Bioassays for Identifying and Characterizing Plant Regulatory Peptides
Abstract
:1. Introduction
2. Mass Spectrometry Is a Powerful Tool for the Identification of Plant Peptides
3. Identified and Putative Regulatory Peptides in Plants
4. Bioassays of Synthetic Peptides for Their Biological Activity Are Essential to Elucidate the Functional Role of Isolated and Putative Peptides
5. Root Growth Assays
6. Cellular Bioassays
7. Bioassays Based on Cellular Stress Reactions
8. Conclusions
Funding
Acknowledgments
Conflicts of Interest
Abbreviations
List of abbreviations | |
HPLC | High-performance liquid chromatography is an analytical technique for the separation and quantification of chemical compounds |
LC-MS/MS | Liquid chromatography—tandem mass spectrometry |
LRR | Leucine-rich repeat |
MALDI | Mass spectrometry technique matrix-assisted laser desorption/ionization |
MALDI-TOF-MS | Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry |
MALDI-TOF-MS/MS | Matrix-assisted laser desorption/ionization time-of-flight tandem mass spectrometry |
MAPK | Mitogen-activated protein kinases |
RGA | Root growth assay |
RTK | Receptor tyrosine kinase |
RLK | Receptor-like kinase |
SBT | Subtilisin-like serine proteinase |
WT | Wild type |
List of peptide acronyms | |
AtPep1 | The 23-amino acid peptide isolated from extracts of Arabidopsis leaves, exhibiting characteristics of an endogenous elicitor of the innate immune response [20], the first member of the Pep (plant elicitor peptides) family [22] |
CEP | C-terminally encoded peptide [34] |
CIF | Casparian strip integrity factor 1 [48] |
CLE | CLAVATA3/EMBRYO SURROUNDING REGION-related [30] |
CLEL | CLE-like peptide [54] |
GLV | GOLVEN peptide [55] |
HypSys | Hydroxyproline-rich peptide systemin [18,77] |
Pep | Plant elicitor peptide [22,23] |
RALF | Rapid alkalinization factor [27] |
RGF | Root meristem growth factor peptide [46] |
PSY | Plant peptide containing sulfated tyrosine [9] |
TDIF | Tracheary element differentiation inhibitory factor peptides [33] |
References
- Hellinger, R.; Sigurdsson, A.; Wu, W.; Romanova, E.V.; Li, L.; Sweedler, J.V.; Süssmuth, R.D.; Gruber, C.W. Peptidomics. Nat. Rev. Methods Primers 2023, 3, 25. [Google Scholar] [CrossRef]
- Tavormina, P.; De Coninck, B.; Nikonorova, N.; De Smet, I.; Cammue, B.P.A. The Plant Peptidome: An Expanding Repertoire of Structural Features and Biological Functions. Plant Cell 2015, 27, 2095–2118. [Google Scholar] [CrossRef] [PubMed]
- Matsubayashi, Y. Exploring Peptide Hormones in Plants: Identification of Four Peptide Hormone-Receptor Pairs and Two Post-Translational Modification Enzymes. Proc. Jpn. Acad. Ser. B Phys. Biol. Sci. 2018, 94, 59. [Google Scholar] [CrossRef] [PubMed]
- Lemmon, M.A.; Schlessinger, J. Cell Signaling by Receptor-Tyrosine Kinases. Cell 2010, 141, 1117. [Google Scholar] [CrossRef] [PubMed]
- Okuda, S. Molecular Mechanisms of Plant Peptide Binding to Receptors. Peptides 2021, 144, 170614. [Google Scholar] [CrossRef] [PubMed]
- Pearce, G.; Strydom, D.; Johnson, S.; Ryan, C.A. A Polypeptide from Tomato Leaves Induces Wound-Inducible Proteinase Inhibitor Proteins. Science 1991, 253, 895–897. [Google Scholar] [CrossRef]
- Matsubayashi, Y.; Sakagami, Y. Phytosulfokine, Sulfated Peptides That Induce the Proliferation of Single Mesophyll Cells of Asparagus officinalis L. Proc. Natl. Acad. Sci. USA 1996, 93, 7623–7627. [Google Scholar] [CrossRef]
- Stührwohldt, N.; Bühler, E.; Sauter, M.; Schaller, A. Phytosulfokine (PSK) Precursor Processing by Subtilase SBT3.8 and PSK Signaling Improve Drought Stress Tolerance in Arabidopsis. J. Exp. Bot. 2021, 72, 3427–3440. [Google Scholar] [CrossRef]
- Amano, Y.; Tsubouchi, H.; Shinohara, H.; Ogawa, M.; Matsubayashi, Y. Tyrosine-Sulfated Glycopeptide Involved in Cellular Proliferation and Expansion in Arabidopsis. Proc. Natl. Acad. Sci. USA 2007, 104, 18333–18338. [Google Scholar] [CrossRef]
- Tost, A.S.; Kristensen, A.; Olsen, L.I.; Axelsen, K.B.; Fuglsang, A.T. The PSY Peptide Family—Expression, Modification and Physiological Implications. Genes 2021, 12, 218. [Google Scholar] [CrossRef]
- Ryan, C.A.; Pearce, G. Systemins: A Functionally Defined Family of Peptide Signals That Regulate Defensive Genes in Solanaceae Species. Proc. Natl. Acad. Sci. USA 2003, 100, 14577–14580. [Google Scholar] [CrossRef]
- Pastor, V.; Sánchez-Bel, P.; Gamir, J.; Pozo, M.J.; Flors, V. Accurate and Easy Method for Systemin Quantification and Examining Metabolic Changes under Different Endogenous Levels. Plant Methods 2018, 14, 33. [Google Scholar] [CrossRef] [PubMed]
- Coppola, M.; Di Lelio, I.; Romanelli, A.; Gualtieri, L.; Molisso, D.; Ruocco, M.; Avitabile, C.; Natale, R.; Cascone, P.; Guerrieri, E.; et al. Tomato Plants Treated with Systemin Peptide Show Enhanced Levels of Direct and Indirect Defense Associated with Increased Expression of Defense-Related Genes. Plants 2019, 8, 395. [Google Scholar] [CrossRef] [PubMed]
- Zhang, H.; Zhang, H.; Lin, J. Systemin-Mediated Long-Distance Systemic Defense Responses. New Phytol. 2020, 226, 1573–1582. [Google Scholar] [CrossRef] [PubMed]
- Cirillo, V.; Molisso, D.; Aprile, A.M.; Maggio, A.; Rao, R. Systemin Peptide Application Improves Tomato Salt Stress Tolerance and Reveals Common Adaptation Mechanisms to Biotic and Abiotic Stress in Plants. Environ. Exp. Bot. 2022, 199, 104865. [Google Scholar] [CrossRef]
- Yan, J.; Xin, P.; Cheng, S.; Chu, J. A Sensitive and Accurate Method for Quantifying Endogenous Systemin Levels and Verifying Natural Occurrence of Leu-Systemin. Plant Commun. 2023, 4, 100638. [Google Scholar] [CrossRef]
- Wang, L.; Einig, E.; Almeida-Trapp, M.; Albert, M.; Fliegmann, J.; Mithöfer, A.; Kalbacher, H.; Felix, G. The Systemin Receptor SYR1 Enhances Resistance of Tomato against Herbivorous Insects. Nat. Plants 2018, 4, 152–156. [Google Scholar] [CrossRef]
- Pearce, G.; Moura, D.S.; Stratmann, J.; Ryan, C.A. Production of Multiple Plant Hormones from a Single Polyprotein Precursor. Nature 2001, 411, 817–820. [Google Scholar] [CrossRef]
- Chen, Y.-L.; Fan, K.-T.; Hung, S.-C.; Chen, Y.-R. The Role of Peptides Cleaved from Protein Precursors in Eliciting Plant Stress Reactions. New Phytol. 2020, 225, 2267–2282. [Google Scholar] [CrossRef]
- Huffaker, A.; Pearce, G.; Ryan, C.A. An Endogenous Peptide Signal in Arabidopsis Activates Components of the Innate Immune Response. Proc. Natl. Acad. Sci. USA 2006, 103, 10098–10103. [Google Scholar] [CrossRef]
- Huffaker, A.; Ryan, C.A. Endogenous Peptide Defense Signals in Arabidopsis Differentially Amplify Signaling for the Innate Immune Response. Proc. Natl. Acad. Sci. USA 2007, 104, 10732–10736. [Google Scholar] [CrossRef]
- Huffaker, A.; Pearce, G.; Veyrat, N.; Erb, M.; Turlings, T.C.J.; Sartor, R.; Shen, Z.; Briggs, S.P.; Vaughan, M.M.; Alborn, H.T.; et al. Plant Elicitor Peptides Are Conserved Signals Regulating Direct and Indirect Antiherbivore Defense. Proc. Natl. Acad. Sci. USA 2013, 110, 5707–5712. [Google Scholar] [CrossRef] [PubMed]
- Bartels, S.; Lori, M.; Mbengue, M.; van Verk, M.; Klauser, D.; Hander, T.; Böni, R.; Robatzek, S.; Boller, T. The Family of Peps and Their Precursors in Arabidopsis: Differential Expression and Localization but Similar Induction of Pattern-Triggered Immune Responses. J. Exp. Bot. 2013, 64, 5309–5321. [Google Scholar] [CrossRef] [PubMed]
- Ruiz, C.; Nadal, A.; Foix, L.; Montesinos, L.; Montesinos, E.; Pla, M. Diversity of Plant Defense Elicitor Peptides within the Rosaceae. BMC Genet. 2018, 19, 11. [Google Scholar] [CrossRef] [PubMed]
- Lee, M.W.; Huffaker, A.; Crippen, D.; Robbins, R.T.; Goggin, F.L. Plant Elicitor Peptides Promote Plant Defences against Nematodes in Soybean. Mol. Plant Pathol. 2017, 19, 858–869. [Google Scholar] [CrossRef] [PubMed]
- Zelman, A.K.; Berkowitz, G.A. Plant Elicitor Peptide (Pep) Signaling and Pathogen Defense in Tomato. Plants 2023, 12, 2856. [Google Scholar] [CrossRef] [PubMed]
- Pearce, G.; Moura, D.S.; Stratmann, J.; Ryan, C.A. RALF, a 5-kDa Ubiquitous Polypeptide in Plants, Arrests Root Growth and Development. Proc. Natl. Acad. Sci. USA 2001, 98, 12843–12847. [Google Scholar] [CrossRef] [PubMed]
- Abarca, A.; Franck, C.M.; Zipfel, C. Family-Wide Evaluation of RAPID ALKALINIZATION FACTOR Peptides. Plant Physiol. 2021, 187, 996–1010. [Google Scholar] [CrossRef]
- Fletcher, J.C.; Brand, U.; Running, M.P.; Simon, R.; Meyerowitz, E.M. Signaling of Cell Fate Decisions by CLAVATA3 in Arabidopsis Shoot Meristems. Science 1999, 283, 1911–1914. [Google Scholar] [CrossRef]
- Cock, J.M.; McCormick, S. A Large Family of Genes That Share Homology with CLAVATA3. Plant Physiol. 2001, 126, 939–942. [Google Scholar] [CrossRef]
- Kondo, T.; Sawa, S.; Kinoshita, A.; Mizuno, S.; Kakimoto, T.; Fukuda, H.; Sakagami, Y. A Plant Peptide Encoded by CLV3 Identified by in Situ MALDI-TOF MS Analysis. Science 2006, 313, 845–848. [Google Scholar] [CrossRef]
- Hagelthorn, L.; Fletcher, J.C. The CLAVATA3/ESR-Related Peptide Family in the Biofuel Crop Pennycress. Front. Plant Sci. 2023, 14, 1240342. [Google Scholar] [CrossRef]
- Ito, Y.; Nakanomyo, I.; Motose, H.; Iwamoto, K.; Sawa, S.; Dohmae, N.; Fukuda, H. Dodeca-CLE Peptides as Suppressors of Plant Stem Cell Differentiation. Science 2006, 313, 842–845. [Google Scholar] [CrossRef]
- Ohyama, K.; Ogawa, M.; Matsubayashi, Y. Identification of a Biologically Active, Small, Secreted Peptide in Arabidopsis by in Silico Gene Screening, Followed by LC-MS-Based Structure Analysis. Plant J. 2008, 55, 152–160. [Google Scholar] [CrossRef] [PubMed]
- Roy, S.; Griffiths, M.; Torres-Jerez, I.; Sanchez, B.; Antonelli, E.; Jain, D.; Krom, N.; Zhang, S.; York, L.M.; Scheible, W.-R.; et al. Application of Synthetic Peptide CEP1 Increases Nutrient Uptake Rates Along Plant Roots. Front. Plant Sci. 2022, 12, 793145. [Google Scholar] [CrossRef] [PubMed]
- Meindl, T.; Boller, T.; Felix, G. The Plant Wound Hormone Systemin Binds with the N-Terminal Part to Its Receptor but Needs the C-Terminal Part to Activate It. Plant Cell 1998, 10, 1561–1570. [Google Scholar] [CrossRef] [PubMed]
- Scheer, J.; Ryan, C. A 160-kD Systemin Receptor on the Surface of Lycopersicon peruvianum Suspension-Cultured Cells. Plant Cell 1999, 11, 1525–1536. [Google Scholar] [CrossRef] [PubMed]
- Matsubayashi, Y.; Ogawa, M.; Morita, A.; Sakagami, Y. An LRR Receptor Kinase Involved in Perception of a Peptide Plant Hormone, Phytosulfokine. Science 2002, 296, 1470–1472. [Google Scholar] [CrossRef] [PubMed]
- Mosher, S.; Seybold, H.; Rodriguez, P.; Stahl, M.; Davies, K.A.; Dayaratne, S.; Morillo, S.A.; Wierzba, M.; Favery, B.; Keller, H.; et al. The Tyrosine-Sulfated Peptide Receptors PSKR1 and PSY1R Modify the Immunity of Arabidopsis to Biotrophic and Necrotrophic Pathogens in an Antagonistic Manner. Plant J. 2013, 73, 469–482. [Google Scholar] [CrossRef] [PubMed]
- Kinoshita, A.; Nakamura, Y.; Sasaki, E.; Kyozuka, J.; Fukuda, H.; Sawa, S. Gain-of-Function Phenotypes of Chemically Synthetic CLAVATA3/ESR-Related (CLE) Peptides in Arabidopsis thaliana and Oryza sativa. Plant Cell Physiol. 2007, 48, 1821–1825. [Google Scholar] [CrossRef]
- Ogawa, M.; Shinohara, H.; Sakagami, Y.; Matsubayash, Y. Arabidopsis CLV3 Peptide Directly Binds CLV1 Ectodomain. Science 2008, 319, 294. [Google Scholar] [CrossRef] [PubMed]
- Etchells, J.P.; Turner, S.R. The PXY-CLE41 Receptor Ligand Pair Defines a Multifunctional Pathway That Controls the Rate and Orientation of Vascular Cell Division. Development 2010, 137, 767–774. [Google Scholar] [CrossRef] [PubMed]
- Stegmann, M.; Monaghan, J.; Smakowska-Luzan, E.; Rovenich, H.; Lehner, A.; Holton, N.; Belkhadir, Y.; Zipfel, C. The Receptor Kinase FER Is a RALF-Regulated Scaffold Controlling Plant Immune Signaling. Science 2017, 355, 287–289. [Google Scholar] [CrossRef] [PubMed]
- Yamaguchi, Y.; Pearce, G.; Ryan, C.A. The Cell Surface Leucine-Rich Repeat Receptor for AtPep1, an Endogenous Peptide Elicitor in Arabidopsis, Is Functional in Transgenic Tobacco Cells. Proc. Natl. Acad. Sci. USA 2006, 103, 10104–10109. [Google Scholar] [CrossRef]
- Tabata, R.; Sumida, K.; Yoshii, T.; Ohyama, K.; Shinohara, H.; Matsubayashi, Y. Perception of Root-Derived Peptides by Shoot LRR-RKs Mediates Systemic N-Demand Signaling. Science 2014, 346, 343–346. [Google Scholar] [CrossRef] [PubMed]
- Matsuzaki, Y.; Ogawa-Ohnishi, M.; Mori, A.; Matsubayashi, Y. Secreted Peptide Signals Required for Maintenance of Root Stem Cell Niche in Arabidopsis. Science 2010, 329, 1065–1067. [Google Scholar] [CrossRef] [PubMed]
- Shinohara, H.; Mori, A.; Yasue, N.; Sumida, K.; Matsubayashi, Y. Identification of Three LRR-RKs Involved in Perception of Root Meristem Growth Factor in Arabidopsis. Proc. Natl. Acad. Sci. USA 2016, 113, 3897–3902. [Google Scholar] [CrossRef]
- Nakayama, T.; Shinohara, H.; Tanaka, M.; Baba, K.; Ogawa-Ohnishi, M.; Matsubayashi, Y. A Peptide Hormone Required for Casparian Strip Diffusion Barrier Formation in Arabidopsis Roots. Science 2017, 355, 284–286. [Google Scholar] [CrossRef]
- Chen, Y.-L.; Lee, C.-Y.; Cheng, K.-T.; Chang, W.-H.; Huang, R.-N.; Nam, H.G.; Chen, Y.-R. Quantitative Peptidomics Study Reveals That a Wound-Induced Peptide from PR-1 Regulates Immune Signaling in Tomato. Plant Cell 2014, 26, 4135–4148. [Google Scholar] [CrossRef]
- Skripnikov, A.I.; Anikanov, N.A.; Kazakov, V.S.; Dolgov, S.V.; Ziganshin, R.K.; Govorun, V.M.; Ivanov, V.T. Exploration and identification of Physcomitrella patens moss peptides. Bioorg. Khim. 2011, 37, 108–118. [Google Scholar] [CrossRef]
- Fesenko, I.A.; Arapidi, G.P.; Skripnikov, A.Y.; Alexeev, D.G.; Kostryukova, E.S.; Manolov, A.I.; Altukhov, I.A.; Khazigaleeva, R.A.; Seredina, A.V.; Kovalchuk, S.I.; et al. Specific Pools of Endogenous Peptides Are Present in Gametophore, Protonema, and Protoplast Cells of the Moss Physcomitrella patens. BMC Plant Biol. 2015, 15, 87. [Google Scholar] [CrossRef]
- Mohd-Radzman, N.A.; Binos, S.; Truong, T.T.; Imin, N.; Mariani, M.; Djordjevic, M.A. Novel MtCEP1 Peptides Produced in Vivo Differentially Regulate Root Development in Medicago truncatula. J. Exp. Bot. 2015, 66, 5289–5300. [Google Scholar] [CrossRef] [PubMed]
- Matsubayashi, Y. Posttranslationally Modified Small-Peptide Signals in Plants. Annu. Rev. Plant Biol. 2014, 65, 385–413. [Google Scholar] [CrossRef] [PubMed]
- Meng, L.; Buchanan, B.B.; Feldman, L.J.; Luan, S. CLE-like (CLEL) Peptides Control the Pattern of Root Growth and Lateral Root Development in Arabidopsis. Proc. Natl. Acad. Sci. USA 2012, 109, 1760–1765. [Google Scholar] [CrossRef] [PubMed]
- Whitford, R.; Fernandez, A.; Tejos, R.; Pérez, A.C.; Kleine-Vehn, J.; Vanneste, S.; Drozdzecki, A.; Leitner, J.; Abas, L.; Aerts, M.; et al. GOLVEN Secretory Peptides Regulate Auxin Carrier Turnover during Plant Gravitropic Responses. Dev. Cell 2012, 22, 678–685. [Google Scholar] [CrossRef] [PubMed]
- Butenko, M.A.; Patterson, S.E.; Grini, P.E.; Stenvik, G.-E.; Amundsen, S.S.; Mandal, A.; Aalen, R.B. Inflorescence Deficient in Abscission Controls Floral Organ Abscission in Arabidopsis and Identifies a Novel Family of Putative Ligands in Plants. Plant Cell 2003, 15, 2296–2307. [Google Scholar] [CrossRef] [PubMed]
- Bubici, G.; Carluccio, A.V.; Stavolone, L.; Cillo, F. Prosystemin Overexpression Induces Transcriptional Modifications of Defense-Related and Receptor-like Kinase Genes and Reduces the Susceptibility to Cucumber Mosaic Virus and Its Satellite RNAs in Transgenic Tomato Plants. PLoS ONE 2017, 12, e0171902. [Google Scholar] [CrossRef] [PubMed]
- Wu, H.; Zheng, R.; Hao, Z.; Meng, Y.; Weng, Y.; Zhou, X.; Zhu, L.; Hu, X.; Wang, G.; Shi, J.; et al. Cunninghamia lanceolata PSK Peptide Hormone Genes Promote Primary Root Growth and Adventitious Root Formation. Plants 2019, 8, 520. [Google Scholar] [CrossRef] [PubMed]
- Kou, X.; Liu, Q.; Sun, Y.; Wang, P.; Zhang, S.; Wu, J. The Peptide PbrPSK2 From Phytosulfokine Family Induces Reactive Oxygen Species (ROS) Production to Regulate Pear Pollen Tube Growth. Front. Plant Sci. 2020, 11, 601993. [Google Scholar] [CrossRef] [PubMed]
- Ampomah-Dwamena, C.; Tomes, S.; Thrimawithana, A.H.; Elborough, C.; Bhargava, N.; Rebstock, R.; Sutherland, P.; Ireland, H.; Allan, A.C.; Espley, R.V. Overexpression of PSY1 Increases Fruit Skin and Flesh Carotenoid Content and Reveals Associated Transcription Factors in Apple (Malus × domestica). Front. Plant Sci. 2022, 13, 967143. [Google Scholar] [CrossRef]
- Fiers, M.; Golemiec, E.; Xu, J.; van der Geest, L.; Heidstra, R.; Stiekema, W.; Liu, C.-M. The 14–Amino Acid CLV3, CLE19, and CLE40 Peptides Trigger Consumption of the Root Meristem in Arabidopsis through a CLAVATA2-Dependent Pathway. Plant Cell 2005, 17, 2542–2553. [Google Scholar] [CrossRef]
- Stahl, Y.; Wink, R.H.; Ingram, G.C.; Simon, R. A Signaling Module Controlling the Stem Cell Niche in Arabidopsis Root Meristems. Curr. Biol. 2009, 19, 909–914. [Google Scholar] [CrossRef]
- Berckmans, B.; Kirschner, G.; Gerlitz, N.; Stadler, R.; Simon, R. CLE40 Signaling Regulates Root Stem Cell Fate. Plant Physiol. 2020, 182, 1776–1792. [Google Scholar] [CrossRef]
- Stührwohldt, N.; Ehinger, A.; Thellmann, K.; Schaller, A. Processing and Formation of Bioactive CLE40 Peptide Are Controlled by Posttranslational Proline Hydroxylation. Plant Physiol. 2020, 184, 1573–1584. [Google Scholar] [CrossRef] [PubMed]
- Breiden, M.; Olsson, V.; Blümke, P.; Schlegel, J.; Gustavo-Pinto, K.; Dietrich, P.; Butenko, M.A.; Simon, R. The Cell Fate Controlling CLE40 Peptide Requires CNGCs to Trigger Highly Localized Ca2+ Transients in Arabidopsis thaliana Root Meristems. Plant Cell Physiol. 2021, 62, 1290–1301. [Google Scholar] [CrossRef] [PubMed]
- Whitewoods, C.D.; Cammarata, J.; Venza, Z.N.; Sang, S.; Crook, A.D.; Aoyama, T.; Wang, X.Y.; Waller, M.; Kamisugi, Y.; Cuming, A.C.; et al. CLAVATA Was a Genetic Novelty for the Morphological Innovation of 3D Growth in Land Plants. Curr. Biol. 2018, 28, 2365–2376.e5. [Google Scholar] [CrossRef] [PubMed]
- Stenvik, G.-E.; Tandstad, N.M.; Guo, Y.; Shi, C.-L.; Kristiansen, W.; Holmgren, A.; Clark, S.E.; Aalen, R.B.; Butenko, M.A. The EPIP Peptide of INFLORESCENCE DEFICIENT IN ABSCISSION Is Sufficient to Induce Abscission in Arabidopsis through the Receptor-Like Kinases HAESA and HAESA-LIKE2. Plant Cell 2008, 20, 1805–1817. [Google Scholar] [CrossRef] [PubMed]
- Kumpf, R.P.; Shi, C.-L.; Larrieu, A.; Stø, I.M.; Butenko, M.A.; Péret, B.; Riiser, E.S.; Bennett, M.J.; Aalen, R.B. Floral Organ Abscission Peptide IDA and Its HAE/HSL2 Receptors Control Cell Separation during Lateral Root Emergence. Proc. Natl. Acad. Sci. USA 2013, 110, 5235–5240. [Google Scholar] [CrossRef] [PubMed]
- Estornell, L.H.; Wildhagen, M.; Pérez-Amador, M.A.; Talón, M.; Tadeo, F.R.; Butenko, M.A. The IDA Peptide Controls Abscission in Arabidopsis and Citrus. Front. Plant Sci. 2015, 6, 1003. [Google Scholar] [CrossRef]
- Stührwohldt, N.; Hohl, M.; Schardon, K.; Stintzi, A.; Schaller, A. Post-Translational Maturation of IDA, a Peptide Signal Controlling Floral Organ Abscission in Arabidopsis. Commun. Integr. Biol. 2017, 11, e1395119. [Google Scholar] [CrossRef]
- Ventimilla, D.; Velázquez, K.; Ruiz-Ruiz, S.; Terol, J.; Pérez-Amador, M.A.; Vives, M.C.; Guerri, J.; Talon, M.; Tadeo, F.R. IDA (INFLORESCENCE DEFICIENT IN ABSCISSION)-like Peptides and HAE (HAESA)-like Receptors Regulate Corolla Abscission in Nicotiana benthamiana Flowers. BMC Plant Biol. 2021, 21, 226. [Google Scholar] [CrossRef]
- Taleski, M.; Chapman, K.; Novák, O.; Schmülling, T.; Frank, M.; Djordjevic, M.A. CEP Peptide and Cytokinin Pathways Converge on CEPD Glutaredoxins to Inhibit Root Growth. Nat. Commun. 2023, 14, 1683. [Google Scholar] [CrossRef]
- Ruiz, C.; Nadal, A.; Montesinos, E.; Pla, M. Novel Rosaceae Plant Elicitor Peptides as Sustainable Tools to Control Xanthomonas arboricola pv. pruni in Prunus spp. Mol. Plant Pathol. 2018, 19, 418–431. [Google Scholar] [CrossRef]
- Poretsky, E.; Dressano, K.; Weckwerth, P.; Ruiz, M.; Char, S.N.; Shi, D.; Abagyan, R.; Yang, B.; Huffaker, A. Differential Activities of Maize Plant Elicitor Peptides as Mediators of Immune Signaling and Herbivore Resistance. Plant J. 2020, 104, 1582–1602. [Google Scholar] [CrossRef]
- Wang, A.; Guo, J.; Wang, S.; Zhang, Y.; Lu, F.; Duan, J.; Liu, Z.; Ji, W. BoPEP4, a C-Terminally Encoded Plant Elicitor Peptide from Broccoli, Plays a Role in Salinity Stress Tolerance. Int. J. Mol. Sci. 2022, 23, 3090. [Google Scholar] [CrossRef]
- Constabel, C.P.; Yip, L.; Ryan, C.A. Prosystemin from Potato, Black Nightshade, and Bell Pepper: Primary Structure and Biological Activity of Predicted Systemin Polypeptides. Plant Mol. Biol. 1998, 36, 55–62. [Google Scholar] [CrossRef]
- Pearce, G.; Bhattacharya, R.; Chen, Y.-C. Peptide Signals for Plant Defense Display a More Universal Role. Plant Signal Behav. 2008, 3, 1091–1092. [Google Scholar] [CrossRef]
- Schardon, K.; Hohl, M.; Graff, L.; Pfannstiel, J.; Schulze, W.; Stintzi, A.; Schaller, A. Precursor Processing for Plant Peptide Hormone Maturation by Subtilisin-like Serine Proteinases. Science 2016, 354, 1594–1597. [Google Scholar] [CrossRef] [PubMed]
- Olsson, V.; Joos, L.; Zhu, S.; Gevaert, K.; Butenko, M.A.; De Smet, I. Look Closely, the Beautiful May Be Small: Precursor-Derived Peptides in Plants. Annu. Rev. Plant Biol. 2019, 70, 153–186. [Google Scholar] [CrossRef] [PubMed]
- Yamaguchi, Y.; Huffaker, A.; Bryan, A.C.; Tax, F.E.; Ryan, C.A. PEPR2 Is a Second Receptor for the Pep1 and Pep2 Peptides and Contributes to Defense Responses in Arabidopsis. Plant Cell 2010, 22, 508–522. [Google Scholar] [CrossRef] [PubMed]
- Xu, L.; Li, S.; Shabala, S.; Jian, T.; Zhang, W. Plants Grown in Parafilm-Wrapped Petri Dishes Are Stressed and Possess Altered Gene Expression Profile. Front. Plant Sci. 2019, 10, 637. [Google Scholar] [CrossRef] [PubMed]
- Whitford, R.; Fernandez, A.; Groodt, R.D.; Ortega, E.; Hilson, P. Plant CLE Peptides from Two Distinct Functional Classes Synergistically Induce Division of Vascular Cells. Proc. Natl. Acad. Sci. USA 2008, 105, 18625–18630. [Google Scholar] [CrossRef] [PubMed]
- Meng, L.; Buchanan, B.B.; Feldman, L.J.; Luan, S. A Putative Nuclear CLE-Like (CLEL) Peptide Precursor Regulates Root Growth in Arabidopsis. Mol. Plant 2012, 5, 955–957. [Google Scholar] [CrossRef] [PubMed]
- Konovalov, A.I.; Ryzhkina, I.S.; Salakhutdinova, O.A.; Murtazina, L.I.; Shevelev, M.D.; Voeikov, V.L.; Buravleva, E.V.; Glybin, A.V.; Skripnikov, A.Y. Effect of Self-Organization and Properties of Aqueous Disperse Systems Based on the Moss Peptide PpCLE2 in a Low Concentration Range on the Growth of Arabidopsis thaliana Roots. Russ. Chem. Bull. 2017, 66, 1699–1705. [Google Scholar] [CrossRef]
- Imin, N.; Mohd-Radzman, N.A.; Ogilvie, H.A.; Djordjevic, M.A. The Peptide-Encoding CEP1 Gene Modulates Lateral Root and Nodule Numbers in Medicago truncatula. J. Exp. Bot. 2013, 64, 5395–5409. [Google Scholar] [CrossRef]
- Sauter, M. Phytosulfokine Peptide Signalling. J. Exp. Bot. 2015, 66, 5161–5169. [Google Scholar] [CrossRef]
- Matsubayashi, Y.; Takagi, L.; Sakagami, Y. Phytosulfokine-, a Sulfated Pentapeptide, Stimulates the Proliferation of Rice Cells by Means of Specific High- and Low-Affinity Binding Sites. Proc. Natl. Acad. Sci. USA 1997, 94, 13357–13362. [Google Scholar] [CrossRef]
- Yamaguchi, Y.L.; Ishida, T.; Sawa, S. CLE Peptides and Their Signaling Pathways in Plant Development. J. Exp. Bot. 2016, 67, 4813–4826. [Google Scholar] [CrossRef]
- Pearce, G.; Ryan, C.A. Systemic Signaling in Tomato Plants for Defense against Herbivores. Isolation and Characterization of Three Novel Defense-Signaling Glycopeptide Hormones Coded in a Single Precursor Gene. J. Biol. Chem. 2003, 278, 30044–30050. [Google Scholar] [CrossRef]
- Campbell, L.; Turner, S.R. A Comprehensive Analysis of RALF Proteins in Green Plants Suggests There Are Two Distinct Functional Groups. Front. Plant Sci. 2017, 8, 37. [Google Scholar] [CrossRef]
- Murphy, E.; De Smet, I. Understanding the RALF Family: A Tale of Many Species. Trends Plant Sci. 2014, 19, 664–671. [Google Scholar] [CrossRef] [PubMed]
- Lori, M.; van Verk, M.C.; Hander, T.; Schatowitz, H.; Klauser, D.; Flury, P.; Gehring, C.A.; Boller, T.; Bartels, S. Evolutionary Divergence of the Plant Elicitor Peptides (Peps) and Their Receptors: Interfamily Incompatibility of Perception but Compatibility of Downstream Signalling. J. Exp. Bot. 2015, 66, 5315–5325. [Google Scholar] [CrossRef] [PubMed]
- Zhang, L.; Gleason, C. Enhancing Potato Resistance against Root-Knot Nematodes Using a Plant-Defence Elicitor Delivered by Bacteria. Nat. Plants 2020, 6, 625–629. [Google Scholar] [CrossRef] [PubMed]
- Moroz, N.; Fritch, K.R.; Marcec, M.J.; Tripathi, D.; Smertenko, A.; Tanaka, K. Extracellular Alkalinization as a Defense Response in Potato Cells. Front. Plant Sci. 2017, 8, 32. [Google Scholar] [CrossRef] [PubMed]
- Moroz, N.; Huffaker, A.; Tanaka, K. Extracellular Alkalinization Assay for the Detection of Early Defense Response. Curr. Protoc. Plant Biol. 2017, 2, 210–220. [Google Scholar] [CrossRef]
- Hu, Z.; Zhang, H.; Shi, K. Plant Peptides in Plant Defense Responses. Plant Signal Behav. 2018, 13, e1475175. [Google Scholar] [CrossRef]
- Huffaker, A. Plant Elicitor Peptides in Induced Defense against Insects. Curr. Opin. Insect Sci. 2015, 9, 44–50. [Google Scholar] [CrossRef]
Peptide, Reference Amino Acid Sequence, Plant Species | Methods of Isolation and Identification | Bioassay/Plant Species | Effective Concentration | Biological Activity | Receptor, Reference |
---|---|---|---|---|---|
Systemin [6] AVQSKPPSKRDPPKMQTD Solanum lycopersicum | Bioassay-guided purification, Edman degradation | Proteinase inhibitor quantification in plant cuttings of Solanum lycopersicum | 40 pM | Regulation of systemic response to herbivore attack | SYR1 [36,37] |
PSK (Phytosulfokine) [9] YIYTQ Asparagus officinalis | Bioassay-guided purification, Edman degradation, LC-MS/MS | Cellular mitogenic bioassay based on the suspension of cultivated cells of Asparagus officinalis | 1 nM–1 μM | Regulation of cell division and expansion | PSKR1 [38] PSKR2 [9] |
PSY1 (Plant peptide containing sulfated tyrosine 1) [9] DYGDPSANPKHDPGVPPS Arabidopsis thaliana | Bioassay-guided purification, Edman degradation, LC-MS/MS | Cellular mitogenic bioassay based on the suspension of cultivated cells of Asparagus officinalis Root growth bioassay based on Arabidopsis thaliana seedlings | 1 nM–0.1 μM | Regulation of cell division and expansion | PSY1R [39] |
CLV3 (CLAVATA3) [31,40] RTVPSGPDPLHH Arabidopsis thaliana | Overexpression of precursor, MALDI-TOF—MS/MS | Root growth bioassay based on Arabidopsis thaliana and Oryza sativa seedlings Cellular differentiation bioassay based on the suspension of cultivated cells of Zinnia elegans | 1 μM | Regulation of cell proliferation in the meristem | CLV1 [41] |
TDIF (Tracheary element differentiation inhibitory factor) [31] HEVPSGPNPISN Zinnia elegans | Bioassay-guided purification, Edman degradation, LC-MS/MS | Cellular differentiation bioassay based on the suspension of cultivated cells of Zinnia elegans Root growth bioassay based on Arabidopsis thaliana seedlings | 10 pM–8 nM | Regulation of differentiation of vascular cells | PXY [42] |
HypSys (Hydroxyproline-rich systemins) [18] RGANLPPPSPASSPPSKE Nicotiana tabacum | Bioassay-guided purification, Edman degradation, LC-MS/MS | Alkalinization cellular bioassay based on suspension cultivated cells of Nicotiana tabacum | 0.2 nM–2 nM | Regulation of stress and defense reactions | n.d. |
RALF * (Rapid alkalinization factor) [27] ATKKYISYGALQKNSVPCSRRGASY-YNCKPGAQANPYSRGCSAITRCRS Nicotiana tabacum | Bioassay-guided purification, Edman degradation, LC-MS/MS | Alkalinization cellular bioassay based on suspension cultivated cells of Nicotiana tabacum and Solanum lycopersicum Root growth bioassay based on Arabidopsis thaliana and Solanum lycopersicum seedlings | 2–10 nM (Alkalinization bioassay) 1 μM (Root growth bioassay) | Regulation of growth, development and stress reactions | FER [43] |
AtPep1 (plant elicitor peptide) [20,22] ATKVKAKQRGKEKVSSGRPGQHN Arabidopsis thaliana | Bioassay-guided purification, Edman degradation, LC-MS/MS | Alkalinization cellular bioassay based on suspension of cultivated cells of Nicotiana tabacum | 10 nM | Activating signaling pathways associated with stress and defense responses | PEPR1 [44] |
CLE44 (CLAVATA3/EMBRYO SURROUNDING REGION-related 44) [34] HEVPSGPNPISN Arabidopsis thaliana | In silico screening and overexpression of precursor, LC-MS/MS | Cellular differentiation bioassay based on the suspension of cultivated cells of Zinnia elegans Root growth bioassay based on Arabidopsis thaliana seedlings | 10 pM–8 nM | Regulation of differentiation of vascular cells | PXY [42] |
CEP1 (C-terminally encoded peptide) [34] DFRPTNPGNSPGVGH Arabidopsis thaliana | In silico screening and overexpression of precursor LC-MS/MS | Root growth bioassay based on Arabidopsis thaliana seedlings | 1 μM | Root growth and development | CEPR1 [45] CEPR2 [45] |
RGF1 (Root meristem growth factor 1) [46] DYSNPPGHHPPRHN Arabidopsis thaliana | In silico screening and overexpression of precursor LC-MS/MS | Root growth bioassay based on Arabidopsis thaliana seedlings | 100 pM–100 nM | Root growth and development | RGRF1 RGFR2 RGFR3 [47] |
CIF1 (Casparian strip integrity factor 1) [48] DYGNNSPSPRLERPPFKLIPN Arabidopsis thaliana | In silico screening and overexpression of precursor LC-MS/MS | Root growth bioassay based on Arabidopsis thaliana seedlings | 100 nM | Promoting lignin deposition and reinforcing the structural integrity of the endodermal layer | GSO1/ SGN3 [48] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the author. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Skripnikov, A. Bioassays for Identifying and Characterizing Plant Regulatory Peptides. Biomolecules 2023, 13, 1795. https://doi.org/10.3390/biom13121795
Skripnikov A. Bioassays for Identifying and Characterizing Plant Regulatory Peptides. Biomolecules. 2023; 13(12):1795. https://doi.org/10.3390/biom13121795
Chicago/Turabian StyleSkripnikov, Alexander. 2023. "Bioassays for Identifying and Characterizing Plant Regulatory Peptides" Biomolecules 13, no. 12: 1795. https://doi.org/10.3390/biom13121795