Next Article in Journal
Boosted Antioxidant Effect Using a Combinatory Approach with Essential Oils from Origanum compactum, Origanum majorana, Thymus serpyllum, Mentha spicata, Myrtus communis, and Artemisia herba-alba: Mixture Design Optimization
Previous Article in Journal
Genetic and Molecular Characterization of a Self-Compatible Brassica rapa Line Possessing a New Class II S Haplotype
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Genome-Wide Identification and Characterization of Caffeic Acid O-Methyltransferase Gene Family in Soybean

1
College of Life Science, Northeast Forestry University, Harbin 150040, China
2
Key Laboratory of Saline-Alkali Vegetation Ecology Restoration, Ministry of Education, College of Life Science, Northeast Forestry University, Harbin 150040, China
3
State Key Laboratory of Tree Genetics and Breeding, Northeast Forestry University, Harbin 150040, China
*
Authors to whom correspondence should be addressed.
Plants 2021, 10(12), 2816; https://doi.org/10.3390/plants10122816
Submission received: 20 November 2021 / Revised: 17 December 2021 / Accepted: 17 December 2021 / Published: 20 December 2021

Abstract

Soybean is one of the most important legumes, providing high-quality protein for humans. The caffeic acid O-methyltransferase (COMT) gene has previously been demonstrated to be a critical gene that regulates lignin production in plant cell walls and plays an important function in plant growth and development. However, the COMT gene family has not been studied in soybeans. In this study, 55 COMT family genes in soybean were identified by phylogenetic analysis and divided into two groups, I and II. The analysis of conserved domains showed that all GmCOMTs genes contained Methyltransferase-2 domains. Further prediction of cis-acting elements showed that GmCOMTs genes were associated with growth, light, stress, and hormonal responses. Eventually, based on the genomic data of soybean under different stresses, the results showed that the expression of GmCOMTs genes was different under different stresses, such as salt and drought stress. This study has identified and characterized the COMT gene family in soybean, which provides an important theoretical basis for further research on the biological functions of COMT genes and promotes revealing the role of GmCOMTs genes under stress resistance.

1. Introduction

Soybean is one of the world’s most significant annual leguminous plants, capable of providing humans with high-quality plant protein and oil [1]. As an important economic and food crop, soybean has high nutritional value and a wide range of uses, which profoundly impact the survival and development of mankind [2]. However, soybean lodging and biological or abiotic stress are important factors affecting soybean yield [3]. As a result, increasing soybean lodging and stress resistance is critical for producing high-yielding, stable-yielding, and high-quality cultivars.
A cell wall is a thick wall that exists on the exterior of cells. It plays an important role in the growth and development of plants, such as preserving the shape of cells, enhancing the mechanical strength of cells, and participating in the transmission of information between cells [4]. The cell wall is mainly composed of polysaccharides, proteins, and lignin [5]. Its components enable the plants to respond to biological or abiotic stresses and resist the invasion of pathogens in the first place [6].
Lignin is an indispensable component of cell walls for some higher plants and is the second most abundant biopolymer [7], which can provide mechanical support for plants and facilitate the transportation of water in the whole plant tissue [8]. It is an effective barrier against insects, pathogens, and fungi to plant disease resistance [9], enhancing the lodging resistance of plants [10], which is also involved in plant response to stress [11]. The studies had shown that the mechanical strength of soybean stems was a crucial factor in improving lodging resistance, and lignin had a significant effect on maintaining the mechanical strength of the stems [12]. Wheat cultivars with greater lignin content were also shown to have improved lodging resistance [13]. As a result, lignin plays an essential role in increasing soybean lodging resistance.
The current consensus on the lignin biosynthesis pathway is that it begins with phenylalanine and proceeds via a series of hydroxylation, methylation, ligation, and reduction reactions to produce lignin units [14]. These units are subsequently transferred to the lignification deposition sites, aggregated to form lignin in the secondary cell wall [15]. Lignin is mainly divided into three phenylpropanoid units, including the lignin monomer sinapyl alcohol (S), p-coumarol (H), and coniferyl alcohol (G) [16]. In previous studies, gymnosperms mainly contained H-type and G-type lignins, while angiosperms mainly contained S-type lignin and G-type lignin [17]. In the lignin biosynthesis pathway, the caffeic acid methyltransferase (COMT) gene is one of the key genes regulating lignin synthesis. It is primarily involved in the synthesis of S-type lignin [18]. It can be used to catalyze the methylation of caffeic acid, 5-hydroxyconiferaldehyde, and 5-hydroxyconiferyl alcohol to generate ferulic acid, sinusaldehyde, and sinapyl alcohol, respectively [19]. Analysis of gene structure and conserved domains showed that all COMTs have a c-terminal catalytic domain named Methyltrans-2, including a SAM/SAH binding pocket and a substrate binding site. Some of them show a common structure, the N-terminal domain, called dimerization [20]. The dimerization domain of LBD has been proposed, forming a helical structure, presenting a hydrophobic surface, which is formed by nine repeating heptapeptide motifs, containing hydrophobic residues at positions one and eight, and hydrophobic or charged amino acids with hydrophobic side chains at position five. Receptor monomer dimerization is a prerequisite for transcriptional activation and effective DNA binding of most nuclear receptors so far [21].
Previous studies have shown that dispersed duplication (DSD) and whole-genome duplication (WGD) are the main driving forces for the evolution of blueberry COMTs. In addition, the COMT of kiwi fruit has undergone two rounds of WGD [22]. In 1991, the COMT genes were cloned and described for the first time from Ligusticum chuanqiong rhizomes [23]. In the same year, the COMT gene was first identified as a gene family in Populus tremuloides [24]. It was later discovered that the COMT family is composed of multiple members. For example, the COMT gene family of Eucalyptus grandis has 7 EgrCOMTs genes [25]; the COMT gene family contains 23 members in Catalpa bungei [26]; there are 92 members in blueberries [20]; there are 25 COMTs genes in Populus trichocarpa [27]; there are 25 COMTs genes in Brassic rapa L. [28], and there are 25 COMTs genes in Betula pendula [29]. In this way, the function of the COMT gene family was gradually being elucidated. For instance, the COMT gene is highest expressed in the stems of the spray cut chrysanthemum, which is related to the rigidity of the pedicel [30]. The lignin concentration of Brassica napus was considerably decreased after COMT gene expression was inhibited, but the seed oil content and quality were unaffected [31]. It can be seen that the COMT gene plays an important regulatory role in the process of plant lignin synthesis. Furthermore, the COMT genes were shown to be involved in the biosynthesis of melatonin, which might improve the salt tolerance of Arabidopsis thaliana [32]. In short, COMT family members play an important regulatory role in plant lignin synthesis and have great potential in lodging and stress resistance.
The COMT gene’s well-established function provides a strong framework for our study, but a more comprehensive genome-wide investigation of the COMT gene family in soybean has yet to be completed. In this study, the COMT gene family in the soybean genome was analyzed at the genome-wide level, and a total of 55 COMT genes were identified. Then, we investigated the phylogenetic relationship, gene structure, protein motifs and domains, and chromosomal location of these GmCOMTs genes, and the cis-acting elements in the promoter region of the COMT genes. Moreover, the tissue specificity of GmCOMTs gene expression and its expression under different stresses were also explored. The research results will help explore the biological functions of the COMT gene family in soybean and further improve soybean yield and quality.

2. Results

2.1. Identification of COMT Gene Family in Soybean

To find all possible members of the COMT gene family in soybean, the known Arabidopsis COMT protein sequences were used as query sequences in a BlastP search against the soybean genome database. Finally, 55 COMT genes were identified, which were named as GmCOMT1~GmCOMT55, respectively. The COMT genes length, amino acid sequence of genes, genomic sequence, transcript sequence, and genomic location were also determined (Table S1). The coding sequence length of the 55 GmCOMTs identified varied from 330 bp (GmCOMT30) to 1149 bp (GmCOMT24), the genomic sequence length ranges from 933 bp (GmCOMT19) to 9540 bp (GmCOMT7), and the transcript sequence length ranges from 330 bp (GmCOMT30) to 3295 bp (GmCOMT34). The length of encoded protein varies between 109 and 382 amino acids. Furthermore, the molecular weight of 55 GmCOMTs was between 12,721.95 and 42,846.58, and the highest molecular weight protein was GmCOMT24; the smallest molecular weight is GmCOMT30. The predicted isoelectric points range from 4.85 (GmCOMT21) to 9.07 (GmCOMT28) (Table S1).

2.2. Phylogenetic Analysis of the COMT Gene Family in Soybean

The phylogenetic tree was constructed using the full-length protein sequences of 55 Glycine max COMTs, 14 Arabidopsis thaliana COMTs, 17 Solanum lycopersicum COMTs, 48 Oryza sativa COMTs, and 25 Brassic rapa COMTs (Figure 1). The numbers of COMTs genes in S. lycopersicum, A. thaliana, and B. rapa in different groups are shown in Table S2. Our study showed that the COMTs in these four species could be classified into group I and group II. Group I had 35 soybean COMTs and 12 tomato COMTs, whereas group II contained 20 soybean COMTs and 5 tomato COMTs. The COMT proteins of soybean and S. lycopersicum were distributed in both groups, but the COMT proteins of A. thaliana and B. rapa were only distributed in group II. In summary, the phylogenetic tree illustrates COMTs’ evolutionary constancy across species. The analysis of the biological activities of these proteins is made possible by determining the homology connection between species.

2.3. Evolutionary Conservation Analysis of COMTs in Soybean

The phylogenetic tree was constructed with 55 COMT protein sequences of soybean (Figure 2a). Phylogenetic analysis of GmCOMTs shows that 55 GmCOMTs gene sequences can be divided into two groups: group I contains 35 GmCOMT proteins, and the remaining 20 GmCOMT proteins are in group II.
The evolution of numerous gene families is aided by the diversity of gene structure [33]. The obtained gene structure reveals significant variations in the variety of GmCOMTs gene structures (Figure 2b). In GmCOMTs, family of the same group have similar sizes and introns quantities. The majority of the GmCOMTs have 4–7 introns; however, GmCOMT5, GmCOMT19, GmCOMT30, and GmCOMT32 each have just 3 introns, and GmCOMT49 has 8 introns. Furthermore, GmCOMT7 is the longest gene, while GmCOMT19 is the shortest gene, and there are 16 GmCOMTs genes without a complete UTR region.
Next, we utilized the MEME website (http://meme-suite.org/; accessed on 9 July 2021) to predict protein motif and further investigate the structural diversity of GmCOMT proteins [34] (Figure 2c). In the analysis of conservative motifs, a total of 10 conserved motifs in the GmCOMTs proteins were identified, each of which was shown distinct, respectively (motif 1~motif 10). The width, sites, and E-value of conservative motifs in GmCOMTs protein were shown in Table S3. In the evolutionary tree, the two sets of GmCOMTs genes share comparable conserved patterns. However, motifs 3 (IIHNHGQPITLSELVSSLQIPPSKACFVQRLMRFLAHNGFF) were identified solely in group I, as opposed to group II. Most members of the soybean COMT family contain comparable conserved motifs, indicating that their motifs are similar in composition and may have similar biological functions.
Further analysis of the conserved domains of soybean COMTs protein revealed that all 55 GmCOMTs genes contained Methyltransf-2 domains (Figure 2e). In addition, the dimerization domains are distributed in 48 GmCOMTs genes; dimerization 2 domains only exist in GmCOMT46.
Although these 55 GmCOMT genes have little difference in domains, so as to ensure the conservation of their functions, there are obvious differences in gene structure and motifs, and they are divided into two groups, namely group I and group II (Figure 2a).

2.4. Chromosomal Location and Collinearity Analysis of COMT Gene FAMILY in Soybean

The location of GmCOMT among 20 chromosomes was displayed using MapChart software based on the position information of 55 COMT genes in the soybean genome (Figure 3), and the specific position information can be checked in Table S4. The 55 GmCOMTs genes are found on chromosomes 2, 4, 6–15, and 18–20, respectively, with no GmCOMT on the other five chromosomes (1, 3, 5, 16, 17). The number of GmCOMTs genes found on each chromosome ranged from one to seven. Only one gene was found on chromosomes 2 and 19, whereas seven were found on chromosomes 6 and 20. The findings reveal that GmCOMTs genes are not uniformly distributed on soybean chromosomes, with roughly 67% clustered at the bottom of the chromosomes. It is worth mentioning that several GmCOMTs genes that are grouped on the same chromosome are also found in the same phylogenetic tree group. For example, the four genes on chromosome 20 (GmCOMT1, GmCOMT2, GmCOMT4, and GmCOMT34) belong to group I of the phylogenetic tree, while the three genes GmCOMT53, GmCOMT54, and GmCOMT55 belong to group II. This occurrence suggests that the GmCOMTs genes’ aggregated distribution may have comparable molecular functions, and the functional annotations of the GmCOMTs genes in soybean are available in Table S5. The studies on soybean and wild soybean genomes showed that 13 million years ago, the whole genome duplication (WGD) event expanded the soybean genome [35]. During the long-term domestication of soybeans, the redundant genes generated by this WGD event declined. This phenomenon was confirmed by the soybean WGD (Figure S1), in which the collinearity genes in the collinearity region occupies most of the repetitive genes. (Table S6). However, most of the COMT family genes we predicted also belong to this type of doubling (Table S7), which indicated that the redundancy of COMT family genes was accompanied by a genome-wide WGD event.
Eventually, the collinearity of GmCOMTs genes is explored by using MCScanx and TBtools software (Figure 4a). To explore the potential evolution relationship and further compare the COMT gene family collinearity among different species, a comparative analysis between the GmCOMT protein and homologues from the other five representative plants, including Populus trichocarpa, Betula Pendula, Solanum lycopersicum, Arabidopsis thaliana, and Oryza sativa, was performed (Figure 4b). The results showed that there are six (10.9%), seven (12.7%), five (9.1%), two (3.6%), and no (0.0%) GmCOMT proteins showing high homology to the members from the other five species, respectively (Figure 4b). Conclusively, the COMT gene family in soybean had more collinearity with woody plants (Populus trichocarpa and Betula Pendula) but showed a little intersection with herbaceous plants (Solanum lycopersicum, Arabidopsis thaliana, and Oryza sativa), indicating that the COMT gene family had undergone evolutionary divergence in woody and herbaceous plants. The Ka/Ks ratios of the homologous genes measured in the COMT gene subfamily were all less than 1 (Figure 4c), indicating that the COMT gene family undergoes purifying selection during evolution, which helps to understand the evolution of the soybean COMT gene family. Furthermore, the divergence time of most soybean COMT genes is within 10 MYA (Table S8), which is later than that of Arabidopsis (9.6–16.1 MYA) [36].

2.5. The Cis-Regulatory Elements in the Promoter of GmCOMTs Genes in Soybean

The PlantCare website (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/; accessed on 13 April 2021) was used to predict and analyze the cis-regulatory elements of the 2000 bp nucleic acid sequences upstream of the GmCOMTs genes transcriptional start site in order to investigate the cis-acting elements found in the soybean COMT gene family and their possible regulation (Figure 5). The cis-acting elements in the promoter region of GmCOMT genes can respond to various biotic and abiotic stresses, therefore regulating the expression of downstream genes. The results showed that the cis-acting elements on the promoter region of the GmCOMT gene family are mostly split into four classes: growth and development, light response, stress response, and hormone response, as shown in Tables S9 and S10.
With 2194 CAAT-boxes found in virtually all GmCOMTs genes, it is the most predicted of all cis-elements. The light response is represented by 20 cis-acting elements, accounting for roughly 36% of all cis-acting elements, suggesting that soybean COMT genes are likely to be controlled by light. We also found ABRE, TCA, as-1, ERE, TATC-box, TGA-box GARE-motif, TGACG-motif, and AuxRR-core, as well as nine cis-acting elements linked to hormones. Furthermore, 16 different cis-acting elements linked to stress response were identified. For example, 21 MBSs associated with low-temperature response, 102 AREs related to drought stress, 22 TC-rich repeats related to salt stress, 16 LTRs related to anaerobic stress, etc. These comprehensive findings suggest that GmCOMTs can participate in a variety of stress responses. These comprehensive findings suggest that a range of stressors or external stimuli can influence the expression of the GmCOMT genes.

2.6. Tissue Specificity of GmCOMTs Genes Expression

To address the expression patterns of the COMT gene family in soybean, two representative soybean varieties, Jack and Williams82, were selected for different tissues at the VC stage (after 14 days of seedlings, two unifoliate leaves unroll), including epicotyls, hypocotyls, meristems, roots, and unifoliate leaves. The findings revealed that most GmCOMT genes were strongly expressed in the roots, with 29 of them being the same (Figure 6a,b). In the Jack variety, there were 5, 7, 11, and 5 highly expressed genes in the epicotyl, hypocotyl, meristem, and unifoliate leaves, respectively. In Williams82, there were 3, 8, 10, and 8 highly expressed genes in epicotyl, hypocotyl, meristem, and unifoliate leaves. The expression results showed that COMTs were mainly expressed in roots, and the expression levels were similar in Jack and Williams82. At the same time, we can see that the two genes, GmCOMT6 and GmCOMT7, are strongly expressed in the hypocotyl of the Jack variety; however, the expression level is low in the hypocotyl of the Williams82 variety but highly expressed in the unifoliate leaves. The study’s findings revealed that the expression of the same gene differs amongst varieties. Furthermore, for verification the data of RNA-seq, three genes (GmCOMT25, GmCOMT33, and GmCOMT53) for RT-qPCR were performed to evaluate the expression level of three genes in the epicotyls, hypocotyls, meristems, roots, and unifoliate leaves of Jack and Williams82, respectively (Figure 6c); it can be seen that GmCOMT25, GmCOMT33, and GmCOMT53 genes are highly expressed in the leaves, roots, and meristems of Jack and William, respectively. The results show that it is consistent with the transcriptome.

2.7. Expression Patterns of COMT Genes under Abiotic Stresses

The expression patterns of COMTs were investigated under drought, submergence, dehydration, and salt stresses (Figure 7). After 5–6 days of drought treatment, the expression of 11 GmCOMTs genes was considerably decreased compared to the control. However, following 5 days of drought treatment in the roots, GmCOMT19 expression increased significantly. The expression of most GmCOMTs genes was considerably decreased after submergence treatment. Gene expression was generally reduced during drought and floods, but it was restored after one day of recovery. Compared to the control, the expressions of seven genes were considerably enhanced after 12 h of dehydration treatment. The expressions of GmCOMT29 and GmCOMT34, on the other hand, were considerably decreased. The expression of 18 genes rose substantially after 6 or 12 h of salt treatment. The findings revealed that the majority of GmCOMT genes differed depending on the stress treatment.

3. Discussion

There was abundant evidence that soybeans were an important food crop on Earth, providing us with a rich source of protein. For plants, lignin was an important polymer compound with many biological functions [37]. If the content of lignin in the plant was reduced, the plants would be in a lodging state [38], reducing the ability of water transport and mechanical support, and it was not conducive to resisting various external pressures, to pose a serious threat to the growth and development of the plants [39]. Reduced lignin concentration in soybeans weakens the strength of the stalks and reduces resilience to pests, diseases, and pathogens, according to previous research [40,41]. The biosynthesis of lignin was an extremely complex and delicate process formed by the polymerization of aromatic structural unit phenylpropanine [42]. It was generally believed that lignin comes from three important monomers, p-hydroxyphenyl (H), syringyl (S), and guaiacyl (G) units [43]. Among them, the COMT gene was a key gene that regulates the synthesis of S-type lignin. So far, the function of the COMT gene family in soybeans was still unclear. Therefore, we preliminarily predicted the function of GmCOMTs based on the homology of other species.
In Arabidopsis thaliana, the At5G54161.1 (O-methyltransferase 1) gene was shown to be highly essential in the production of S-type lignin [44] and catalyzed the methylation of n-acetylserotonin to produce melatonin [45]. Melatonin was considered a growth-promoting compound and rooting agent [46] which played an important role in the growth and development of plants. In addition, melatonin made a significant contribution to improving the stress tolerance of plants [47]. Our results showed that AT5G54160.1 was closely related to the five genes GmCOMT51, GmCOMT52, GmCOMT53, GmCOMT54, and GmCOMT55 in group II, indicating that GmCOMTs in group II may have similar functions. In general, COMT is considered to be mainly involved in the lignin synthesis pathway, converting 5-hydroxy-coniferyl aldehyde to sinapisaldehyde. However, recent studies have shown that COMT can participate in the final step of catalyzing the synthesis of melatonin in watermelon, and we speculate that the functions of different COMT gene family members are differentiated.
We can observe from the gene structure study results that the majority of GmCOMTs genes have numerous introns. In the phylogenetic tree, the GmCOMTs in the same group showed very comparable intron–exon architectures. The number of introns in the GmCOMTs gene in group II was typically higher than in group I, suggesting that the COMT genes with the large number of introns may have a better selective advantage in evolution. The Methyltransf-2 domain was found in all 55 GmCOMTs gene sequences, with the majority of the genes having just one Methyltransf-2 domain; however, two genes (GmCOMT9 and GmCOMT19) had two Methyltransf-2 domains. In previous reports, the PtrCOMTs gene sequence of Populus trichocarpa contains only one Methyltransf-2 domain [48]; some blueberry VcCOMTs genes contain two or three Methyltransf-2 domains [20]. The 55 GmCOMT protein sequences all contain Methyltransf-2 domain, so they are relatively conservative; meanwhile, in the analysis of motifs, most of the motifs are relatively conservative in the two groups. For example, some residues of Motif 2 (‘VGGGTGTTAKIICEAFPKJKCIVFDLPHV’) are related to the SAM/SAH binding site [49], which is consistent with the previous COMTs verification of blueberry and alfalfa. However, some motifs are specific. For example, Motif 3 (‘IIHNHGQPITLSELVSSLQIPPSKACFVQRLMRFLAHNGFF’) only exists in the group I of GmCOMTs protein sequence and is not included in group II; therefore, it is consistent with the classification analysis of the evolutionary tree. Based on the analysis of conservative motifs, it is found that the presence or absence of Motif 3 in the soybean COMT protein sequences is one of the important reasons for the classification based on the phylogenetic tree. However, there is no difference in the conserved domains of the two groups; therefore it is consistent with the classification analysis of the evolutionary tree. Thus, this conserved sequence might play an important role in maintaining the structure and function of COMT in soybean.
According to cis-acting element findings, the majority of cis-acting elements linked to light response were discovered in soybean COMT genes. There were 128 G-boxes, 63 GT1-moths, 23 GATA-moths, and so on, all of which were important in light-mediated transcriptional activity. Therefore, the GmCOMTs gene was likely to be influenced by the light-induced proteins. Meanwhile, we also discovered many cis-acting elements related to stress. In previous studies, the COMT genes were induced by salt stress and affected by cold stress [50]. These stress-related elements, such as ARE (related to drought), TC-rich (related to salt stress), and MBS (related to low temperature), all indicated that the GmCOMTs were likely to be induced by abiotic stress. According to reports, transgenic Arabidopsis overexpressing CrCOMT genes showed better physiological performance than wild type under salt stress [51]; and the expression pattern of COMT gene family under salt stress can infer that GmCOMTs genes in group II have similar functions.
Finally, the expression patterns of the COMT gene family in different soybean tissues are similar. Among them, the COMT gene family has the highest expression in the roots of Jack and Williams82. However, the differences in the expression patterns of different tissues in the same breed indicate that there are functional differences between the COMT gene families. The COMT gene family may regulate gene expression in response to dehydration and salt stress in soybean. Therefore, the COMTs expression of W82 roots under these stress conditions was analyzed. Our results indicated that, under salt stress condition, the expression of COMTs increased. However, under drought and submergence stress conditions, the expression of COMTs in soybean was significantly reduced. At the same time, the expression of COMTs in different tissues from distinct soybean varieties showed that the expression of COMTs in the roots was higher. We also used the W82 leaves and roots of the V1 stage to verify. It is interesting to find that the gene expression levels in the roots on the first day of stress treatment increased significantly. Regarding the mechanism of this phenomenon, it also needs further study. Therefore, in this study, the family structure, evolutionary relationship, and expression pattern of GmCOMTs genes were comprehensively analyzed, which played a vital role in soybean stress resistance and provided a theoretical basis for its future breeding.

4. Materials and Methods

4.1. Plant Materials

Two soybean varieties, Jack and Williams82, were grown as plant materials in the laboratory greenhouse of Northeast Forestry University (26 °C, 14 h light/10 h dark). When the seedlings were 14 days old (VC stage, two unifoliate leaves unroll), different tissues of the plant, including the epicotyls, hypocotyls, meristems, roots, and unifoliate leaves, were collected, with three independent copies of each sample. The collected plant material was frozen in liquid nitrogen and stored at −80 °C.

4.2. Identification of COMT Gene Family in Soybean

The candidate protein sequences were identified using the known model plant-Arabidopsis COMT gene and soybean genomic protein database for BlastP analysis (E-value threshold <= 1 × 10−5). Furthermore, 55 soybean COMT genes were identified, using HMMER 3.1 (http://hmmer.org/download.html; accessed on 23 March 2021) software to screen candidate genes through hidden Markov models [52]. The isoelectric points and molecular weights of all soybean COMT gene families were obtained online on the ExPASy (http://www.expasy.org/tools/; accessed on 18 September 2021) website [53], and the parameters were set to average values.

4.3. Phylogenetic Analysis of COMT Proteins in Soybean

The protein sequences of COMT from G. max, A. thaliana, B. rapa, O. Sativa and S. lycopersium were subjected to multiple sequence alignment, and the phylogenetic tree was built using the Neighbor-Joining (NJ) method of MEGA-X software 10.0 [54,55]. The robustness of each node in the tree was determined using 1000 bootstrap replicates, and the default parameter for the remaining parameters was selected. The visualization of the evolutionary tree is achieved through the iTOL website (https://itol.embl.de/; accessed on 20 November 2021).

4.4. Gene Structure, Motif and Domain Analyses for the GmCOMT Genes

The gene structures of the COMT gene family members in soybean were visualized using the soybean genome’s annotation information using TBtools software (version 1.092) [56]. The conserved motifs of soybean COMT proteins were analyzed by the MEME website (http://meme-suite.org; accessed on 9 July 2021) [34]. The MEME (http://meme-suite.org; accessed on 9 July 2021) website was used to analyze the conserved motifs of GmCOMT proteins with the following parameters, setting 10 motifs.

4.5. Chromosomal Location, Collinearity Analysis, Gene Duplication Events, and Ka/Ks Analysis of GmCOMT Genes

The chromosome mapping information of the COMT gene family in soybean was gained from the NCBI database, and the map was drawn by MapChart software [57]. The collinear relationship of COMT gene families between soybean and poplar was analyzed by using MCScanx and TBtools software (version 1.092) [58]. The gene duplication of COMT genes was characterized using BlastP and Multiple Collinearity Scan toolkit (MCScanX) (http://chibba.pgml.uga.edu/mcscan2/#tm; accessed on 10 July 2021) [59], and the synteny analysis of COMT genes among the Populus trichocarpa, Betula pendula, Solanum lycopersicum, Arabidopsis thaliana, and Oryza sativa was performed in TBtools with default parameters.
The Ka value, Ks value, and Ka/Ks ratios for the paralogs COMT gene pairs were calculated by TBtools. The paralogous genes were identified by searching the term “syntenic region” in the soybean genome. The rate of divergence was calculated by using the following formula: T = Ks/2r, where Ks represents the synonymous substitutions per site and r is the rate of divergence. For dicotyledonous plants, the hypothesis is 1.5 synonymous substitutions per site of 108 years [60].

4.6. Prediction of Cis-Acting Elements of COMT Genes in Soybean

The upstream 2000 bp genomic DNA sequences in the promoter regions of COMT genes were retrieved from the soybean genome using the TBtools software (version 1.092). The cis-regulatory elements (CREs) in the 2000 bp upstream regions of the COMT gene promoter were analyzed using the PlantCare website (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/; accessed on 13 April 2021) [61,62].

4.7. Expression Pattern Analysis

The transcriptome data of soybean under diverse stress treatments (drought, submergence, dehydration, and salt) was obtained from the NCBI database (https://www.ncbi.nlm.nih.gov; accessed on 13 July 2021) with accession number PRJNA246058 (https://www.ncbi.nlm.nih.gov/bioproject/PRJNA246058/; accessed on 13 July 2021) and PRJNA574626 (https://www.ncbi.nlm.nih.gov/bioproject/PRJNA574626/; accessed on 13 July 2021). The obtained transcriptome data were processed and drawn into heat maps. The fragments per kilobase per million (FPKM) value was calculated to quantify gene expression.
The bioinformatics analysis process is as follows: (a) the original transcriptome data was aligned to the soybean genome with hisat2 (https://daehwankimlab.github.io/hisat2/; accessed on 20 July 2021). (b) The aligned results were performed to calculate transcripts per million (TPM) by stringtie (http://ccb.jhu.edu/software/stringtie; accessed on 20 July 2021). (c) Finally, the GmCOMT gene expression in different tissues was scaled by setting the scale = “row” parameter in pheatmap function of R (https://cran.r-project.org; accessed on 20 July 2021), and then the hierarchical clustering of expression profiles of 55 COMT genes was visualized by R-heatmap package.

4.8. Genomic RNA Extraction and Quantitative RT-PCR Analysis

TRIzol (TianGen, Beijing, China) was used to extract total RNA from each tissue of soybeans. The SYBR Green I Master mixture (Roche, Basel, Switzerland) was used as the reagent for qRT-PCR. The qRT-PCR primers designed in this study are shown in Table S11. The 2−ΔΔCT method was used to calculate the relative gene expression levels [63]. About 1 μg RNA was mixed with the 10 μL reverse-transcribed buffer in 2 mL PCR-tube, which comprised 1 μL gDNA Eraser Buffer, 2 μL 5 × g DNA Eraser Buffer, and the rest is RNase free ddH2O. The standard protocol was set as 2 min at 42 °C, followed by 10 min at 0 °C. The reaction product was added to a 10 μL reaction containing 1 μL Primer Script RT Enzyme, 1 μL RT Primer Mix, 4 μL 5 × Primer Script Buffer, and RNase Free ddH2O. The reverse-transcribed parameters were as follows: 15 min at 37 °C followed by 5 s at 85 °C and 10 min at 0 °C. The ten-fold diluted digestion DNA products were used as a template for quantitative RT-PCR of betulin synthetic genes. The tubulin gene was identified from the birch reference genome as the internal control. PCR analysis was conducted using the Applied ABI7500 Real-Time PCR System with SYBR Premix Ex Taq™ II. Each PCR was conducted in a 15 μL reaction mixture containing 6.3 μL of 20 × diluted cDNA, 7.5 μL of SYBR Green Supermix, 0.6 μL of forward primers, and 0.6 μL of reverse primers. Each gene of transcript level was calculated by the 2-(−ΔΔCT) CT method. All the qRT-PCR experiments were performed in three independent replicates.

5. Conclusions

A total of 55 COMTs genes were identified in the entire soybean genome, and these genes were distributed in two groups of the phylogenetic tree. COMTs in soybeans has large structural differences, but it is relatively conservative in evolution. In addition, the cis-acting elements in the promoter region of the GmCOMTs gene were predicted, showing a total of four types of elements. The GmCOMTs gene expression patterns in different tissues and stress conditions were systematically studied. It was found that the expression of soybean COMT gene family members had tissue differences and was related to abiotic stresses such as drought and salt. The systematic exploration of the soybean COMT gene lays the foundation for future soybean breeding and stress resistance.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/plants10122816/s1. Table S1. The length, the amnio acid sequence, and the position of COMT gene family of chromosomes. Table S2. The number of COMTs in Glycine max, Arabidopsis thaliana, Solanum lycopersicum and Brassic rapa. Table S3. Width, Sites, E-value of GmCOMTs conserved motif. Table S4. The genes that contain a collinear relationship and the location of soybean COMTs. Table S5. The functional annotations of the COMT genes in soybean. Table S6. Analysis of whole genome duplication (WGD) in soybean. Table S7. Analysis of whole genome duplication (WGD) in GmCOMTs subfamily. Table S8. Ka/Ks calculation of the paralog pairs of SET and COMT in soybean. Table S9. Prediction of cis-elements of GmCOMT gene family. Table S10. The numbers of cis-elements in GmCOMT gene family. Table S11. The primers of qRT-PCR. Figure S1. Genomic collinearity analysis in soybean.

Author Contributions

Conceptualization, X.Z.; methodology, X.Z. and B.C.; writing—original draft preparation, X.Z.; writing—review and editing, B.C. and S.A.; data curation, B.C.; investigation, L.W., Y.G., J.L., and J.W.; supervision, Q.Z. and L.X. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the National Natural Science Foundation of China (31871220 and 31801444); Heilongjiang Provincial Natural Science Foundation of China (LH2021C005); Heilongjiang Touyan Innovation Team Program (Tree Genetics and Breeding Innovation Team); the National Nonprofit Institute Research Grant of the Chinese Academy of Forestry (CAFYBB2019ZY003); the Fundamental Research Funds for the Central Universities (2572020DP01).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

All data on NCBI database (https://www.ncbi.nlm.nih.gov; accessed on 13 July 2021) is publicly available.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Pagano, M.C.; Miransari, M. The importance of soybean production worldwide. In Abiotic and Biotic Stresses in Soybean Production; Academic Press: Cambridge, MA, USA, 2016; Volume 1, pp. 1–26. [Google Scholar]
  2. Koberg, M.; Abu-Much, R.; Gedanken, A. Optimization of bio-diesel production from soybean and wastes of cooked oil: Combining dielectric microwave irradiation and a SrO catalyst. Bioresour. Technol. 2011, 102, 1073–1078. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Zou, J.L.; Liu, W.G.; Yuan, J.; Jiang, T.; Yang, W.Y. Relationship between lignin synthesis and lodging resistance at seedlings stage in soybean intercropping system. Acta Agron. Sin. 2015, 41, 1098–1104. [Google Scholar] [CrossRef] [Scilit]
  4. Klis, F.M.; Mol, P.; Hellingwerf, K.; Brul, S. Dynamics of cell wall structure in Saccharomyces cerevisiae. FEMS Microbiol. Rev. 2002, 26, 239–256. [Google Scholar] [CrossRef]
  5. Canut, H.; Albenne, C.; Jamet, E. Isolation of the cell wall. Methods Mol. Biol. 2017, 1511, 171–185. [Google Scholar] [PubMed]
  6. Underwood, W. The plant cell wall: A dynamic barrier against pathogen invasion. Front. Plant Sci. 2012, 3, 85. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Ralph, J.; Lundquist, K.; Brunow, G.; Lu, F.; Boerjan, W. Lignins: Natural polymers from oxidative coupling of 4-hydroxyphenyl- propanoids. Phytochem. Rev. 2004, 3, 29–60. [Google Scholar] [CrossRef] [Scilit]
  8. Liu, Q.; Luo, L.; Zheng, L. Lignins: Biosynthesis and biological functions in plants. Int. J. Mol. Sci. 2018, 19, 335. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Ithal, N.; Recknor, J.; Dan, N.; Maier, T.; Mitchum, M.G. Developmental transcript profiling of cyst nematode feeding cells in soybean roots. Mol. Plant Microbe Interact. 2007, 20, 510–525. [Google Scholar] [CrossRef] [Scilit]
  10. Peng, D.; Chen, X.; Yin, Y.; Lu, K.; Yang, W.; Tang, Y.; Wang, Z. Lodging resistance of winter wheat (Triticum aestivum L.): Lignin accumulation and its related enzymes activities due to the application of paclobutrazol or gibberellin acid. Field Crop. Res. 2014, 157, 1–7. [Google Scholar] [CrossRef] [Scilit]
  11. Moura, J.C.M.S.; Bonine, C.; Viana, J.; Dornelas, M.C.; Mazzafera, P. Abiotic and biotic stresses and changes in the lignin content and composition in plants. J. Integr. Plant Biol. 2010, 52, 360–376. [Google Scholar] [CrossRef] [Scilit]
  12. Xiang, D.B.; Guo, K.; Lei, T.; Yu, X.B.; Luo, Q.M.; Yang, W.Y. Effects of phosphorus and potassium on stem characteristics and lodging resistance of relay cropping soybean. Chin. J. Oil Crop Sci. 2010, 32, 395–402. [Google Scholar]
  13. Tripathi, S.C.; Sayre, K.D.; Kaul, J.N.; Narang, R.S. Growth and morphology of spring wheat (Triticum aestivum L.) culms and their association with lodging: Effects of genotypes, N levels and ethephon. Field Crop. Res. 2003, 84, 271–290. [Google Scholar] [CrossRef] [Scilit]
  14. Vanholme, R.; Meester, B.D.; Ralph, J.; Boerjan, W. Lignin biosynthesis and its integration into metabolism. Curr. Opin. Biotechnol. 2019, 56, 230–239. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Jin, Q.; Yan, C.; Qiu, J.; Zhang, N.; Lin, Y.; Cai, Y. Structural characterization and deposition of stone cell lignin in Dangshan Su pear. Sci. Hortic. 2013, 155, 123–130. [Google Scholar] [CrossRef] [Scilit]
  16. Abdelaziz, O.Y.; Brink, D.P.; Prothmann, J.; Ravi, K.; Gorwa-Grauslund, M.F. Biological valorization of low molecular weight lignin. Biotechnol. Adv. 2016, 34, 1318–1346. [Google Scholar] [CrossRef] [Scilit]
  17. Vanholme, R.; Demedts, B.; Morreel, K.; Ralph, J.; Boerjan, W. Lignin biosynthesis and structure. Plant Physiol. 2010, 153, 895–905. [Google Scholar] [CrossRef] [Scilit]
  18. Trabucco, G.M.; Matos, D.A.; Lee, S.J.; Saathoff, A.J.; Hazen, S.P. Functional characterization of cinnamyl alcohol dehydrogenase and caffeic acid O-methyltransferase in Brachypodium distachyon. BMC Biotechnol. 2013, 13, 61. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Faraji, M.; Fonseca, L.L.; Escamilla-Trevio, L.; Barros-Rios, J.; Voit, E.O. Mathematical models of lignin biosynthesis. Biotechnol. Biofuels 2018, 11, 34. [Google Scholar] [CrossRef] [Scilit]
  20. Liu, Y.; Wang, Y.; Pei, J.; Li, Y.; Sun, H. Genome-wide identification and characterization of COMT gene family during the development of blueberry fruit. BMC Plant Biol. 2021, 21, 5. [Google Scholar] [CrossRef] [Scilit]
  21. Zägel, P.; Dell’Orco, D.; Koch, K.W. The dimerization domain in outer segment guanylate cyclase is a Ca2+-sensitive control switch module. Biochemistry 2013, 52, 5065–5074. [Google Scholar] [CrossRef] [Scilit]
  22. Huang, S.; Ding, J.; Deng, D.; Tang, W.; Sun, H.; Liu, D.; Zhang, L.; Niu, X.; Zhang, X.; Meng, M.; et al. Draft genome of the kiwifruit Actinidia chinensis. Nat. Commun. 2013, 4, 2640. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Li, J.J.; Zhang, G.; Yu, J.H.; Li, Y.Y.; Liao, H. Molecular cloning and characterization of caffeic acid 3-O-methyltransferase from the rhizome of Ligusticum chuanxiong. Biotechnol. Lett. 2015, 37, 1–8. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Bugos, R.C.; Chiang, V.; Campbell, W.H. cDNA cloning, sequence analysis and seasonal expression of lignin-bispecific caffeic acid/5-hydroxyferulic acid O-methyltransferase of aspen. Plant Mol. Biol. 1991, 17, 1203–1215. [Google Scholar] [CrossRef] [Scilit]
  25. Carocha, V.; Soler, M.; Hefer, C.; Cassan-Wang, H.; Fevereiro, P.; Myburg, A.A.; Paiva, J.A.; Grima-Pettenati, J. Genome-wide analysis of the lignin toolbox of Eucalyptus grandis. New Phytol. 2015, 206, 1297–1313. [Google Scholar] [CrossRef] [Scilit]
  26. Lu, N.; Ma, W.; Han, D.; Liu, Y.; Wang, Z.; Wang, N.; Yang, G.; Qu, G.; Wang, Q.; Zhao, K.; et al. Genome-wide analysis of the Catalpa bungei caffeic acid O-methyltransferase (COMT) gene family: Identification and expression profiles in normal, tension, and opposite wood. PeerJ 2019, 7, 6520. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Chiang, V.L. Towards a systems approach for lignin biosynthesis in Populus trichocarpa: Transcript abundance and specificity of the monolignol biosynthetic genes. Plant Cell Physiol. 2010, 51, 144–163. [Google Scholar]
  28. Wei, L.; Lu, J.; Lu, K.; Yuan, J.; Li, J. Cloning and phylogenetic analysis of Brassica napus L. Caffeic acid O-methyltransferase 1 gene family and its expression pattern under drought stress. PLoS ONE 2016, 11, e0165975. [Google Scholar]
  29. Chen, S.; Zhao, Y.; Zhao, X.; Chen, S. Identification of putative lignin biosynthesis genes in Betula pendula. Trees 2020, 34, 1255–1265. [Google Scholar] [CrossRef] [Scilit]
  30. Lv, G.; Tang, D.; Chen, F.; Sun, Y.; Fang, W.; Guan, Z.; Liu, Z.; Chen, S. The anatomy and physiology of spray cut chrysanthemum pedicels, and expression of a caffeic acid 3-O-methyltransferase homologue. Postharvest Biol. Technol. 2011, 60, 244–250. [Google Scholar] [CrossRef] [Scilit]
  31. Oraby, H.F.; Ramadan, M.F. Impact of suppressing the caffeic acid O-methyltransferase (COMT) gene on lignin, fiber, and seed oil composition in Brassica napus transgenic plants. Eur. Food Res. Technol. 2015, 240, 931–938. [Google Scholar] [CrossRef] [Scilit]
  32. Lee, H.Y.; Byeon, Y.; Lee, K.; Lee, H.; Back, K. Cloning of Arabidopsis serotonin N-acetyltransferase and its role with caffeic acid O-methyltransferase in the biosynthesis of melatonin in vitro despite their different subcellular localizations. J. Pineal Res. 2015, 57, 418–426. [Google Scholar] [CrossRef] [Scilit]
  33. Xu, G.; Guo, C.; Shan, H.; Kong, H. Divergence of duplicate genes in exon-intron structure. Proc. Natl. Acad. Sci. USA 2012, 109, 1187–1192. [Google Scholar] [CrossRef] [Scilit]
  34. Bailey, T.L.; Mikael, B.; Buske, F.A.; Martin, F.; Grant, C.E.; Luca, C.; Jingyuan, R.; Li, W.W.; Noble, W.S. MEME SUITE: Tools for motif discovery and searching. Nucleic Acids Res. 2009, 37, W202–W208. [Google Scholar] [CrossRef] [Scilit]
  35. Liu, Y.; Du, H.; Li, P.; Shen, Y.; Peng, H.; Liu, S.; Zhou, G.A.; Zhang, H.; Liu, Z.; Shi, M.; et al. Pan-genome of wild and cultivated soybeans. Cell 2020, 182, 162–176. [Google Scholar] [CrossRef] [Scilit]
  36. Lei, L.; Zhou, S.; Ma, H.; Zhang, L. Expansion and diversification of the SET domain gene family following whole-genome duplications in Populus trichocarpa. BMC Evol. Biol. 2012, 12, 51. [Google Scholar] [CrossRef] [Scilit]
  37. Boerjan, W.; Ralph, J.; Baucher, M. Lignin biosynthesis. Annu. Rev. Plant Biol. 2003, 54, 519–546. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Hu, D.; Liu, X.B.; Wang, C.; Yang, H.; Li, H.X.; Ruan, R.W.; Yuan, X.H.; Yi, Z.L. Expression analysis of key enzyme genes in lignin synthesis of culm among different lodging resistances of common buckwheat (Fagopyrum esculentum Moench.). Sci. Agric. Sin. 2015, 48, 1864–1872. [Google Scholar]
  39. Schuetz, M.; Benske, A.; Smith, R.A.; Watanabe, Y.; Tobimatsu, Y.; Ralph, J.; Demura, T.; Ellis, B.; Samuels, A.L. Laccases direct lignification in the discrete secondary cell wall domains of protoxylem. Plant Physiol. 2014, 166, 798–807. [Google Scholar] [CrossRef] [Scilit]
  40. Bellaloui, N. Soybean seed phenol, lignin, and isoflavones partitioning as affected by seed node position and genotype differences. Food Nutr. Sci. 2012, 3, 447–454. [Google Scholar] [CrossRef]
  41. Casler, M. Breeding forage crops for increased nutritional value. Adv. Agron. 2001, 71, 51–107. [Google Scholar]
  42. Rogers, L.A.; Campbell, M.M. The genetic control of lignin deposition during plant growth and development. New Phytol. 2004, 164, 17–30. [Google Scholar] [CrossRef] [Scilit]
  43. Rinaldi, R.; Jastrzebski, R.; Clough, M.T.; Ralph, J.; Kennema, M.; Bruijnincx, P.; Weckhuysen, B.M. Paving the way for lignin valorisation: Recent advances in bioengineering, biorefining and catalysis. Angew. Chem. Int. Ed. Engl. 2016, 55, 8164–8215. [Google Scholar] [CrossRef] [Scilit]
  44. Vanholme, R.; Ralph, J.; Akiyama, T.; Lu, F.; Boerjan, W. Engineering traditional monolignols out of lignin by concomitant up-regulation of F5H1 and down-regulation of COMT in Arabidopsis. Plant J. Cell Mol. Biol. 2010, 64, 885–897. [Google Scholar] [CrossRef] [Scilit]
  45. Byeon, Y.; Lee, H.Y.; Lee, K.; Back, K. Caffeic acid O-methyltransferase is involved in the synthesis of melatonin by methylating N-acetylserotonin in Arabidopsis. J. Pineal Res. 2015, 57, 219–227. [Google Scholar] [CrossRef] [Scilit]
  46. Cipolla-Neto, J.; Amaral, F.G.; Afeche, S.C.; Tan, D.X.; Reiter, R.J. Melatonin, energy metabolism, and obesity: A review. J. Pineal Res. 2014, 56, 371–381. [Google Scholar] [CrossRef] [Scilit]
  47. Zhang, N.; Sun, Q.; Zhang, H.; Cao, Y.; Weeda, S.; Ren, S.; Guo, Y.D. Roles of melatonin in abiotic stress resistance in plants. J. Exp. Bot. 2015, 66, 647–656. [Google Scholar] [CrossRef] [Scilit]
  48. Barakat, A.; Choi, A.; Yassin, N.B.M.; Park, J.S.; Sun, Z.; Carlson, J.E. Comparative genomics and evolutionary analyses of the O-methyltransferase gene family in Populus. Gene 2011, 479, 37–46. [Google Scholar] [CrossRef] [Scilit]
  49. Robin, A.Y.; Giustini, C.; Graindorge, M.; Matringe, M.; Dumas, R. Crystal structure of norcoclaurine-6-O-methyltransferase, a key rate-limiting step in the synthesis of benzylisoquinoline alkaloids. Plant J. 2016, 87, 641–653. [Google Scholar] [CrossRef] [Scilit]
  50. Kim, J.; Choi, B.; Cho, B.K.; Lim, H.S.; Bae, H. Molecular cloning, characterization and expression of the caffeic acid O-methyltransferase (COMT) ortholog from kenaf (Hibiscus cannabinus). Plant Omics 2013, 6, 246–253. [Google Scholar]
  51. Zhang, K.; Cui, H.; Cao, S.; Yan, L.; Sun, Y. Overexpression of CrCOMT from Carex rigescens increases salt stress and modulates melatonin synthesis in Arabidopsis thaliana. Plant Cell Rep. 2019, 38, 1501–1514. [Google Scholar] [CrossRef] [Scilit]
  52. Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, 29–37. [Google Scholar] [CrossRef] [Scilit]
  53. Panu, A.; Manohar, J.; Konstantin, A.; Delphine, B.; Gabor, C.; Edouard, D.C.; Séverine, D.; Volker, F.; Arnaud, F.; Elisabeth, G. ExPASy: SIB bioinformatics resource portal. Nucleic Acids Res. 2012, 40, 597–603. [Google Scholar]
  54. Saitou, N. The neighbor-joining method: A new method for reconstructing phylogenetic trees. Mol. Biol. Evol. 1987, 4, 406–425. [Google Scholar]
  55. Sudhir, K.; Glen, S.; Li, M.; Christina, K.; Koichiro, T. MEGA X: Molecular evolutionary genetics analysis across computing platforms. Mol. Biol. Evol. 2018, 35, 1547–1549. [Google Scholar]
  56. Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef] [Scilit]
  57. Voorrips, R.E. MapChart: Software for the graphical presentation of linkage maps and QTLs. J. Heredity 2002, 93, 77–78. [Google Scholar] [CrossRef] [Scilit]
  58. Wang, Y.; Tang, H.; Debarry, J.D.; Tan, X.; Li, J.; Wang, X.; Tae-Ho, L.; Jin, H.; Barry, M.; Guo, H. MCScanX: A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, 49. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Xie, T.; Chen, C.; Li, C.; Liu, J.; Liu, C.; He, Y. Genome-wide investigation of WRKY gene family in pineapple: Evolution and expression profiles during development and stress. BMC Genom. 2018, 19, 490. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Koch, M.; Al-Shehbaz, I.; Mummenhoff, K. Molecular systematics, evolution, and population biology in the mustard family (Brassicaceae). Ann. Mo. Bot. Gard. 2003, 1, 151–171. [Google Scholar] [CrossRef] [Scilit]
  61. Rombauts, S.; Déhais, P.; Van, M.; Rouzé, P. PlantCARE, a plant cis-acting regulatory element database. Nucleic Acids Res. 1999, 27, 295–296. [Google Scholar] [CrossRef] [Scilit]
  62. Lescot, M. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef] [Scilit]
  63. Schmittgen, T.D.; Livak, K.J. Analyzing real-time PCR data by the comparative C(T) method. Nat. Protoc. 2008, 3, 1101–1108. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. Phylogenetic relationship of COMTs in different species using complete protein sequences. The neighbor-joining (NJ) phylogenetic tree was constructed with Poisson model by MEGA-X 10.0 software. Gm represents G. max; Bra represents B. rapa; Solyc represents S. lycopersium; AT represents A. thaliana, Os represents Oryza sativa, respectively. The tree was generated from an amino acid sequence alignment of 55 GmCOMTs, 25 BrCOMTs, 17 SlCOMTs, 48 OsCOMTs, and 14 AtCOMTs. The red arc represents group I; the blue arc represents group II, respectively. The tree is based on homologous groups showing evolutionary relationships with COMTs.
Figure 1. Phylogenetic relationship of COMTs in different species using complete protein sequences. The neighbor-joining (NJ) phylogenetic tree was constructed with Poisson model by MEGA-X 10.0 software. Gm represents G. max; Bra represents B. rapa; Solyc represents S. lycopersium; AT represents A. thaliana, Os represents Oryza sativa, respectively. The tree was generated from an amino acid sequence alignment of 55 GmCOMTs, 25 BrCOMTs, 17 SlCOMTs, 48 OsCOMTs, and 14 AtCOMTs. The red arc represents group I; the blue arc represents group II, respectively. The tree is based on homologous groups showing evolutionary relationships with COMTs.
Plants 10 02816 g001
Figure 2. The polygenetic relationship, gene structure, and motif analysis of the COMTs in soybean. (a) The phylogenetic tree was constructed with the MEGA-X 10.0 program using protein sequences of the 55 COMTs genes in soybean. (b) Identification of the conserved functional domains of the COMT gene family of soybean. Blue represents the Methyltransf-2 domain, yellow represents the dimerization domain, and pink represents the dimerization 2 domain. (c) The size of the 55 COMTs were characterized by the MEME website and TBtools software, respectively. A total of 10 putative motifs are identified here, with the numbers 1–10, and are represented by different color boxes, which are numbered and placed at the bottom on the right. (d) Motif LOGO showing below. (e) Exon/intron structure analysis of 55 putative COMT genes. The yellow box is indicative of the exons (CDS), the green box represents UTR, and the grey line is described as the introns. The sizes of the exons or introns can be calculated from the bottom scale.
Figure 2. The polygenetic relationship, gene structure, and motif analysis of the COMTs in soybean. (a) The phylogenetic tree was constructed with the MEGA-X 10.0 program using protein sequences of the 55 COMTs genes in soybean. (b) Identification of the conserved functional domains of the COMT gene family of soybean. Blue represents the Methyltransf-2 domain, yellow represents the dimerization domain, and pink represents the dimerization 2 domain. (c) The size of the 55 COMTs were characterized by the MEME website and TBtools software, respectively. A total of 10 putative motifs are identified here, with the numbers 1–10, and are represented by different color boxes, which are numbered and placed at the bottom on the right. (d) Motif LOGO showing below. (e) Exon/intron structure analysis of 55 putative COMT genes. The yellow box is indicative of the exons (CDS), the green box represents UTR, and the grey line is described as the introns. The sizes of the exons or introns can be calculated from the bottom scale.
Plants 10 02816 g002
Figure 3. Chromosomal localization of COMT genes in soybean. There were 55 COMT genes located on 15 soybean chromosomes. Chromosome numbers are labeled at the top of each vertical bar. The left scale rulers indicate the length of the chromosomes. The names of the COMT genes are labeled at the appropriate position on the right side of each soybean chromosome.
Figure 3. Chromosomal localization of COMT genes in soybean. There were 55 COMT genes located on 15 soybean chromosomes. Chromosome numbers are labeled at the top of each vertical bar. The left scale rulers indicate the length of the chromosomes. The names of the COMT genes are labeled at the appropriate position on the right side of each soybean chromosome.
Plants 10 02816 g003
Figure 4. (a) Collinearity analysis of COMT gene family in soybean. Each colored square on the edge of the circle represents soybean chromosomes. The gray lines in the middle represent the soybean genome’s collinearity module, and the red lines show that some of the COMTs genes have a collinear relationship. (b) The homology analysis of COMT genes between soybean and five representative plant species. The gray lines represent the collinear blocks in the genome of soybean and other plants, and the red line represents the collinear COMT gene pairs. The plant named different prefixes “G. max”, “P. trichocarpa”, “B. pendula”, “S. lycopersicum”, “A. thaliana”, and “O. sativa” represent Glycine max, Populus trichocarpa, Betula pendula, Solanum lycopersicum, Arabidopsis thaliana, and Oryza sativa. (c) The ratio between Ks and Ka for paralogous GmCOMT gene pairs in soybean.
Figure 4. (a) Collinearity analysis of COMT gene family in soybean. Each colored square on the edge of the circle represents soybean chromosomes. The gray lines in the middle represent the soybean genome’s collinearity module, and the red lines show that some of the COMTs genes have a collinear relationship. (b) The homology analysis of COMT genes between soybean and five representative plant species. The gray lines represent the collinear blocks in the genome of soybean and other plants, and the red line represents the collinear COMT gene pairs. The plant named different prefixes “G. max”, “P. trichocarpa”, “B. pendula”, “S. lycopersicum”, “A. thaliana”, and “O. sativa” represent Glycine max, Populus trichocarpa, Betula pendula, Solanum lycopersicum, Arabidopsis thaliana, and Oryza sativa. (c) The ratio between Ks and Ka for paralogous GmCOMT gene pairs in soybean.
Plants 10 02816 g004
Figure 5. Predicted cis-regulatory elements in the 2000 bp promoter regions of COMT genes in soybean. Putative core sequences are represented by different symbols, as indicated in the figure key at the bottom. Different color squares represent different cis-acting elements.
Figure 5. Predicted cis-regulatory elements in the 2000 bp promoter regions of COMT genes in soybean. Putative core sequences are represented by different symbols, as indicated in the figure key at the bottom. Different color squares represent different cis-acting elements.
Plants 10 02816 g005
Figure 6. The expression levels of GmCOMTs genes in Jack (a) and Williams82 (b). The colors spanning from green to blue represent an increasing level of gene expression. The horizontal axis represents the different tissue parts of the soybean, and the vertical axis represents the COMTs genes of soybean. The expression patterns of GmCOMT25, GmCOMT33, and GmCOMT53 are shown in Jack and Williams82 (c). Different colors represent different tissues. E, epicotyl; H, hypocotyl; M, meristem; R, roots; U, unifoliate leaves.
Figure 6. The expression levels of GmCOMTs genes in Jack (a) and Williams82 (b). The colors spanning from green to blue represent an increasing level of gene expression. The horizontal axis represents the different tissue parts of the soybean, and the vertical axis represents the COMTs genes of soybean. The expression patterns of GmCOMT25, GmCOMT33, and GmCOMT53 are shown in Jack and Williams82 (c). Different colors represent different tissues. E, epicotyl; H, hypocotyl; M, meristem; R, roots; U, unifoliate leaves.
Plants 10 02816 g006
Figure 7. Expression patterns of GmCOMTs genes under different abiotic stresses, (a) dehydration and salt stress, (b) drought and submergence. Co and CT represent control treatment; De and Na represent dehydration and salt stress, respectively; DRO and SUB represent drought and submergence. D and h represent day and hour. L and R are the leaves and roots, respectively. DRO_REC_L/R indicates one-day recovery following six days of drought in leaves/roots. SUB_REC_L/R indicates one-day recovery following three days of submergence in leaves/roots.
Figure 7. Expression patterns of GmCOMTs genes under different abiotic stresses, (a) dehydration and salt stress, (b) drought and submergence. Co and CT represent control treatment; De and Na represent dehydration and salt stress, respectively; DRO and SUB represent drought and submergence. D and h represent day and hour. L and R are the leaves and roots, respectively. DRO_REC_L/R indicates one-day recovery following six days of drought in leaves/roots. SUB_REC_L/R indicates one-day recovery following three days of submergence in leaves/roots.
Plants 10 02816 g007aPlants 10 02816 g007b
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Zhang, X.; Chen, B.; Wang, L.; Ali, S.; Guo, Y.; Liu, J.; Wang, J.; Xie, L.; Zhang, Q. Genome-Wide Identification and Characterization of Caffeic Acid O-Methyltransferase Gene Family in Soybean. Plants 2021, 10, 2816. https://doi.org/10.3390/plants10122816

AMA Style

Zhang X, Chen B, Wang L, Ali S, Guo Y, Liu J, Wang J, Xie L, Zhang Q. Genome-Wide Identification and Characterization of Caffeic Acid O-Methyltransferase Gene Family in Soybean. Plants. 2021; 10(12):2816. https://doi.org/10.3390/plants10122816

Chicago/Turabian Style

Zhang, Xu, Bowei Chen, Lishan Wang, Shahid Ali, Yile Guo, Jiaxi Liu, Jiang Wang, Linan Xie, and Qingzhu Zhang. 2021. "Genome-Wide Identification and Characterization of Caffeic Acid O-Methyltransferase Gene Family in Soybean" Plants 10, no. 12: 2816. https://doi.org/10.3390/plants10122816

APA Style

Zhang, X., Chen, B., Wang, L., Ali, S., Guo, Y., Liu, J., Wang, J., Xie, L., & Zhang, Q. (2021). Genome-Wide Identification and Characterization of Caffeic Acid O-Methyltransferase Gene Family in Soybean. Plants, 10(12), 2816. https://doi.org/10.3390/plants10122816

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop