retention times. Peptides 2005, 26, 2050–2056. [Google Scholar] [CrossRef] [Scilit]
  212. Abranches, J.; Zeng, L.; Kajfasz, J.K.; Palmer, S.R.; Chakraborty, B.; Wen, Z.T.; Richards, V.P.; Brady, L.J.; Lemos, J.A. Biology of Oral Streptococci. Microbiol. Spectr. 2018, 6, 10–128. [Google Scholar] [CrossRef] [Scilit]
  213. van’t Hof, W.; Veerman, E.C.; Helmerhorst, E.J.; Amerongen, A.V. Antimicrobial peptides: Properties and applicability. Biol. Chem. 2001, 382, 597–619. [Google Scholar] [CrossRef] [Scilit]
  214. Haney, E.F.; Straus, S.K.; Hancock, R.E.W. Reassessing the Host Defense Peptide Landscape. Front. Chem. 2019, 7, 43. [Google Scholar] [CrossRef] [Scilit]
  215. Gupta, J.; Gupta, K. Xylitol on dental caries: A review. J. Drug Deliv. Ther. 2018, 8, 69–72. [Google Scholar] [CrossRef] [Scilit]
  216. Tang, X.; Sensat, M.; Stoltenberg, J. The antimicrobial effect of chlorhexidine varnish on mutans streptococci in patients with fixed orthodontic appliances: A systematic review of clinical efficacy. Int. J. Dent. Hyg. 2016, 14, 53–61. [Google Scholar] [CrossRef] [Scilit]
  217. Wang, Z.; de la Fuente-Nunez, C.; Shen, Y.; Haapasalo, M.; Hancock, R.E. Treatment of Oral Multispecies Biofilms by an Anti-Biofilm Peptide. PLoS ONE 2015, 10, e0132512. [Google Scholar] [CrossRef] [Scilit]
  218. Lobos, O.; Padilla, A.; Padilla, C. In vitro antimicrobial effect of bacteriocin PsVP-10 in combination with chlorhexidine and triclosan against Streptococcus mutans and Streptococcus sobrinus strains. Arch. Oral Biol. 2009, 54, 230–234. [Google Scholar] [CrossRef] [Scilit]
  219. Ghibaudo, G.; Santospirito, D.; Sala, A.; Flisi, S.; Taddei, S.; Cavirani, S.; Cabassi, C.S. In vitro antimicrobial activity of a gel containing antimicrobial peptide AMP2041, chlorhexidine digluconate and Tris-EDTA on clinical isolates of Pseudomonas aeruginosa from canine otitis. Vet. Dermatol. 2016, 27, 391-e98. [Google Scholar] [CrossRef] [Scilit]
  220. Sheard Dean, E.; O’Brien-Simpson Neil, M.; Wade John, D.; Separovic, F. Combating bacterial resistance by combination of antibiotics with antimicrobial peptides. Pure Appl. Chem. 2019, 91, 199. [Google Scholar] [CrossRef] [Scilit]
  221. Zhang, O.L.; Niu, J.Y.; Yu, O.Y.; Mei, M.L.; Jakubovics, N.S.; Chu, C.H. Peptide Designs for Use in Caries Management: A Systematic Review. Int. J. Mol. Sci. 2023, 24, 4247. [Google Scholar] [CrossRef] [Scilit]
  222. Guo, L.; Edlund, A. Targeted Antimicrobial Peptides: A Novel Technology to Eradicate Harmful Streptococcus Mutans. J. Calif. Dent. Assoc. 2017, 45, 557–564. [Google Scholar] [CrossRef] [Scilit]
  223. Malik, E.; Dennison, S.R.; Harris, F.; Phoenix, D.A. pH Dependent Antimicrobial Peptides and Proteins, Their Mechanisms of Action and Potential as Therapeutic Agents. Pharmaceuticals 2016, 9, 67. [Google Scholar] [CrossRef] [Scilit]
  224. Dashper, S.G.; Liu, S.W.; Reynolds, E.C. Antimicrobial Peptides and their Potential as Oral Therapeutic Agents. Int. J. Pept. Res. Ther. 2007, 13, 505–516. [Google Scholar] [CrossRef] [Scilit]
  225. Kim, J.H.; Lee, J.O.; Jung, J.H.; Lee, S.K.; You, G.Y.; Park, S.H.; Kim, H.S. Gaegurin-6 stimulates insulin secretion through calcium influx in pancreatic β Rin5mf cells. Regul. Pept. 2010, 159, 123–128. [Google Scholar] [CrossRef] [Scilit]
  226. Bray, F.; Ferlay, J.; Soerjomataram, I.; Siegel, R.L.; Torre, L.A.; Jemal, A. Global cancer statistics 2018: GLOBOCAN estimates of incidence and mortality worldwide for 36 cancers in 185 countries. CA Cancer J. Clin. 2018, 68, 394–424. [Google Scholar] [CrossRef] [Scilit]
  227. Meredith, A.-M.; Dass, C.R. Increasing role of the cancer chemotherapeutic doxorubicin in cellular metabolism. J. Pharm. Pharmacol. 2016, 68, 729–741. [Google Scholar] [CrossRef] [Scilit]
  228. Tacar, O.; Sriamornsak, P.; Dass, C.R. Doxorubicin: An update on anticancer molecular action, toxicity and novel drug delivery systems. J. Pharm. Pharmacol. 2013, 65, 157–170. [Google Scholar] [CrossRef] [Scilit]
  229. Zhao, J.; Huang, Y.; Liu, D.; Chen, Y. Two hits are better than one: Synergistic anticancer activity of α-helical peptides and doxorubicin/epirubicin. Oncotarget 2014, 6, 1769–1778. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  230. Zhao, J.; Hao, X.; Liu, D.; Huang, Y.; Chen, Y. In vitro Characterization of the Rapid Cytotoxicity of Anticancer Peptide HPRP-A2 through Membrane Destruction and Intracellular Mechanism against Gastric Cancer Cell Lines. PLoS ONE 2015, 10, e0139578. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  231. Gerlach, S.L.; Rathinakumar, R.; Chakravarty, G.; Goransson, U.; Wimley, W.C.; Darwin, S.P.; Mondal, D. Anticancer and chemosensitizing abilities of cycloviolacin 02 from Viola odorata and psyle cyclotides from Psychotria leptothyrsa. Biopolymers 2010, 94, 617–625. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  232. Hilchie, A.L.; Hoskin, D.W.; Power Coombs, M.R. Anticancer Activities of Natural and Synthetic Peptides. In Antimicrobial Peptides: Basics for Clinical Application; Matsuzaki, K., Ed.; Springer: Singapore, 2019; pp. 131–147. [Google Scholar]
  233. Lee Bong, J.I.N.; Seo Min, D.U.K.; Kang Su, J.I.N.; Kim Hyun, J. Novel Analogues of Antimicrobial and Anticancer Peptide Synthesized and Produced from Gaegurin 5. U.S. Patent No. 8,076,284, 14 May 2007. [Google Scholar]
  234. Kosikowska, P.; Lesner, A. Antimicrobial peptides (AMPs) as drug candidates: A patent review (2003–2015). Expert Opin. Ther. Pat. 2016, 26, 689–702. [Google Scholar] [CrossRef] [Scilit]
  235. Conlon, J.M.; Mechkarska, M.; Abdel-Wahab, Y.H.; Flatt, P.R. Peptides from frog skin with potential for development into agents for Type 2 diabetes therapy. Peptides 2018, 100, 275–281. [Google Scholar] [CrossRef] [Scilit]
  236. Soltaninejad, H.; Zare-Zardini, H.; Ordooei, M.; Ghelmani, Y.; Ghadiri-Anari, A.; Mojahedi, S.; Hamidieh, A.A. Antimicrobial Peptides from Amphibian Innate Immune System as Potent Antidiabetic Agents: A Literature Review and Bioinformatics Analysis. J. Diabetes Res. 2021, 2021, 2894722. [Google Scholar] [CrossRef] [Scilit]
  237. Chatterjee, S.; Khunti, K.; Davies, M.J. Type 2 diabetes. Lancet 2017, 389, 2239–2251. [Google Scholar] [CrossRef] [Scilit]
  238. Zhou, C.; Shen, P.; Cheng, Y. Quantitative study of the drug efflux kinetics from sensitive and MDR human breast cancer cells. Biochim. Biophys. Acta 2007, 1770, 1011–1020. [Google Scholar] [CrossRef] [Scilit]
  239. Mechetner, E.; Kyshtoobayeva, A.; Zonis, S.; Kim, H.; Stroup, R.; Garcia, R.; Parker, R.J.; Fruehauf, J.P. Levels of multidrug resistance (MDR1) P-glycoprotein expression by human breast cancer correlate with in vitro resistance to taxol and doxorubicin. Clin. Cancer Res. 1998, 4, 389–398. [Google Scholar]
  240. Waghray, D.; Zhang, Q. Inhibit or Evade Multidrug Resistance P-Glycoprotein in Cancer Treatment. J. Med. Chem. 2018, 61, 5108–5121. [Google Scholar] [CrossRef] [Scilit]
  241. Dewanjee, S.; Dua, T.K.; Bhattacharjee, N.; Das, A.; Gangopadhyay, M.; Khanra, R.; Joardar, S.; Riaz, M.; Feo, V.D.; Zia-Ul-Haq, M. Natural Products as Alternative Choices for P-Glycoprotein (P-gp) Inhibition. Molecules 2017, 22, 871. [Google Scholar] [CrossRef] [Scilit]
  242. Wang, J.; Seebacher, N.; Shi, H.; Kan, Q.; Duan, Z. Novel strategies to prevent the development of multidrug resistance (MDR) in cancer. Oncotarget 2017, 8, 84559–84571. [Google Scholar] [CrossRef] [Scilit]
  243. Huang, Q.; Cai, T.; Bai, L.; Huang, Y.; Li, Q.; Wang, Q.; Chiba, P.; Cai, Y. State of the art of overcoming efflux transporter mediated multidrug resistance of breast cancer. Transl. Cancer Res. 2019, 8, 319–329. [Google Scholar] [CrossRef] [Scilit]
  244. Suh, J.Y.; Lee, Y.T.; Park, C.B.; Lee, K.H.; Kim, S.C.; Choi, B.S. Structural and functional implications of a proline residue in the antimicrobial peptide gaegurin. Eur. J. Biochem. 1999, 266, 665–674. [Google Scholar] [CrossRef] [Scilit]
  245. Suh, J.Y.; Lee, K.H.; Chi, S.W.; Hong, S.Y.; Choi, B.W.; Moon, H.M.; Choi, B.S. Unusually stable helical kink in the antimicrobial peptide—A derivative of gaegurin. FEBS Lett. 1996, 392, 309–312. [Google Scholar] [CrossRef] [Scilit]
  246. Phoenix, D.A.; Dennison, S.R.; Harris, F. Cationic Antimicrobial Peptides. In Antimicrobial Peptides; Wiley-VCH Verlag GmbH & Co.: Weinheim, Germany; KGaA: Darmstadt, Germany, 2013; pp. 39–81. [Google Scholar]
  247. Visiers, I.; Braunheim, B.B.; Weinstein, H. Prokink: A protocol for numerical evaluation of helix distortions by proline. Protein Eng. Des. Sel. 2000, 13, 603–606. [Google Scholar] [CrossRef] [Scilit]
  248. Bobone, S.; Bocchinfuso, G.; Park, Y.; Palleschi, A.; Hahm, K.S.; Stella, L. The importance of being kinked: Role of Pro residues in the selectivity of the helical antimicrobial peptide P5. J. Pept. Sci. 2013, 19, 758–769. [Google Scholar] [CrossRef] [Scilit]
  249. Vanhoof, G.; Goossens, F.; De Meester, I.; Hendriks, D.; Scharpe, S. Proline motifs in peptides and their biological processing. FASEB J. 1995, 9, 736–744. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  250. Lee, J.K.; Gopal, R.; Park, S.-C.; Ko, H.S.; Kim, Y.; Hahm, K.-S.; Park, Y. A Proline-Hinge Alters the Characteristics of the Amphipathic α-helical AMPs. PLoS ONE 2013, 8, e67597. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  251. Türková, A.; Kabelka, I.; Králová, T.; Sukeník, L.; Pokorná, Š.; Hof, M.; Vácha, R. Effect of Helical Kink in Antimicrobial Peptides on Membrane Pore Formation. eLife 2020, 9, e47946. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  252. Fernandez, D.I.; Gehman, J.D.; Separovic, F. Membrane interactions of antimicrobial peptides from Australian frogs. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1630–1638. [Google Scholar] [CrossRef] [Scilit]
  253. Sani, M.-A.; Separovic, F. How Membrane-Active Peptides Get into Lipid Membranes. Acc. Chem. Res. 2016, 49, 1130–1138. [Google Scholar] [CrossRef] [Scilit]
  254. Rodríguez, A.; Villegas, E.; Montoya-Rosales, A.; Rivas-Santiago, B.; Corzo, G. Characterization of antibacterial and hemolytic activity of synthetic pandinin 2 variants and their inhibition against Mycobacterium tuberculosis. PLoS ONE 2014, 9, e101742. [Google Scholar] [CrossRef] [Scilit]
  255. Harrison, P.L.; Abdel-Rahman, M.A.; Strong, P.N.; Tawfik, M.M.; Miller, K. Characterisation of three alpha-helical antimicrobial peptides from the venom of Scorpio maurus palmatus. Toxicon 2016, 117, 30–36. [Google Scholar] [CrossRef] [Scilit]
  256. Xie, Y.; Fleming, E.; Chen, J.L.; Elmore, D.E. Effect of proline position on the antimicrobial mechanism of buforin II. Peptides 2011, 32, 677–682. [Google Scholar] [CrossRef] [Scilit]
  257. Yang, S.-T.; Lee, J.Y.; Kim, H.-J.; Eu, Y.-J.; Shin, S.Y.; Hahm, K.-S.; Kim, J.I. Contribution of a central proline in model amphipathic α-helical peptides to self-association, interaction with phospholipids, and antimicrobial mode of action. FEBS J. 2006, 273, 4040–4054. [Google Scholar] [CrossRef] [Scilit]
  258. Niidome, T.; Kobayashi, K.; Arakawa, H.; Hatakeyama, T.; Aoyagi, H. Structure–activity relationship of an antibacterial peptide, maculatin 1.1, from the skin glands of the tree frog, Litoria genimaculata. J. Pept. Sci. 2004, 10, 414–422. [Google Scholar] [CrossRef] [Scilit]
  259. Chia, B.C.; Carver, J.A.; Mulhern, T.D.; Bowie, J.H. Maculatin 1.1, an anti-microbial peptide from the Australian tree frog, Litoria genimaculata solution structure and biological activity. Eur. J. Biochem. 2000, 267, 1894–1908. [Google Scholar] [CrossRef] [Scilit]
  260. Fernandez, D.I.; Sani, M.-A.; Separovic, F. Interactions of the Antimicrobial Peptide Maculatin 1.1 and Analogues with Phospholipid Bilayers. Aust. J. Chem. 2011, 64, 798–805. [Google Scholar] [CrossRef] [Scilit]
  261. Sani, M.A.; Lee, T.H.; Aguilar, M.I.; Separovic, F. Proline-15 creates an amphipathic wedge in maculatin 1.1 peptides that drives lipid membrane disruption. Biochim. Biophys. Acta 2015, 1848, 2277–2289. [Google Scholar] [CrossRef] [Scilit]
  262. Harris, F.; Daman, A.; Wallace, J.; Dennison, S.R.; Phoenix, D.A. Oblique orientated alpha-helices and their prediction. Curr. Protein Pept. Sci. 2006, 7, 529–537. [Google Scholar] [CrossRef] [Scilit]
  263. Gautier, R.; Douguet, D.; Antonny, B.; Drin, G. HELIQUEST: A web server to screen sequences with specific α-helical properties. Bioinformatics 2008, 24, 2101–2102. [Google Scholar] [CrossRef] [Scilit]
  264. Ma, B.; Niu, C.; Zhou, Y.; Xue, X.; Meng, J.; Luo, X.; Hou, Z. The Disulfide Bond of the Peptide Thanatin Is Dispensible for Its Antimicrobial Activity In Vivo and In Vitro. Antimicrob. Agents Chemother. 2016, 60, 4283–4289. [Google Scholar] [CrossRef] [Scilit]
  265. Panteleev, P.V.; Bolosov, I.A.; Balandin, S.V.; Ovchinnikova, T.V. Structure and Biological Functions of β-Hairpin Antimicrobial Peptides. Acta Naturae 2015, 7, 37–47. [Google Scholar] [CrossRef] [Scilit]
  266. Imamura, T.; Yamamoto, N.; Tamura, A.; Murabayashi, S.; Hashimoto, S.; Shimada, H.; Taguchi, S. NMR based structure-activity relationship analysis of an antimicrobial peptide, thanatin, engineered by site-specific chemical modification: Activity improvement and spectrum alteration. Biochem. Biophys. Res. Commun. 2008, 369, 609–615. [Google Scholar] [CrossRef] [Scilit]
  267. Orivel, J.; Redeker, V.; Le Caer, J.P.; Krier, F.; Revol-Junelles, A.M.; Longeon, A.; Chaffotte, A.; Dejean, A.; Rossier, J. Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii. J. Biol. Chem. 2001, 276, 17823–17829. [Google Scholar] [CrossRef] [Scilit]
  268. Garcia, F.; Villegas, E.; Espino-Solis, G.P.; Rodriguez, A.; Paniagua-Solis, J.F.; Sandoval-Lopez, G.; Possani, L.D.; Corzo, G. Antimicrobial peptides from arachnid venoms and their microbicidal activity in the presence of commercial antibiotics. J. Antibiot. 2013, 66, 3–10. [Google Scholar] [CrossRef] [Scilit]
  269. Johnson, S.R.; Copello, J.A.; Evans, M.S.; Suarez, A.V. A biochemical characterization of the major peptides from the Venom of the giant Neotropical hunting ant Dinoponera australis. Toxicon 2010, 55, 702–710. [Google Scholar] [CrossRef] [Scilit]
  270. Thaker, H.D.; Cankaya, A.; Scott, R.W.; Tew, G.N. Role of Amphiphilicity in the Design of Synthetic Mimics of Antimicrobial Peptides with Gram-Negative Activity. ACS Med. Chem. Lett. 2013, 4, 481–485. [Google Scholar] [CrossRef] [Scilit]
  271. Xiong, M.; Lee, M.W.; Mansbach, R.A.; Song, Z.; Bao, Y.; Peek, R.M.; Yao, C.; Chen, L.-F.; Ferguson, A.L.; Wong, G.C.L.; et al. Helical antimicrobial polypeptides with radial amphiphilicity. Proc. Natl. Acad. Sci. USA 2015, 112, 13155–13160. [Google Scholar] [CrossRef] [Scilit]
  272. Marcotte, I.; Wegener, K.L.; Lam, Y.-H.; Chia, B.C.S.; de Planque, M.R.R.; Bowie, J.H.; Auger, M.; Separovic, F. Interaction of antimicrobial peptides from Australian amphibians with lipid membranes. Chem. Phys. Lipids 2003, 122, 107–120. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  273. Dennison, S.R.; Harris, F.; Phoenix, D.A. Are oblique orientated alpha-helices used by antimicrobial peptides for membrane invasion? Protein Pept. Lett. 2005, 12, 27–29. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  274. Brasseur, R. Tilted peptides: A motif for membrane destabilization (hypothesis). Mol. Membr. Biol. 2000, 17, 31–40. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  275. Chia, C.S.; Torres, J.; Cooper, M.A.; Arkin, I.T.; Bowie, J.H. The orientation of the antibiotic peptide maculatin 1.1 in DMPG and DMPC lipid bilayers. Support for a pore-forming mechanism. FEBS Lett. 2002, 512, 47–51. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  276. Dennison, S.R.; Wallace, J.; Harris, F.; Phoenix, D.A. Amphiphilic alpha-helical antimicrobial peptides and their structure/function relationships. Protein Pept. Lett. 2005, 12, 31–39. [Google Scholar] [CrossRef] [Scilit]
  277. Strandberg, E.; Killian, J.A. Snorkeling of lysine side chains in transmembrane helices: How easy can it get? FEBS Lett. 2003, 544, 69–73. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  278. Mura, M.; Dennison, S.R.; Zvelindovsky, A.V.; Phoenix, D.A. Aurein 2.3 functionality is supported by oblique orientated alpha-helical formation. Biochim. Biophys. Acta 2013, 1828, 586–594. [Google Scholar] [CrossRef] [Scilit]
  279. Qu, B.; Yuan, J.; Liu, X.; Zhang, S.; Ma, X.; Lu, L. Anticancer activities of natural antimicrobial peptides from animals. Front. Microbiol. 2024, 14, 1321386. [Google Scholar] [CrossRef] [Scilit]
  280. Parchebafi, A.; Tamanaee, F.; Ehteram, H.; Ahmad, E.; Nikzad, H.; Haddad Kashani, H. The dual interaction of antimicrobial peptides on bacteria and cancer cells; mechanism of action and therapeutic strategies of nanostructures. Microb. Cell Factories 2022, 21, 118. [Google Scholar] [CrossRef] [Scilit]
  281. Gabernet, G.; Müller, A.T.; Hiss, J.A.; Schneider, G. Membranolytic anticancer peptides. MedChemComm 2016, 7, 2232–2245. [Google Scholar] [CrossRef] [Scilit]
  282. Deslouches, B.; Di, Y.P. Antimicrobial peptides with selective antitumor mechanisms: Prospect for anticancer applications. Oncotarget 2017, 8, 46635–46651. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  283. Cho, J.H.; Sung, B.H.; Kim, S.C. Buforins: Histone H2A-derived antimicrobial peptides from toad stomach. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1564–1569. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  284. Lee, H.S.; Park, C.B.; Kim, J.M.; Jang, S.A.; Park, I.Y.; Kim, M.S.; Cho, J.H.; Kim, S.C. Mechanism of anticancer activity of buforin IIb, a histone H2A-derived peptide. Cancer Lett. 2008, 271, 47–55. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  285. Li, D.; Xu, Y. Buforin IIb induced cell cycle arrest in liver cancer. Anim. Cells Syst. 2019, 23, 176–183. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  286. Musale, V.; Casciaro, B.; Mangoni, M.L.; Abdel-Wahab, Y.H.A.; Flatt, P.R.; Conlon, J.M. Assessment of the potential of temporin peptides from the frog Rana temporaria (Ranidae) as anti-diabetic agents. J. Pept. Sci. 2018, 24, e3065. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  287. Kwon, M.-Y.; Hong, S.-Y.; Lee, K.-H. Structure-activity analysis of brevinin 1E amide, an antimicrobial peptide from Rana esculenta. Biochim. Biophys. Acta Protein Struct. Mol. Enzymol. 1998, 1387, 239–248. [Google Scholar] [CrossRef] [Scilit]
  288. Zohrab, F.; Askarian, S.; Jalili, A.; Kazemi Oskuee, R. Biological Properties, Current Applications and Potential Therapeautic Applications of Brevinin Peptide Superfamily. Int. J. Pept. Res. Ther. 2019, 25, 39–48. [Google Scholar] [CrossRef] [Scilit]
  289. Chi, S.W.; Kim, J.S.; Kim, D.H.; Lee, S.H.; Park, Y.H.; Han, K.H. Solution structure and membrane interaction mode of an antimicrobial peptide gaegurin 4. Biochem. Biophys. Res. Commun. 2007, 352, 592–597. [Google Scholar] [CrossRef] [Scilit]
  290. Malik, E. The Characterisation of Linearized Esculentin-2EM (gaegurin 4) at Varying pH and in Differing Lipid Environments; University of Central Lancashire: Preston, UK, 2018. [Google Scholar]
  291. Kwon, S.Y.; Carlson, B.A.; Park, J.M.; Lee, B.J. Structural organization and expression of the gaegurin 4 gene of Rana rugosa. Biochim. Biophys. Acta 2000, 1492, 185–190. [Google Scholar] [CrossRef] [Scilit]
  292. Ojo, O.O.; Srinivasan, D.K.; Owolabi, B.O.; Vasu, S.; Conlon, J.M.; Flatt, P.R.; Abdel-Wahab, Y.H.A. Esculentin-2CHa-Related Peptides Modulate Islet Cell Function and Improve Glucose Tolerance in Mice with Diet-Induced Obesity and Insulin Resistance. PLoS ONE 2015, 10, e0141549. [Google Scholar] [CrossRef] [Scilit]
  293. Attoub, S.; Mechkarska, M.; Sonnevend, A.; Radosavljevic, G.; Jovanovic, I.; Lukic, M.L.; Conlon, J.M. Esculentin-2CHa: A host-defense peptide with differential cytotoxicity against bacteria, erythrocytes and tumor cells. Peptides 2013, 39, 95–102. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  294. Vineeth Kumar, T.; Asha, R.; George, S. Identification and functional characterisation of Esculentin-2 HYba peptides and their C-terminally amidated analogs from the skin secretion of an endemic frog. Nat. Prod. Res. 2019, 35, 1262–1266. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  295. Park, S.H.; Kim, Y.K.; Park, J.W.; Lee, B.; Lee, B.J. Solution structure of the antimicrobial peptide gaegurin 4 by 1H and 15N nuclear magnetic resonance spectroscopy. Eur. J. Biochem. 2000, 267, 2695–2704. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  296. Won, H.S.; Park, S.H.; Kim, H.E.; Hyun, B.; Kim, M.; Lee, B.J.; Lee, B.J. Effects of a tryptophanyl substitution on the structure and antimicrobial activity of C-terminally truncated gaegurin 4. Eur. J. Biochem. 2002, 269, 4367–4374. [Google Scholar] [CrossRef] [Scilit]
  297. Kim, H.; Lee, B.J.; Lee, M.H.; Hong, S.G.; Ryu, P.D. Mechanisms of Selective Antimicrobial Activity of Gaegurin 4. Korean J. Physiol. Pharmacol. 2009, 13, 39–47. [Google Scholar] [CrossRef] [Scilit]
  298. Eun, S.-Y.; Jang, H.-K.; Han, S.-K.; Ryu, P.D.; Lee, B.J.; Han, K.-H.; Kim, S.-J. A helix-induced oligomeric transition of gaegurin 4, an antimicrobial peptide isolated from a Korean frog. Mol. Cells 2006, 21, 229–236. [Google Scholar] [CrossRef] [Scilit]
  299. Malik, E.; Phoenix, D.A.; Badiani, K.; Snape, T.J.; Harris, F.; Singh, J.; Morton, L.H.G.; Dennison, S.R. Biophysical studies on the antimicrobial activity of linearized esculentin 2EM. Biochim. Biophys. Acta Biomembr. 2019, 1862, 183141. [Google Scholar] [CrossRef] [Scilit]
  300. Malik, E.; Phoenix, D.A.; Snape, T.J.; Harris, F.; Singh, J.; Morton, L.H.G.; Dennison, S.R. Linearized esculentin-2EM shows pH dependent antibacterial activity with an alkaline optimum. Mol. Cell. Biochem. 2021, 476, 3729–3744. [Google Scholar] [CrossRef] [Scilit]
  301. Agarwal, S.; Sharma, G.; Dang, S.; Gupta, S.; Gabrani, R. Antimicrobial Peptides as Anti-Infectives against Staphylococcus epidermidis. Med. Princ. Pract. 2016, 25, 301–308. [Google Scholar] [CrossRef] [Scilit]
  302. Conlon, J.M.; Al-Ghaferi, N.; Abraham, B.; Leprince, J. Strategies for transformation of naturally-occurring amphibian antimicrobial peptides into therapeutically valuable anti-infective agents. Methods 2007, 42, 349–357. [Google Scholar] [CrossRef] [Scilit]
  303. Nguyen, T.H.; Park, M.D.; Otto, M. Host Response to Staphylococcus epidermidis Colonization and Infections. Front. Cell. Infect. Microbiol. 2017, 7, 90. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  304. Widerström, M. Commentary: Significance of Staphylococcus epidermidis in Health Care-Associated Infections, from Contaminant to Clinically Relevant Pathogen: This Is a Wake-Up Call! J. Clin. Microbiol. 2016, 54, 1679–1681. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  305. Kim, H.; Kim, S.; Lee, M.; Lee, B.; Ryu, P. Role of C-terminal heptapeptide in pore-forming activity of antimicrobial agent, gaegurin 4. J. Pept. Res. 2004, 64, 151–158. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  306. Rhodes, J.; Fisher, M.C. Global epidemiology of emerging Candida auris. Curr. Opin. Microbiol. 2019, 52, 84–89. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  307. Nett, J.E. Candida auris: An emerging pathogen “incognito”? PLoS Pathog. 2019, 15, e1007638. [Google Scholar] [CrossRef] [Scilit]
  308. Wang, S.; Zeng, X.; Yang, Q.; Qiao, S. Antimicrobial Peptides as Potential Alternatives to Antibiotics in Food Animal Industry. Int. J. Mol. Sci. 2016, 17, 603. [Google Scholar] [CrossRef] [Scilit]
  309. Meng, S.; Xu, H.; Wang, F. Research advances of antimicrobial peptides and applications in food industry and agriculture. Curr. Protein Pept. Sci. 2010, 11, 264–273. [Google Scholar] [CrossRef] [Scilit]
  310. Ben Lagha, A.; Haas, B.; Gottschalk, M.; Grenier, D. Antimicrobial potential of bacteriocins in poultry and swine production. Vet. Res. 2017, 48, 22. [Google Scholar] [CrossRef] [Scilit]
  311. Dennison, S.R.; Morton, L.H.; Phoenix, D.A. Role of molecular architecture on the relative efficacy of aurein 2.5 and modelin 5. Biochim. Biophys. Acta 2012, 1818, 2094–2102. [Google Scholar] [CrossRef] [Scilit]
  312. Kim, S.; Kim, J.Y.; Lee, B.J.; Kim, S.J. Synthesis and characterization of GGN4 and its tryptophan substituted analogue peptides. J. Biochem. Mol. Biol. 1999, 32, 12–19. [Google Scholar]
  313. Migoń, D.; Neubauer, D.; Kamysz, W. Hydrocarbon Stapled Antimicrobial Peptides. Protein J. 2018, 37, 2–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  314. Bayarbat, I.; Lee, J.H.; Lee, S.Y. Expression of Recombinant Hybrid Peptide Gaegurin4 and LL37 using Fusion Protein in E. coli. Korean J. Microbiol. Biotechnol. 2012, 40, 92–97. [Google Scholar] [CrossRef] [Scilit]
  315. Pujarini, D.; Santasabuj, D. Mammalian Antimicrobial Peptides: Promising Therapeutic Targets Against Infection and Chronic Inflammation. Curr. Top. Med. Chem. 2016, 16, 99–129. [Google Scholar] [CrossRef] [Scilit]
  316. Biswaro, L.S.; da Costa Sousa, M.G.; Rezende, T.M.B.; Dias, S.C.; Franco, O.L. Antimicrobial Peptides and Nanotechnology, Recent Advances and Challenges. Front. Microbiol. 2018, 9, 855. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  317. Boto, A.; Perez de la Lastra, J.M.; Gonzalez, C.C. The Road from Host-Defense Peptides to a New Generation of Antimicrobial Drugs. Molecules 2018, 23, 311. [Google Scholar] [CrossRef] [Scilit]
  318. Kim, J.; Park, J.M.; Lee, B.J. High-level expression and efficient purification of the antimicrobial peptide gaegurin 4 in E. coli. Protein Pept. Lett. 1997, 4, 391–396. [Google Scholar]
  319. Park, S.; Son, W.S.; Kim, Y.J.; Kwon, A.R.; Lee, B.J. NMR spectroscopic assessment of the structure and dynamic properties of an amphibian antimicrobial peptide (Gaegurin 4) bound to SDS micelles. BMB Rep. 2007, 40, 261–269. [Google Scholar] [CrossRef] [Scilit]
  320. Imai, K.; Mitaku, S. Mechanisms of secondary structure breakers in soluble proteins. Biophysics 2005, 1, 55–65. [Google Scholar] [CrossRef] [Scilit]
  321. Idiong, G.; Won, A.; Ruscito, A.; Leung, B.O.; Hitchcock, A.P.; Ianoul, A. Investigating the effect of a single glycine to alanine substitution on interactions of antimicrobial peptide latarcin 2a with a lipid membrane. Eur. Biophys. J. 2011, 40, 1087–1100. [Google Scholar] [CrossRef] [Scilit]
  322. Sani, M.A.; Saenger, C.; Juretic, D.; Separovic, F. Glycine Substitution Reduces Antimicrobial Activity and Helical Stretch of diPGLa-H in Lipid Micelles. J. Phys. Chem. B 2017, 121, 4817–4822. [Google Scholar] [CrossRef] [Scilit]
  323. Qu, P.; Gao, W.; Chen, H.; Li, D.; Yang, N.; Zhu, J.; Feng, X.; Liu, C.; Li, Z. The Central Hinge Link Truncation of the Antimicrobial Peptide Fowlicidin-3 Enhances Its Cell Selectivity without Antibacterial Activity Loss. Antimicrob. Agents Chemother. 2016, 60, 2798–2806. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  324. Chen, H.-C.; Brown, J.H.; Morell, J.L.; Huang, C.M. Synthetic magainin analogues with improved antimicrobial activity. FEBS Lett. 1988, 236, 462–466. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  325. Amos, S.-B.T.A.; Vermeer, L.S.; Ferguson, P.M.; Kozlowska, J.; Davy, M.; Bui, T.T.; Drake, A.F.; Lorenz, C.D.; Mason, A.J. Antimicrobial Peptide Potency is Facilitated by Greater Conformational Flexibility when Binding to Gram-negative Bacterial Inner Membranes. Sci. Rep. 2016, 6, 37639. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  326. Panteleev, P.; Tsarev, A.V.; Bolosov, I.A.; Paramonov, A.S.; Marggraf, M.B.; Sychev, S.V.; Shenkarev, Z.O.; Ovchinnikova, T.V. Novel Antimicrobial Peptides from the Arctic Polychaeta Nicomache minor Provide New Molecular Insight into Biological Role of the BRICHOS Domain. Mar. Drugs 2018, 16, 401. [Google Scholar] [CrossRef] [Scilit]
  327. Pham, T.K.; Kim, D.H.; Lee, B.J.; Kim, Y.W. Truncated and constrained helical analogs of antimicrobial esculentin-2EM. Bioorganic Med. Chem. Lett. 2013, 23, 6717–6720. [Google Scholar] [CrossRef] [Scilit]
  328. Dennison, S.R.; Morton, L.H.; Phoenix, D.A. Effect of amidation on the antimicrobial peptide aurein 2.5 from Australian southern bell frogs. Protein Pept. Lett. 2012, 19, 586–591. [Google Scholar] [CrossRef] [Scilit]
  329. Dennison, S.R.; Harris, F.; Morton, L.H.G.; Phoenix, D.A. Antimicrobial activity of aurein 2.5 against yeasts. FEMS Microbiol. Lett. 2013, 346, 140–145. [Google Scholar] [CrossRef] [Scilit]
  330. Dennison, S.R.; Morton, L.H.G.; Harris, F.; Phoenix, D.A. The interaction of aurein 2.5 with fungal membranes. Eur. Biophys. J. Biophys. Lett. 2014, 43, 255–264. [Google Scholar] [CrossRef] [Scilit]
  331. Kim, H.J.; Han, S.K.; Park, J.B.; Baek, H.J.; Lee, B.J.; Ryu, P.D. Gaegurin 4, a peptide antibiotic of frog skin, forms voltage-dependent channels in planar lipid bilayers. J. Pept. Res. Off. J. Am. Pept. Soc. 1999, 53, 1–7. [Google Scholar] [CrossRef] [Scilit]
  332. Epand, R.M.; Epand, R.F. Bacterial membrane lipids in the action of antimicrobial agents. J. Pept. Sci. 2011, 17, 298–305. [Google Scholar] [CrossRef] [Scilit]
  333. Han, F.F.; Gao, Y.H.; Luan, C.; Xie, Y.G.; Liu, Y.F.; Wang, Y.Z. Comparing bacterial membrane interactions and antimicrobial activity of porcine lactoferricin-derived peptides. J. Dairy Sci. 2013, 96, 3471–3487. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  334. Lin, Y.-M.; Wu, S.-J.; Chang, T.-W.; Wang, C.-F.; Suen, C.-S.; Hwang, M.-J.; Chang, M.D.-T.; Chen, Y.-T.; Liao, Y.-D. Outer membrane protein I of Pseudomonas aeruginosa is a target of cationic antimicrobial peptide/protein. J. Biol. Chem. 2010, 285, 8985–8994. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  335. Chang, T.-W.; Lin, Y.-M.; Wang, C.-F.; Liao, Y.-D. Outer membrane lipoprotein Lpp is Gram-negative bacterial cell surface receptor for cationic antimicrobial peptides. J. Biol. Chem. 2012, 287, 418–428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  336. Chen, H.M.; Chan, S.C.; Lee, J.C.; Chang, C.C.; Murugan, M.; Jack, R.W. Transmission electron microscopic observations of membrane effects of antibiotic cecropin B on Escherichia coli. Microsc. Res. Tech. 2003, 62, 423–430. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  337. Epand, R.M.; Epand, R.F. Lipid domains in bacterial membranes and the action of antimicrobial agents. Biochim. Biophys. Acta Biomembr. 2009, 1788, 289–294. [Google Scholar] [CrossRef] [Scilit]
  338. Bahar, A.A.; Ren, D. Antimicrobial peptides. Pharmaceuticals 2013, 6, 1543–1575. [Google Scholar] [CrossRef] [Scilit]
  339. Kredics, L.; Szekeres, A.; Czifra, D.; Vágvölgyi, C.; Leitgeb, B. Recent Results in Alamethicin Research. Chem. Biodivers. 2013, 10, 744–771. [Google Scholar] [CrossRef] [Scilit]
  340. Tyagi, C.; Marik, T.; Vagvolgyi, C.; Kredics, L.; Otvos, F. Accelerated Molecular Dynamics Applied to the Peptaibol Folding Problem. Int. J. Mol. Sci. 2019, 20, 4268. [Google Scholar] [CrossRef] [Scilit]
  341. Rončević, T.; Puizina, J.; Tossi, A. Antimicrobial Peptides as Anti-Infective Agents in Pre-Post-Antibiotic Era? Int. J. Mol. Sci. 2019, 20, 5713. [Google Scholar] [CrossRef] [Scilit]
  342. Bessin, Y.; Saint, N.; Marri, L.; Marchini, D.; Molle, G. Antibacterial activity and pore-forming properties of ceratotoxins: A mechanism of action based on the barrel stave model. Biochim. Biophys. Acta-Biomembr. 2004, 1667, 148–156. [Google Scholar] [CrossRef] [Scilit]
  343. Zeth, K.; Sancho-Vaello, E. The Human Antimicrobial Peptides Dermcidin and LL-37 Show Novel Distinct Pathways in Membrane Interactions. Front. Chem. 2017, 5, 86. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  344. Song, C.; Weichbrodt, C.; Salnikov, E.S.; Dynowski, M.; Forsberg, B.O.; Bechinger, B.; Steinem, C.; de Groot, B.L.; Zachariae, U.; Zeth, K. Crystal structure and functional mechanism of a human antimicrobial membrane channel. Proc. Natl. Acad. Sci. USA 2013, 110, 4586–4591. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  345. He, Y.; Lazaridis, T. Activity determinants of helical antimicrobial peptides: A large-scale computational study. PLoS ONE 2013, 8, e66440. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  346. Torres-Larios, A.; Gurrola, G.B.; Zamudio, F.Z.; Possani, L.D. Hadrurin, a new antimicrobial peptide from the venom of the scorpion Hadrurus aztecus. Eur. J. Biochem. 2000, 267, 5023–5031. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  347. Lee, H.-R.; You, D.-g.; Kim, H.K.; Sohn, J.W.; Kim, M.J.; Park, J.K.; Lee, G.Y.; Yoo, Y.D. Romo1-Derived Antimicrobial Peptide Is a New Antimicrobial Agent against Multidrug-Resistant Bacteria in a Murine Model of Sepsis. mBio 2020, 11, e03258-19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  348. Phoenix, D.A.; Harris, F.; Mura, M.; Dennison, S.R. The increasing role of phosphatidylethanolamine as a lipid receptor in the action of host defence peptides. Prog. Lipid Res. 2015, 59, 26–37. [Google Scholar] [CrossRef] [Scilit]
  349. Dennison, S.R.; Harris, F.; Mura, M.; Morton, L.H.; Zvelindovsky, A.; Phoenix, D.A. A novel form of bacterial resistance to the action of eukaryotic host defense peptides, the use of a lipid receptor. Biochemistry 2013, 52, 6021–6029. [Google Scholar] [CrossRef] [Scilit]
  350. Scheinpflug, K.; Krylova, O.; Nikolenko, H.; Thurm, C.; Dathe, M. Evidence for a Novel Mechanism of Antimicrobial Action of a Cyclic R-,W-Rich Hexapeptide. PLoS ONE 2015, 10, e0125056. [Google Scholar] [CrossRef] [Scilit]
  351. Zweytick, D.; Japelj, B.; Mileykovskaya, E.; Zorko, M.; Dowhan, W.; Blondelle, S.E.; Riedl, S.; Jerala, R.; Lohner, K. N-acylated peptides derived from human lactoferricin perturb organization of cardiolipin and phosphatidylethanolamine in cell membranes and induce defects in Escherichia coli cell division. PLoS ONE 2014, 9, e90228. [Google Scholar] [CrossRef] [Scilit]
  352. Dowhan, W.; Bogdanov, M.; Mileykovskaya, E. Chapter 1—Functional Roles of Lipids in Membranes. In Biochemistry of Lipids, Lipoproteins and Membranes, 6th ed.; Ridgway, N.D., McLeod, R.S., Eds.; Elsevier: Boston, MA, USA, 2016; pp. 1–40. [Google Scholar]
  353. Lewis, R.N.A.H.; McElhaney, R.N. The physicochemical properties of cardiolipin bilayers and cardiolipin-containing lipid membranes. Biochim. Biophys. Acta Biomembr. 2009, 1788, 2069–2079. [Google Scholar] [CrossRef] [Scilit]
  354. Bechinger, B.; Lohner, K. Detergent-like actions of linear amphipathic cationic antimicrobial peptides. Biochim. Biophys. Acta 2006, 1758, 1529–1539. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  355. Annick, T.; Robert, B. Tilted Peptides: The History. Curr. Protein Pept. Sci. 2006, 7, 523–527. [Google Scholar] [CrossRef] [Scilit]
  356. Dennison, S.R.; Morton, L.H.; Harris, F.; Phoenix, D.A. The impact of membrane lipid composition on antimicrobial function of an alpha-helical peptide. Chem. Phys. Lipids 2008, 151, 92–102. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  357. Hernández-Villa, L.; Manrique-Moreno, M.; Leidy, C.; Jemioła-Rzemińska, M.; Ortíz, C.; Strzałka, K. Biophysical evaluation of cardiolipin content as a regulator of the membrane lytic effect of antimicrobial peptides. Biophys. Chem. 2018, 238, 8–15. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  358. Poger, D.; Pöyry, S.; Mark, A.E. Could Cardiolipin Protect Membranes against the Action of Certain Antimicrobial Peptides? Aurein 1.2, a Case Study. ACS Omega 2018, 3, 16453–16464. [Google Scholar] [CrossRef] [Scilit]
  359. Dennison, S.R.; Morton, L.H.; Harris, F.; Phoenix, D.A. Low pH Enhances the Action of Maximin H5 against Staphylococcus aureus and Helps Mediate Lysylated Phosphatidylglycerol-Induced Resistance. Biochemistry 2016, 55, 3735–3751. [Google Scholar] [CrossRef] [Scilit]
  360. Kim, D.; Wang, Z.; Jin, L.L.; Li, H.P.; Hwang, J.W.; Hanrahan, J.W.; Wang, Q.Y. Development of a novel antimicrobial peptide AWRK6. Bangladesh J. Pharmacol. 2016, 11, 460–468. [Google Scholar] [CrossRef] [Scilit]
  361. Wang, Q.; Zhao, C.; Jin, L.; Zhang, H.; Miao, Q.; Liu, H.; Zhang, D. AWRK6, a Novel GLP-1 Receptor Agonist, Attenuates Diabetes by Stimulating Insulin Secretion. Int. J. Mol. Sci. 2018, 19, 3053. [Google Scholar] [CrossRef] [Scilit]
  362. Wang, Q.; Jin, L.; Wang, H.; Tai, S.; Liu, H.; Zhang, D. AWRK6, A Synthetic Cationic Peptide Derived from Antimicrobial Peptide Dybowskin-2CDYa, Inhibits Lipopolysaccharide-Induced Inflammatory Response. Int. J. Mol. Sci. 2018, 19, 600. [Google Scholar] [CrossRef] [Scilit]
  363. Haines, T.H. A new look at Cardiolipin. Biochim. Biophys. Acta Biomembr. 2009, 1788, 1997–2002. [Google Scholar] [CrossRef] [Scilit]
  364. Yeagle, P.L. Chapter 1—Introduction. In The Membranes of Cells, 3rd ed.; Yeagle, P.L., Ed.; Academic Press: Boston, MA, USA, 2016; pp. 1–25. [Google Scholar]
  365. Lourenço, A.L.P.; Rios, T.B.; da Silva, Á.P.; Franco, O.L.; Ramada, M.H.S. Peptide Stapling Applied to Antimicrobial Peptides. Antibiotics 2023, 12, 1400. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  366. You, Y.; Liu, H.; Zhu, Y.; Zheng, H. Rational design of stapled antimicrobial peptides. Amino Acids 2023, 55, 421–442. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  367. Mourtada, R.; Herce, H.D.; Yin, D.J.; Moroco, J.A.; Wales, T.E.; Engen, J.R.; Walensky, L.D. Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice. Nat. Biotechnol. 2019, 37, 1186–1197. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  368. Robertson, N.S.; Jamieson, A.G. Regulation of protein–protein interactions using stapled peptides. Rep. Org. Chem. 2015, 5, 65–74. [Google Scholar] [CrossRef] [Scilit]
  369. Pham, T.K.; Yoo, J.; Kim, Y.-W. Comparison of Oct-2-enyl and Oct-4-enyl staples for their formation and α-helix stabilizing effects. Bull. Korean Chem. Soc. 2013, 34, 2640–2644. [Google Scholar] [CrossRef] [Scilit]
  370. Luong, H.X.; Bui, H.T.P.; Tung, T.T. Application of the All-Hydrocarbon Stapling Technique in the Design of Membrane-Active Peptides. J. Med. Chem. 2022, 65, 3026–3045. [Google Scholar] [CrossRef] [Scilit]
  371. Krishnamoorthy, S.; Swain, B.; Verma, R.S.; Gunthe, S.S. SARS-CoV, MERS-CoV, and 2019-nCoV viruses: An overview of origin, evolution, and genetic variations. Virusdisease 2020, 31, 411–423. [Google Scholar] [CrossRef] [Scilit]
  372. Zhu, Z.; Lian, X.; Su, X.; Wu, W.; Marraro, G.A.; Zeng, Y. From SARS and MERS to COVID-19: A brief summary and comparison of severe acute respiratory infections caused by three highly pathogenic human coronaviruses. Respir. Res. 2020, 21, 224. [Google Scholar] [CrossRef] [Scilit]
  373. Jackman, J.A. Antiviral peptide engineering for targeting membrane-enveloped viruses: Recent progress and future directions. Biochim. Biophys. Acta Biomembr. 2022, 1864, 183821. [Google Scholar] [CrossRef] [Scilit]
  374. Teissier, E.; Penin, F.; Pécheur, E.-I. Targeting Cell Entry of Enveloped Viruses as an Antiviral Strategy. Molecules 2011, 16, 221–250. [Google Scholar] [CrossRef] [Scilit]
  375. Saini, J.; Kaur, P.; Malik, N.; Lakhawat, S.S.; Sharma, P.K. Antimicrobial peptides: A promising tool to combat multidrug resistance in SARS CoV2 era. Microbiol. Res. 2022, 265, 127206. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  376. Bakovic, A.; Risner, K.; Bhalla, N.; Alem, F.; Chang, T.L.; Weston, W.; Harness, J.A.; Narayanan, A. Brilacidin, a COVID-19 Drug Candidate, Exhibits Potent In Vitro Antiviral Activity Against SARS-CoV-2. bioRxiv 2020, 2020-10. [Google Scholar] [CrossRef] [Scilit]
  377. Sample, C.J.; Hudak, K.E.; Barefoot, B.E.; Koci, M.D.; Wanyonyi, M.S.; Abraham, S.; Staats, H.F.; Ramsburg, E.A. A mastoparan-derived peptide has broad-spectrum antiviral activity against enveloped viruses. Peptides 2013, 48, 96–105. [Google Scholar] [CrossRef] [Scilit]
  378. Hoffmann, A.R.; Guha, S.; Wu, E.; Ghimire, J.; Wang, Y.; He, J.; Garry, R.F.; Wimley, W.C. Broad-Spectrum Antiviral Entry Inhibition by Interfacially Active Peptides. J. Virol. 2020, 94, 10–1128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  379. Zakaryan, H.; Chilingaryan, G.; Arabyan, E.; Serobian, A.; Wang, G. Natural antimicrobial peptides as a source of new antiviral agents. J. Gen. Virol. 2021, 102, 001661. [Google Scholar] [CrossRef] [Scilit]
  380. Buck, C.B.; Day, P.M.; Thompson, C.D.; Lubkowski, J.; Lu, W.; Lowy, D.R.; Schiller, J.T. Human α-defensins block papillomavirus infection. Proc. Natl. Acad. Sci. USA 2006, 103, 1516–1521. [Google Scholar] [CrossRef] [Scilit]
  381. Skeate, J.G.; Segerink, W.H.; Garcia, M.D.; Fernandez, D.J.; Prins, R.; Lühen, K.P.; Voss, F.O.; Da Silva, D.M.; Kast, W.M. Theta-defensins inhibit high-risk human papillomavirus infection through charge-driven capsid clustering. Front. Immunol. 2020, 11, 561843. [Google Scholar] [CrossRef] [Scilit]
  382. Cho, N.-J.; Dvory-Sobol, H.; Xiong, A.; Cho, S.-J.; Frank, C.W.; Glenn, J.S. Mechanism of an Amphipathic α-Helical Peptide’s Antiviral Activity Involves Size-Dependent Virus Particle Lysis. ACS Chem. Biol. 2009, 4, 1061–1067. [Google Scholar] [CrossRef] [Scilit]
  383. Jackman, J.A.; Zan, G.H.; Zhdanov, V.P.; Cho, N.-J. Rupture of Lipid Vesicles by a Broad-Spectrum Antiviral Peptide: Influence of Vesicle Size. J. Phys. Chem. B 2013, 117, 16117–16128. [Google Scholar] [CrossRef] [Scilit]
  384. Jackman, J.A.; Saravanan, R.; Zhang, Y.; Tabaei, S.R.; Cho, N.-J. Correlation between Membrane Partitioning and Functional Activity in a Single Lipid Vesicle Assay Establishes Design Guidelines for Antiviral Peptides. Small 2015, 11, 2372–2379. [Google Scholar] [CrossRef] [Scilit]
  385. Park, S.; Jackman, J.A.; Cho, N.-J. Comparing the membrane-interaction profiles of two antiviral peptides: Insights into structure–function relationship. Langmuir 2019, 35, 9934–9943. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  386. Skalickova, S.; Heger, Z.; Krejcova, L.; Pekarik, V.; Bastl, K.; Janda, J.; Kostolansky, F.; Vareckova, E.; Zitka, O.; Adam, V.; et al. Perspective of Use of Antiviral Peptides against Influenza Virus. Viruses 2015, 7, 5428–5442. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  387. Yeh, J.-C.; Hazam Prakash, K.; Hsieh, C.-Y.; Hsu, P.-H.; Lin, W.-C.; Chen, Y.-R.; Li, C.-C.; Chen, J.-Y. Rational Design of Stapled Antimicrobial Peptides to Enhance Stability and In Vivo Potency against Polymicrobial Sepsis. Microbiol. Spectr. 2023, 11, e03853-22. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  388. Wojciechowska, M.; Macyszyn, J.; Miszkiewicz, J.; Grzela, R.; Trylska, J. Stapled Anoplin as an Antibacterial Agent. Front. Microbiol. 2021, 12, 772038. [Google Scholar] [CrossRef] [Scilit]
  389. Cromm, P.M.; Spiegel, J.; Grossmann, T.N. Hydrocarbon Stapled Peptides as Modulators of Biological Function. ACS Chem. Biol. 2015, 10, 1362–1375. [Google Scholar] [CrossRef] [Scilit]
  390. Yang, Y.; Babich, O.; Sukhikh, S.; Zimina, M. Antibiotic activity and resistance of lactic acid bacteria and other antagonistic bacteriocin-producing microorganisms. Foods Raw Mater. 2020, 8, 377–384. [Google Scholar] [CrossRef] [Scilit]
  391. Zhai, Z.; Cui, C.; Li, X.; Yan, J.; Sun, E.; Wang, C.; Guo, H.; Hao, Y. Prevalence, antimicrobial susceptibility, and antibiotic resistance gene transfer of Bacillus strains isolated from pasteurized milk. J. Dairy Sci. 2023, 106, 75–83. [Google Scholar] [CrossRef] [Scilit]
  392. Irkitov, A.N.; Grebenshchikova, A.V.; Dudnik, D.E. Antibiotic susceptibilty of bacteria from the Bacillus subtilis group. Ukr. J. Ecol. 2019, 9, 363–366. [Google Scholar] [CrossRef] [Scilit]
  393. Celandroni, F.; Salvetti, S.; Gueye, S.A.; Mazzantini, D.; Lupetti, A.; Senesi, S.; Ghelardi, E. Identification and Pathogenic Potential of Clinical Bacillus and Paenibacillus Isolates. PLoS ONE 2016, 11, E0152831. [Google Scholar] [CrossRef] [Scilit]
  394. Tokano, M.; Tarumoto, N.; Imai, K.; Sakai, J.; Maeda, T.; Kawamura, T.; Seo, K.; Takahashi, K.; Yamamoto, T.; Maesaki, S. Bacterial Meningitis Caused by Bacillus subtilis var. natto. Intern. Med. 2023, 62, 1989–1993. [Google Scholar] [CrossRef] [Scilit]
  395. Kato, A.; Yoshifuji, A.; Komori, K.; Aoki, K.; Taniyama, D.; Komatsu, M.; Fujii, K.; Yamada, K.; Ishii, Y.; Kikuchi, T.; et al. A case of Bacillus subtilis var. natto bacteremia caused by ingestion of natto during COVID-19 treatment in a maintenance hemodialysis patient with multiple myeloma. J. Infect. Chemother. 2022, 28, 1212–1215. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  396. Khatri, B.; Nuthakki, V.R.; Chatterjee, J. Strategies to Enhance Metabolic Stabilities. In Cyclic Peptide Design; Goetz, G., Ed.; Springer New York: New York, NY, USA, 2019; pp. 17–40. [Google Scholar]
  397. Lai, Z.; Yuan, X.; Chen, H.; Zhu, Y.; Dong, N.; Shan, A. Strategies employed in the design of antimicrobial peptides with enhanced proteolytic stability. Biotechnol. Adv. 2022, 59, 107962. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  398. Lee, Y.J.; Shirkey, J.D.; Park, J.; Bisht, K.; Cowan, A.J. An Overview of Antiviral Peptides and Rational Biodesign Considerations. Biodesign Res. 2022, 2022, 9898241. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  399. Vankadari, N.; Shepherd, D.C.; Carter, S.D.; Ghosal, D. Three-dimensional insights into human enveloped viruses in vitro and in situ. Biochem. Soc. Trans. 2022, 50, 95–105. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  400. Dinh, T.T.T.; Kim, D.-H.; Lee, S.-J.; Kim, Y.-W. De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides. Bull. Korean Chem. Soc. 2014, 35, 3632–3636. [Google Scholar] [CrossRef] [Scilit]
  401. Dinh, T.T.T.; Kim, D.-H.; Nguyen, T.Q.; Lee, B.-J.; Kim, Y.-W. N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities. Bull. Korean Chem. Soc. 2015, 36, 2511–2515. [Google Scholar] [CrossRef] [Scilit]
  402. Luong, H.X.; Kim, D.-H.; Lee, B.-J.; Kim, Y.-W. Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers. Bull. Korean Chem. Soc. 2016, 37, 1199–1203. [Google Scholar] [CrossRef] [Scilit]
  403. Luong, H.X.; Kim, D.H.; Mai, N.T.; Lee, B.J.; Kim, Y.W. Mono-substitution effects on antimicrobial activity of stapled heptapeptides. Arch. Pharmacal Res. 2017, 40, 713–719. [Google Scholar] [CrossRef] [Scilit]
  404. Shi, G.; Kang, X.; Dong, F.; Liu, Y.; Zhu, N.; Hu, Y.; Xu, H.; Lao, X.; Zheng, H. DRAMP 3.0: An enhanced comprehensive data repository of antimicrobial peptides. Nucleic Acids Res. 2022, 50, D488–D496. [Google Scholar] [CrossRef] [Scilit]
  405. UCN. The IUCN Red List of Threatened Species. Version 2024-2. 2024. Available online: https://www.iucnredlist.org (accessed on 5 December 2024).
  406. Matsui, M.; Maeda, N. Encyclopedia of Japanese Frogs; Bun-ichi Sogo Shuppan Co.: Tokyo, Japan, 2018; p. 271. [Google Scholar]
  407. Fei, L.; Ye, C.; Jiang, J. Colored Atlas of Chinese Amphibians and Their Distributions; Huayu Nature Book Trade Co. Ltd.: Beijing, China, 2012; p. 620. [Google Scholar]
  408. Fei, L.; Ye, C.-Y.; Huang, Y.-A.; Liu, M.-Y. Atlas of Amphibians of China; Henan Science and Technical Press: Zhengzhou, China, 1999; p. 432. [Google Scholar]
  409. Collins, J.P. Amphibian decline and extinction: What we know and what we need to learn. Dis. Aquat. Org. 2010, 92, 93–99. [Google Scholar] [CrossRef] [Scilit]
  410. Pyron, R.A. Global amphibian declines have winners and losers. Proc. Natl. Acad. Sci. USA 2018, 115, 3739–3741. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  411. Nicolas, P.; Vanhoye, D.; Amiche, M. Molecular strategies in biological evolution of antimicrobial peptides. Peptides 2003, 24, 1669–1680. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  412. Duda, T.F.; Vanhoye, D.; Nicolas, P. Roles of Diversifying Selection and Coordinated Evolution in the Evolution of Amphibian Antimicrobial Peptides. Mol. Biol. Evol. 2002, 19, 858–864. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  413. Alison, J.R.; Strathern, J.N. Error-Prone DNA Polymerases: When Making a Mistake is the Only Way to Get Ahead. Annu. Rev. Genet. 2003, 37, 31–66. [Google Scholar] [CrossRef] [Scilit]
  414. Vaisman, A.; Woodgate, R. Translesion DNA polymerases in eukaryotes: What makes them tick? Crit. Rev. Biochem. Mol. Biol. 2017, 52, 274–303. [Google Scholar] [CrossRef] [Scilit]
  415. Maslowska, K.H.; Makiela-Dzbenska, K.; Fijalkowska, I.J. The SOS system: A complex and tightly regulated response to DNA damage. Environ. Mol. Mutagen. 2019, 60, 368–384. [Google Scholar] [CrossRef] [Scilit]
  416. Pelleschi, A. The Evolution of Amphibians; Abdo Publishing: North Mankato, MN, USA, 2018. [Google Scholar]
  417. Haslam, I.S.; Roubos, E.W.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R. From frog integument to human skin: Dermatological perspectives from frog skin biology. Biol. Rev. 2014, 89, 618–655. [Google Scholar] [CrossRef] [Scilit]
  418. Marenah, L.; Flatt, P.R.; Orr, D.F.; Shaw, C.; YH, A.-W. Isolation and structural characterization of novel Rugosin A-like insulinotropic peptide from the skin secretions of Rana saharica frog. Peptides 2005, 26, 2117–2123. [Google Scholar] [CrossRef] [Scilit]
  419. Yokoyama, H.; Kudo, N.; Todate, M.; Shimada, Y.; Suzuki, M.; Tamura, K. Skin regeneration of amphibians: A novel model for skin regeneration as adults. Dev. Growth Differ. 2018, 60, 316–325. [Google Scholar] [CrossRef] [Scilit]
  420. Wang, J.; Xu, J. Effects of Topical Insulin on Wound Healing: A Review of Animal and Human Evidences. Diabetes Metab. Syndr. Obes. 2020, 13, 719–727. [Google Scholar] [CrossRef] [Scilit]
  421. Oryan, A.; Alemzadeh, E. Effects of insulin on wound healing: A review of animal and human evidences. Life Sci. 2017, 174, 59–67. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  422. Alton, L.A.; Franklin, C.E. Drivers of amphibian declines: Effects of ultraviolet radiation and interactions with other environmental factors. Clim. Chang. Responses 2017, 4, 6. [Google Scholar] [CrossRef] [Scilit]
  423. Cramp, R.L.; Franklin, C.E. Exploring the link between ultraviolet B radiation and immune function in amphibians: Implications for emerging infectious diseases. Conserv. Physiol. 2018, 6, coy035. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  424. Dunnill, C.; Patton, T.; Brennan, J.; Barrett, J.; Dryden, M.; Cooke, J.; Leaper, D.; Georgopoulos, N.T. Reactive oxygen species (ROS) and wound healing: The functional role of ROS and emerging ROS-modulating technologies for augmentation of the healing process. Int. Wound J. 2017, 14, 89–96. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  425. Xu, H.; Zheng, Y.-W.; Liu, Q.; Liu, L.-P.; Luo, F.-L.; Zhou, H.-C.; Isoda, H.; Ohkohchi, N.; Li, Y.-M. Reactive Oxygen Species in Skin Repair, Regeneration, Aging, and Inflammation. In Reactive Oxygen Species (ROS) in Living Cells; Intechopen: London, UK, 2018. [Google Scholar]
  426. Yin, S.; Wang, Y.; Yang, X. Amphibian-derived wound healing peptides: Chemical molecular treasure trove for skin wound treatment. Front. Pharmacol. 2023, 14, 1120228. [Google Scholar] [CrossRef] [Scilit]
  427. Wang, X.; Duan, H.; Li, M.; Xu, W.; Wei, L. Characterization and mechanism of action of amphibian-derived wound-healing-promoting peptides. Front. Cell Dev. Biol. 2023, 11, 1219427. [Google Scholar] [CrossRef] [Scilit]
  428. Chinnadurai, R.K.; Khan, N.; Meghwanshi, G.K.; Ponne, S.; Althobiti, M.; Kumar, R. Current research status of anti-cancer peptides: Mechanism of action, production, and clinical applications. Biomed. Pharmacother. 2023, 164, 114996. [Google Scholar] [CrossRef] [Scilit]
  429. Zare-Zardini, H.; Saberian, E.; Jenča, A.; Ghanipour-Meybodi, R.; Jenča, A.; Petrášová, A.; Jenčová, J. From defense to offense: Antimicrobial peptides as promising therapeutics for cancer. Front. Oncol. 2024, 14, 1463088. [Google Scholar] [CrossRef] [Scilit]
  430. Tornesello, A.L.; Borrelli, A.; Buonaguro, L.; Buonaguro, F.M.; Tornesello, M.L. Antimicrobial Peptides as Anticancer Agents: Functional Properties and Biological Activities. Molecules 2020, 25, 2850. [Google Scholar] [CrossRef] [Scilit]
  431. Hoskin, D.W.; Ramamoorthy, A. Studies on anticancer activities of antimicrobial peptides. Biochim. Biophys. Acta 2008, 1778, 357–375. [Google Scholar] [CrossRef] [Scilit]
  432. Gaspar, D.; Veiga, A.S.; Castanho, M.A.R.B. From antimicrobial to anticancer peptides. A review. Front. Microbiol. 2013, 4, 294. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  433. Dennison, S.R.; Harris, F.; Bhatt, T.; Singh, J.; Phoenix, D.A. A theoretical analysis of secondary structural characteristics of anticancer peptides. Mol. Cell. Biochem. 2010, 333, 129–135. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  434. Castro Monzon, F.; Rödel, M.-O.; Jeschke, J.M. Tracking Batrachochytrium dendrobatidis Infection Across the Globe. EcoHealth 2020, 17, 270–279. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  435. Rahman, M.; Badhon, M.K.; Salauddin, M.; Rabbe, M.F.; Isslam, M.S. Chytrid infection in Asia: How much do we know and what else do we need to know? Herpetol. J. 2020, 30, 99–111. [Google Scholar] [CrossRef] [Scilit]
  436. Fisher, M.C.; Garner, T.W.J. Chytrid fungi and global amphibian declines. Nat. Rev. Microbiol. 2020, 18, 332–343. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  437. Goka, K.; Yokoyama, J.; Tominaga, A. Distribution and Genetic Diversity of the Amphibian Chytrid in Japan. J. Fungi 2021, 7, 522. [Google Scholar] [CrossRef] [Scilit]
  438. Mangoni, M.L.; McDermott, A.M.; Zasloff, M. Antimicrobial peptides and wound healing: Biological and therapeutic considerations. Exp. Dermatol. 2016, 25, 167–173. [Google Scholar] [CrossRef] [Scilit]
  439. van Harten, R.M.; van Woudenbergh, E.; van Dijk, A.; Haagsman, H.P. Cathelicidins: Immunomodulatory Antimicrobials. Vaccines 2018, 6, 63. [Google Scholar] [CrossRef] [Scilit]
  440. Exner, M.; Bhattacharya, S.; Christiansen, B.; Gebel, J.; Goroncy-Bermes, P.; Hartemann, P.; Heeg, P.; Ilschner, C.; Kramer, A.; Larson, E.; et al. Antibiotic resistance: What is so special about multidrug-resistant Gram-negative bacteria? GMS Hyg. Infect. Control 2017, 12, Doc05. [Google Scholar] [CrossRef] [Scilit]
  441. Karakonstantis, S.; Kritsotakis, E.I.; Gikas, A. Pandrug-resistant Gram-negative bacteria: A systematic review of current epidemiology, prognosis and treatment options. J. Antimicrob. Chemother. 2019, 75, 271–282. [Google Scholar] [CrossRef] [Scilit]
  442. Moradali, M.F.; Ghods, S.; Rehm, B.H.A. Pseudomonas aeruginosa Lifestyle: A Paradigm for Adaptation, Survival, and Persistence. Front. Cell. Infect. Microbiol. 2017, 7, 39. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  443. Faure, E.; Kwong, K.; Nguyen, D. Pseudomonas aeruginosa in Chronic Lung Infections: How to Adapt Within the Host? Front. Immunol. 2018, 9, 2416. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  444. Moskowitz, S.M.; Ernst, R.K. The role of Pseudomonas lipopolysaccharide in cystic fibrosis airway infection. Subcell. Biochem. 2010, 53, 241–253. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  445. Ernst, R.K.; Moskowitz, S.M.; Emerson, J.C.; Kraig, G.M.; Adams, K.N.; Harvey, M.D.; Ramsey, B.; Speert, D.P.; Burns, J.L.; Miller, S.I. Unique Lipid A Modifications in Pseudomonas aeruginosa Isolated from the Airways of Patients with Cystic Fibrosis. J. Infect. Dis. 2007, 196, 1088–1092. [Google Scholar] [CrossRef] [Scilit]
  446. Sathe, N.; Beech, P.; Croft, L.; Suphioglu, C.; Kapat, A.; Athan, E. Pseudomonas aeruginosa: Infections and novel approaches to treatment “Knowing the enemy” the threat of Pseudomonas aeruginosa and exploring novel approaches to treatment. Infect. Med. 2023, 2, 178–194. [Google Scholar] [CrossRef] [Scilit]
  447. Reynolds, D.; Kollef, M. The Epidemiology and Pathogenesis and Treatment of Pseudomonas aeruginosa Infections: An Update. Drugs 2021, 81, 2117–2131. [Google Scholar] [CrossRef] [Scilit]
  448. Dubovskii, P.V.; Vassilevski, A.A.; Samsonova, O.V.; Egorova, N.S.; Kozlov, S.A.; Feofanov, A.V.; Arseniev, A.S.; Grishin, E.V. Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin. FEBS J. 2011, 278, 4382–4393. [Google Scholar] [CrossRef] [Scilit]
  449. Tang, T.; Li, X.; Yang, X.; Yu, X.; Wang, J.; Liu, F.; Huang, D. Transcriptional Response of Musca domestica Larvae to Bacterial Infection. PLoS ONE 2014, 9, e104867. [Google Scholar] [CrossRef] [Scilit]
  450. Viejo-Díaz, M.; Andrés, M.T.; Fierro, J.F. Different anti-Candida activities of two human lactoferrin-derived peptides, Lfpep and kaliocin-1. Antimicrob. Agents Chemother. 2005, 49, 2583–2588. [Google Scholar] [CrossRef] [Scilit]
  451. Yount, N.Y.; Andrés, M.T.; Fierro, J.F.; Yeaman, M.R. The gamma-core motif correlates with antimicrobial activity in cysteine-containing kaliocin-1 originating from transferrins. Biochim. Biophys. Acta 2007, 1768, 2862–2872. [Google Scholar] [CrossRef] [Scilit]
  452. Kuo, S.-H.; Shen, C.-J.; Shen, C.-F.; Cheng, C.-M. Role of pH Value in Clinically Relevant Diagnosis. Diagnostics 2020, 10, 107. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  453. Wallace, L.A.; Gwynne, L.; Jenkins, T. Challenges and opportunities of pH in chronic wounds. Ther. Deliv. 2019, 10, 719–735. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  454. Surber, C.; Abels, C.; Maibach, H. pH of the Skin: Issues and Challenges Current Problems; Karger: Basel, Switzerland, 2018. [Google Scholar]
  455. Xiong, S.; Liu, X.; Deng, W.; Zhou, Z.; Li, Y.; Tu, Y.; Chen, L.; Wang, G.; Fu, B. Pharmacological Interventions for Bacterial Prostatitis. Front. Pharmacol. 2020, 11, 504. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  456. Bono, M.J.; Reygaert, W.C. Urinary Tract Infection. In StatPearls; StatPearls Publishing Copyright © 2020; StatPearls Publishing LLC.: Treasure Island, FL, USA, 2020. [Google Scholar]
  457. Rawat, S. Food Spoilage: Microorganisms and their prevention. Asian J. Plant Sciience Res. 2015, 5, 47–56. [Google Scholar]
  458. Goldfeder, Y.; Zaknoon, F.; Mor, A. Experimental conditions that enhance potency of an antibacterial oligo-acyl-lysyl. Antimicrob. Agents Chemother. 2010, 54, 2590–2595. [Google Scholar] [CrossRef] [Scilit]
  459. Gottschalk, S.; Gottlieb, C.T.; Vestergaard, M.; Hansen, P.R.; Gram, L.; Ingmer, H.; Thomsen, L.E. Amphibian antimicrobial peptide fallaxin analogue FL9 affects virulence gene expression and DNA replication in Staphylococcus aureus. J. Med. Microbiol. 2015, 64, 1504–1513. [Google Scholar] [CrossRef] [Scilit]
  460. Nielsen, S.L.; Frimodt-Møller, N.; Kragelund, B.B.; Hansen, P.R. Structure–activity study of the antibacterial peptide fallaxin. Protein Sci. 2007, 16, 1969–1976. [Google Scholar] [CrossRef] [Scilit]
  461. Sarig, H.; Goldfeder, Y.; Rotem, S.; Mor, A. Mechanisms mediating bactericidal properties and conditions that enhance the potency of a broad-spectrum oligo-acyl-lysyl. Antimicrob. Agents Chemother. 2011, 55, 688–695. [Google Scholar] [CrossRef] [Scilit]
  462. Perez Espitia, P.J.; de Fátima Ferreira Soares, N.; dos Reis Coimbra, J.S.; de Andrade, N.J.; Souza Cruz, R.; Alves Medeiros, E.A. Bioactive Peptides: Synthesis, Properties, and Applications in the Packaging and Preservation of Food. Compr. Rev. Food Sci. Food Saf. 2012, 11, 187–204. [Google Scholar] [CrossRef] [Scilit]
  463. Del Aguila, E.M.; Gomes, L.P.; Freitas, C.S.; Pereira, P.R.; Paschoalin, V.F. Natural Antimicrobials in Food Processing: Bacteriocins, Peptides and Chitooligosaccharides. Front. Anti-Infect. Drug Discov. 2017, 5, 55–108. [Google Scholar]
  464. Kozić, M.; Vukičević, D.; Simunić, J.; Rončević, T.; Antcheva, N.; Tossi, A.; Juretić, D. Predicting the Minimal Inhibitory Concentration for Antimicrobial Peptides with Rana-Box Domain. J. Chem. Inf. Model. 2015, 55, 2275–2287. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  465. Mercer, D.K.; Torres, M.D.T.; Duay, S.S.; Lovie, E.; Simpson, L.; von Köckritz-Blickwede, M.; de la Fuente-Nunez, C.; O’Neil, D.A.; Angeles-Boza, A.M. Antimicrobial Susceptibility Testing of Antimicrobial Peptides to Better Predict Efficacy. Front. Cell. Infect. Microbiol. 2020, 10, 326. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  466. Vences, M.; Köhler, J.; Hutter, C.R.; Preick, M.; Petzold, A.; Rakotoarison, A.; Ratsoavina, F.M.; Glaw, F.; Scherz, M.D. Communicator whistles: A Trek through the taxonomy of the Boophis marojezensis complex reveals seven new, morphologically cryptic treefrogs from Madagascar (Amphibia: Anura: Mantellidae). Vertebr. Zool. 2024, 74, 643–681. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Sequences and homology of AMPs from G. rugosa, G. emeljanovi and G susurra. Figure 1 was derived from [83,85,101]. 1 GSSa of the granuliberin family appears to have resulted from mutations in genes encoding brevinin-1 peptides produced by G. sussura that led to the insertion of a premature stop codon in their cDNA. The full, predicted sequence of GSSa is shown aligned with these brevinin-1 peptides (enclosed in a blue box) and the premature stop codon is indicated by *. Cysteine residues are shown aligned in red boxes and form the disulfide bond of the Rana box motif possessed by the parent peptides. In the case of R2SSa, this C-terminal Rana box motif was formed from six residues and in that of B2SSb, the second cysteine residue of this motif has been substituted by serine and an extra seven residues added to the sequence.
Figure 1. Sequences and homology of AMPs from G. rugosa, G. emeljanovi and G susurra. Figure 1 was derived from [83,85,101]. 1 GSSa of the granuliberin family appears to have resulted from mutations in genes encoding brevinin-1 peptides produced by G. sussura that led to the insertion of a premature stop codon in their cDNA. The full, predicted sequence of GSSa is shown aligned with these brevinin-1 peptides (enclosed in a blue box) and the premature stop codon is indicated by *. Cysteine residues are shown aligned in red boxes and form the disulfide bond of the Rana box motif possessed by the parent peptides. In the case of R2SSa, this C-terminal Rana box motif was formed from six residues and in that of B2SSb, the second cysteine residue of this motif has been substituted by serine and an extra seven residues added to the sequence.
Biologics 04 00027 g001
Figure 2. The potential of B1EMa (FLGALFKVASKVLPSVKCAITKKC) and B1EMb (FLPLLAGLAANFLPTIICKISYKC) to form tilted, amphiphilic α-helical structure. The potential of B1EMa (1–13) and B1EMb (1–13) to form tilted α-helical structure was determined using extended hydrophobic moment methodology, as previously described [33]. Essentially, this a statistically based methodology based on the amphiphilicity (<µH>) and hydrophobicity (<H>) of α-helical AMPs, as defined in Section 1. In (A), this analysis yielded values of <µH> = 0.52 and <H> = 0.36 for B1EMa (1–13) and <µH> = 0.26 and <H> = 0.65 for B1EMb (1–13). These values of <µH> and <H> were then plotted on the extended hydrophobic moment plot diagram, which showed that the data points representing both peptides lay in the shaded area, indicating candidacy to form tilted segments. In (B,C), the potential of B1EMa (1–13) and B1EMb (1–13) to form a hydrophobicity gradient, which is characteristic of tilted α-helical architecture, was visualized by amphiphilic profiling, which essentially plots <µH> along a peptide’s sequence, as previously described [262]. In both cases, these peptides possessed putative hydrophobicity gradients that extended from residue 4 to residue 13 and increased in the N→ C direction. (AC) also shows that, in comparison to B1EMb (1–13), B1EMa (1–13) is much more amphiphilic (<µH> = 0.52 versus <µH> = 0.26) and far less hydrophobic (<H> = 0.36 versus <H> = 0.65). These structural differences are reflected by the fact that the hydrophobicity gradient of B1EMa (1–13) (B) possesses lower overall hydrophobicity than that of B1EMb (1–13) (C). In (D,E), B1EMa and B1EMb were modeled as a two-dimensional axial projection using the software at [263]. These analyses revealed that both peptides formed amphiphilic α-helices with hydrophobic face of circa 200° and 220°, respectively, that primarily comprised the apolar residues alanine, phenylaniline, valine, leucine and isoleucine (yellow circles). These α-helices also possessed hydrophilic face of circa 160° and 140°, respectively, that was predominantly formed from charged residues, including lysine (blue circles); polar residues, including serine and threonine (purple circles); and uncharged residues, including glycine (grey circles) and proline (green circles).
Figure 2. The potential of B1EMa (FLGALFKVASKVLPSVKCAITKKC) and B1EMb (FLPLLAGLAANFLPTIICKISYKC) to form tilted, amphiphilic α-helical structure. The potential of B1EMa (1–13) and B1EMb (1–13) to form tilted α-helical structure was determined using extended hydrophobic moment methodology, as previously described [33]. Essentially, this a statistically based methodology based on the amphiphilicity (<µH>) and hydrophobicity (<H>) of α-helical AMPs, as defined in Section 1. In (A), this analysis yielded values of <µH> = 0.52 and <H> = 0.36 for B1EMa (1–13) and <µH> = 0.26 and <H> = 0.65 for B1EMb (1–13). These values of <µH> and <H> were then plotted on the extended hydrophobic moment plot diagram, which showed that the data points representing both peptides lay in the shaded area, indicating candidacy to form tilted segments. In (B,C), the potential of B1EMa (1–13) and B1EMb (1–13) to form a hydrophobicity gradient, which is characteristic of tilted α-helical architecture, was visualized by amphiphilic profiling, which essentially plots <µH> along a peptide’s sequence, as previously described [262]. In both cases, these peptides possessed putative hydrophobicity gradients that extended from residue 4 to residue 13 and increased in the N→ C direction. (AC) also shows that, in comparison to B1EMb (1–13), B1EMa (1–13) is much more amphiphilic (<µH> = 0.52 versus <µH> = 0.26) and far less hydrophobic (<H> = 0.36 versus <H> = 0.65). These structural differences are reflected by the fact that the hydrophobicity gradient of B1EMa (1–13) (B) possesses lower overall hydrophobicity than that of B1EMb (1–13) (C). In (D,E), B1EMa and B1EMb were modeled as a two-dimensional axial projection using the software at [263]. These analyses revealed that both peptides formed amphiphilic α-helices with hydrophobic face of circa 200° and 220°, respectively, that primarily comprised the apolar residues alanine, phenylaniline, valine, leucine and isoleucine (yellow circles). These α-helices also possessed hydrophilic face of circa 160° and 140°, respectively, that was predominantly formed from charged residues, including lysine (blue circles); polar residues, including serine and threonine (purple circles); and uncharged residues, including glycine (grey circles) and proline (green circles).
Biologics 04 00027 g002
Figure 3. The membrane orientation of B1EMa from G. emeljanovi. Figure 3 was revised from [86] and shows that B1EMa (FLGALFKVASKVLPSVKCAITKKC) forms a continuous amphiphilic α-helix (Figure 2), with a curvature of circa 25°, primarily due to the presence of a proline residue at position 14 of the peptide. This amphiphilic α-helix possesses lysine and other hydrophilic residues located on its convex face and hydrophobic residues such as valine, alanine and isoleucine situated on its concave face. The lysine residues possessed by B1EMa, at sequence positions, 7, 11, 22 and 23, would allow the convex, hydrophilic face of the peptide to associate with the lipid head group region (Figure 2) and it is well established that these residues are able to promote the membrane partitioning of AMPs via the snorkeling mechanism, as described in the text [98,245]. In this membrane orientation, B1EMa (15–24) is partitioned parallel to the bilayer surface, which anchors and stabilizes the oblique insertion of B1EMa (1–13) such that its hydrophobic face penetrates the acyl chain region of the membrane at an angle of circa 45° (Figure 3) [242]. This mode of oblique membrane insertion would be consistent with the use of tilted structure and B1EMa (1–13) was predicted to form a hydrophobicity gradient that extended from residue 4 to residue 13 and increased in the N→ C direction (Figure 2). This may be particularly relevant to lysine residues at sequence positions 7 and 11, which lie in B1EMa (15–24) at the surface-associated end of the putative tilted α-helix formed by B1EMa (1–13) (Figure 1 and Figure 2); snorkeling by similarly located lysine residues has been shown to promote the oblique insertion of a number of other amphibian AMPs with tilted characteristics [241,247]. It has been predicted that B1EMb from G. emeljanovi will utilize a similar mode of membrane interaction.
Figure 3. The membrane orientation of B1EMa from G. emeljanovi. Figure 3 was revised from [86] and shows that B1EMa (FLGALFKVASKVLPSVKCAITKKC) forms a continuous amphiphilic α-helix (Figure 2), with a curvature of circa 25°, primarily due to the presence of a proline residue at position 14 of the peptide. This amphiphilic α-helix possesses lysine and other hydrophilic residues located on its convex face and hydrophobic residues such as valine, alanine and isoleucine situated on its concave face. The lysine residues possessed by B1EMa, at sequence positions, 7, 11, 22 and 23, would allow the convex, hydrophilic face of the peptide to associate with the lipid head group region (Figure 2) and it is well established that these residues are able to promote the membrane partitioning of AMPs via the snorkeling mechanism, as described in the text [98,245]. In this membrane orientation, B1EMa (15–24) is partitioned parallel to the bilayer surface, which anchors and stabilizes the oblique insertion of B1EMa (1–13) such that its hydrophobic face penetrates the acyl chain region of the membrane at an angle of circa 45° (Figure 3) [242]. This mode of oblique membrane insertion would be consistent with the use of tilted structure and B1EMa (1–13) was predicted to form a hydrophobicity gradient that extended from residue 4 to residue 13 and increased in the N→ C direction (Figure 2). This may be particularly relevant to lysine residues at sequence positions 7 and 11, which lie in B1EMa (15–24) at the surface-associated end of the putative tilted α-helix formed by B1EMa (1–13) (Figure 1 and Figure 2); snorkeling by similarly located lysine residues has been shown to promote the oblique insertion of a number of other amphibian AMPs with tilted characteristics [241,247]. It has been predicted that B1EMb from G. emeljanovi will utilize a similar mode of membrane interaction.
Biologics 04 00027 g003
Figure 4. The potential of E2EM-lin (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC), which is E2EM with no disulfide bond, to form tilted, amphiphilic α-helical structure. The potential of E2EM-lin (1–23) and E2EM-lin (25–37) to form tilted α-helical structure was determined using extended hydrophobic moment plot methodology, as previously described [33]. Essentially, this a statistically based methodology based on the amphiphilicity (<µH>) and hydrophobicity (<H>) of α-helical AMPs, as defined in Section 1. In (A), this analysis yielded values of <µH> = 0.67 and <H> = 0.09 for E2EM-lin (1–23), and <µH> = 0.43 and <H> = 0.06 for E2EM-lin (25–37). These values of <µH> and <H> were then plotted on the extended hydrophobic moment plot diagram, which showed that the data points representing both peptides lay in the shaded area, indicating candidacy to form tilted segments. In (B), the potential of E2EM-lin to form a hydrophobicity gradient, which is characteristic of tilted α-helical architecture, was visualized by amphiphilic profiling, which essentially plots < µH > along a peptide’s sequence, as previously described [262]. E2EM-lin (1–23) possessed a putative hydrophobicity gradient that extended from residue 10 to residue 23 and increased in the C→ N direction (B). In contrast, E2EM-lin (25–37) formed no discernable hydrophobicity gradient, which suggested that this region does not form tilted structure (B). In (C,D), E2EM-lin (1–23) and E2EM-lin (25–37) were modeled as a two-dimensional axial projection using the software at [263]. These analyses revealed that E2EM-lin (1–23) formed an amphiphilic α-helix with a hydrophobic face of circa 140°, primarily comprised of the apolar residues phenylaniline, valine and leucine (yellow circles). This α-helix also possessed a hydrophilic face of circa 220° that was predominantly formed from charged residues, including lysine (blue circles) and aspartic acid (red circles), and uncharged residues, including glycine (grey circles) and glutamine (mauve circles) (C). E2EM-lin (25–37) formed an amphiphilic α-helix with an apolar face of circa 200°, primarily comprised of the apolar residues alanine, valine and leucine (yellow circles). This α-helix also possessed a hydrophilic face of circa 160° that was predominantly formed from charged residues, including lysine (blue circles) and uncharged residues, including serine and threonine (purple circles) (D).
Figure 4. The potential of E2EM-lin (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC), which is E2EM with no disulfide bond, to form tilted, amphiphilic α-helical structure. The potential of E2EM-lin (1–23) and E2EM-lin (25–37) to form tilted α-helical structure was determined using extended hydrophobic moment plot methodology, as previously described [33]. Essentially, this a statistically based methodology based on the amphiphilicity (<µH>) and hydrophobicity (<H>) of α-helical AMPs, as defined in Section 1. In (A), this analysis yielded values of <µH> = 0.67 and <H> = 0.09 for E2EM-lin (1–23), and <µH> = 0.43 and <H> = 0.06 for E2EM-lin (25–37). These values of <µH> and <H> were then plotted on the extended hydrophobic moment plot diagram, which showed that the data points representing both peptides lay in the shaded area, indicating candidacy to form tilted segments. In (B), the potential of E2EM-lin to form a hydrophobicity gradient, which is characteristic of tilted α-helical architecture, was visualized by amphiphilic profiling, which essentially plots < µH > along a peptide’s sequence, as previously described [262]. E2EM-lin (1–23) possessed a putative hydrophobicity gradient that extended from residue 10 to residue 23 and increased in the C→ N direction (B). In contrast, E2EM-lin (25–37) formed no discernable hydrophobicity gradient, which suggested that this region does not form tilted structure (B). In (C,D), E2EM-lin (1–23) and E2EM-lin (25–37) were modeled as a two-dimensional axial projection using the software at [263]. These analyses revealed that E2EM-lin (1–23) formed an amphiphilic α-helix with a hydrophobic face of circa 140°, primarily comprised of the apolar residues phenylaniline, valine and leucine (yellow circles). This α-helix also possessed a hydrophilic face of circa 220° that was predominantly formed from charged residues, including lysine (blue circles) and aspartic acid (red circles), and uncharged residues, including glycine (grey circles) and glutamine (mauve circles) (C). E2EM-lin (25–37) formed an amphiphilic α-helix with an apolar face of circa 200°, primarily comprised of the apolar residues alanine, valine and leucine (yellow circles). This α-helix also possessed a hydrophilic face of circa 160° that was predominantly formed from charged residues, including lysine (blue circles) and uncharged residues, including serine and threonine (purple circles) (D).
Biologics 04 00027 g004
Figure 5. A model for the pH-dependent, antibacterial action of E2EM/E2EM-lin (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC). Figure 5 was revised from [86,299,300] and shows a schematic representation of the pH-dependent antimicrobial action proposed for E2EM/E2EM-lin. Initially, the unstructured peptide (A) interacts with the bacterial membrane surface and forms α-helical structure (represented as cylinders) with a hydrophobic surface (red) and a hydrophilic surface (blue) (B). The α-helical structure formed by E2EM/E2EM-lin (1–23) is driven by the presence of bacterial lipids and possesses a hydrophobicity gradient (B). The levels of this structure are enhanced by increasing pH (C), which then promotes pore formation by E2EM/E2EM-lin via membrane insertion and the adoption of a transmembrane orientation, which is stabilized by the surface interactions of E2EM/E2EM-lin (25–37) (D,E). Potentially, E2EM/E2EM-lin can form a toroidal pore (D) or a barrel stave pore (E) and the major difference between these pore types is that in the former pore, the membrane leaflets deform to allow the lipid head-group region to remain in contact with the hydrophilic face of the E2EM/E2EM-lin membrane spanning region, which is not observed in the latter pore [42]. In both cases, increasing pH promotes higher levels of pore formation and membranolysis, which are maximal under alkaline conditions and lead to microbial cell death (D,E); for clarity, two monomers of E2EM/E2EM-lin are shown in this pore-forming process, but it has been predicted that between five and ten monomers are involved [290].
Figure 5. A model for the pH-dependent, antibacterial action of E2EM/E2EM-lin (GILDTLQAFAKGVGKDLVKGAAQGVLSTVSCKLAKTC). Figure 5 was revised from [86,299,300] and shows a schematic representation of the pH-dependent antimicrobial action proposed for E2EM/E2EM-lin. Initially, the unstructured peptide (A) interacts with the bacterial membrane surface and forms α-helical structure (represented as cylinders) with a hydrophobic surface (red) and a hydrophilic surface (blue) (B). The α-helical structure formed by E2EM/E2EM-lin (1–23) is driven by the presence of bacterial lipids and possesses a hydrophobicity gradient (B). The levels of this structure are enhanced by increasing pH (C), which then promotes pore formation by E2EM/E2EM-lin via membrane insertion and the adoption of a transmembrane orientation, which is stabilized by the surface interactions of E2EM/E2EM-lin (25–37) (D,E). Potentially, E2EM/E2EM-lin can form a toroidal pore (D) or a barrel stave pore (E) and the major difference between these pore types is that in the former pore, the membrane leaflets deform to allow the lipid head-group region to remain in contact with the hydrophilic face of the E2EM/E2EM-lin membrane spanning region, which is not observed in the latter pore [42]. In both cases, increasing pH promotes higher levels of pore formation and membranolysis, which are maximal under alkaline conditions and lead to microbial cell death (D,E); for clarity, two monomers of E2EM/E2EM-lin are shown in this pore-forming process, but it has been predicted that between five and ten monomers are involved [290].
Biologics 04 00027 g005
Figure 6. The stapling of AMPs from G. emeljanovi. Figure 6 was derived from [199] and shows a schematic representation of the residue stapling involved in the generation of peptide B-5S and peptide B-sub5S from peptide B, which is derived from B1EMa. (A) shows the sequences of peptide B-5S (FLGWLFKVASKVL-NH2) and peptide B-sub5S (FLRDLWKVASKVL-NH2) where the two black dots connected by a bold line represent residues that are cross-linked via an oct-4-enyl staple. (B) schematically illustrates this stapling for peptide B-5S and peptide B-sub5S when in an α-helical conformation and shows that residues linked by oct-4-enyl staples in (A) are located at positions i and i + 4 of these conformations. Similar stapling arrangements were used in the generation of E2EM15W-S1, E2EM15W-S2 and E2EM15W-S3 from 23D16W, which is derived from E2EM [327].
Figure 6. The stapling of AMPs from G. emeljanovi. Figure 6 was derived from [199] and shows a schematic representation of the residue stapling involved in the generation of peptide B-5S and peptide B-sub5S from peptide B, which is derived from B1EMa. (A) shows the sequences of peptide B-5S (FLGWLFKVASKVL-NH2) and peptide B-sub5S (FLRDLWKVASKVL-NH2) where the two black dots connected by a bold line represent residues that are cross-linked via an oct-4-enyl staple. (B) schematically illustrates this stapling for peptide B-5S and peptide B-sub5S when in an α-helical conformation and shows that residues linked by oct-4-enyl staples in (A) are located at positions i and i + 4 of these conformations. Similar stapling arrangements were used in the generation of E2EM15W-S1, E2EM15W-S2 and E2EM15W-S3 from 23D16W, which is derived from E2EM [327].
Biologics 04 00027 g006
Table 1. Antimicrobial and hemolytic activity of AMPs from G. rugosa and G. emeljanovi.
Table 1. Antimicrobial and hemolytic activity of AMPs from G. rugosa and G. emeljanovi.
BacteriaB2RaB2RbB2EMaB2EMbB2EMb’
MIC (µM)
S. aureus1.81.8NDNDND
M. luteus7.20.51.40.80.8
S. epidermidisNDND14.03.03.0
B. subtilis3.61.814.03.03.0
S. pyogenes14.43.6NDNDND
K. pneumoniaeNDND28.07.57.6
S. dysenteriaeNDND7.07.57.6
P. putidaNDND28.015.015.2
P. aeruginosa>28.028.828.015.015.2
E. coli28.83.67.022.522.8
P. mirabilisNDND>56.0>60.0>60.0
S. marcescensNDND>56.0>60.0>60.0
S. typhimuriumNDND>56.045.045.6
FungiMIC (µM)
C. albicansNDND>56.045.0>60.0
S. cerevisiaeNDND>28.022.5>60.0
HemolysisMaximal levels (%)
Human erythrocytesNDND<1.5<1.5<1.5
Table 1 was compiled from [83,85] and shows the minimum inhibitory concentration (MIC, µM) of B2Ra (GLLNTFKDWAISIAKGAGKGVLTTLSCKLDKSC) and B2Rb (SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC) from G. rugosa, and B2EMa (SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC), B2EMb (GIMSIVKDVAKNAAKEAAKGALSTLSCKLAKTC) and B2EMb’ (GIMSIVKDVAKTAAKEAAKGALSTLSCKLAKTC) from G. emeljanovi, against a series of bacteria and fungi. Also shown is the activity of these peptides against human erythrocytes as the maximal % hemolysis achieved. ND denotes ‘not determined’.
Table 2. Antimicrobial activity of AMPs from G. susurra.
Table 2. Antimicrobial activity of AMPs from G. susurra.
BacteriaB2SSbR2SSaGSSa
MIC (µM)
S. aureus>30.0>44.0>86.0
B. cereus>30.0>44.0>86.0
C. michiganensis3.844.03.8
P. aeruginosa30.0>44.0>86.0
E. coli30.0>44.0>86.0
S. enterica30.0>44.0>86.0
X. oryzae0.9>44.0>43.0
FungiMIC (µM)
C. albicans30.030.030.0
P. oryzae30.0>44.030.0
Table 2 was compiled from [101] and shows the minimum inhibitory concentration (MIC, µM) of B2SSb (SFLSLIKAGAKFLGKNMLKQGAQYAACKVSKDSENVNWKS), R2SSa (GLISTIWNTASNVAGTLTDSVKCKFKKC) and GSSa (FIFLPIFRRPVS-NH2) from G. susurra against a series of bacteria and fungi.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Harris, F.; Phoenix, D.A.; Dennison, S.R. Antimicrobial Peptides from Frogs of the Glandirana Genus. Biologics 2024, 4, 444-507. https://doi.org/10.3390/biologics4040027

AMA Style

Harris F, Phoenix DA, Dennison SR. Antimicrobial Peptides from Frogs of the Glandirana Genus. Biologics. 2024; 4(4):444-507. https://doi.org/10.3390/biologics4040027

Chicago/Turabian Style

Harris, Frederick, David A. Phoenix, and Sarah R. Dennison. 2024. "Antimicrobial Peptides from Frogs of the Glandirana Genus" Biologics 4, no. 4: 444-507. https://doi.org/10.3390/biologics4040027

APA Style

Harris, F., Phoenix, D. A., & Dennison, S. R. (2024). Antimicrobial Peptides from Frogs of the Glandirana Genus. Biologics, 4(4), 444-507. https://doi.org/10.3390/biologics4040027

Article Metrics

Back to TopTop