Next Article in Journal
Application of Clove Oil and Sonication Process on the Influence of the Functional Properties of Mung Bean Flour-Based Edible Film
Next Article in Special Issue
Formation of a Fully Anionic Supported Lipid Bilayer to Model Bacterial Inner Membrane for QCM-D Studies
Previous Article in Journal
Array of Graphene Variable Capacitors on 100 mm Silicon Wafers for Vibration-Based Applications
Previous Article in Special Issue
Deciphering the Assembly of Enveloped Viruses Using Model Lipid Membranes
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Infrared Spectroscopic Study of Multi-Component Lipid Systems: A Closer Approximation to Biological Membrane Fluidity

by
Maria C. Klaiss-Luna
and
Marcela Manrique-Moreno
*
Chemistry Institute, Faculty of Exact and Natural Sciences, University of Antioquia, A.A. 1226, Medellin 050010, Colombia
*
Author to whom correspondence should be addressed.
Membranes 2022, 12(5), 534; https://doi.org/10.3390/membranes12050534
Submission received: 9 April 2022 / Revised: 5 May 2022 / Accepted: 16 May 2022 / Published: 20 May 2022
(This article belongs to the Special Issue Model Lipid Membrane)

Abstract

Membranes are essential to cellular organisms, and play several roles in cellular protection as well as in the control and transport of nutrients. One of the most critical membrane properties is fluidity, which has been extensively studied, using mainly single component systems. In this study, we used Fourier transform infrared spectroscopy to evaluate the thermal behavior of multi-component supported lipid bilayers that mimic the membrane composition of tumoral and non-tumoral cell membranes, as well as microorganisms such as Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus. The results showed that, for tumoral and non-tumoral membrane models, the presence of cholesterol induced a loss of cooperativity of the transition. However, in the absence of cholesterol, the transitions of the multi-component lipid systems had sigmoidal curves where the gel and fluid phases are evident and where main transition temperatures were possible to determine. Additionally, the possibility of designing multi-component lipid systems showed the potential to obtain several microorganism models, including changes in the cardiolipin content associated with the resistance mechanism in Staphylococcus aureus. Finally, the potential use of multi-component lipid systems in the determination of the conformational change of the antimicrobial peptide LL-37 was studied. The results showed that LL-37 underwent a conformational change when interacting with Staphylococcus aureus models, instead of with the erythrocyte membrane model. The results showed the versatile applications of multi-component lipid systems studied by Fourier transform infrared spectroscopy.

1. Introduction

All cellular organisms have a thin, fluid, and flexible membrane based on lipids that define them as units, separates them from their surroundings, and participates in several physiological processes [1]. Biological membranes have diverse functions and compositions; however, they have a common and critical property called fluidity [2,3,4]. Membrane fluidity is a complex concept that from a physicochemical view is an elastomechanical property. However, it includes several parameters such as structure, composition and disposition of membrane lipids that contribute to the state of the membrane. The complex diversity of lipid types creates a delicate balance that regulates the structural properties of biomembranes, and therefore the environment for proteins and other membrane components, and this is associated with the flexibility needed for cellular morphological transformation including division, differentiation, and general adaptation for each kind of membrane [5,6]. These processes are associated with molecular motion within a lipid bilayer and activity regulation of other molecules, including membrane-bound proteins. It was reported that abnormalities in the physical properties of cell membranes may underlie the defects that are strongly linked to hypertension, stroke and other cardiovascular diseases [7,8], diabetes mellitus [9], and Alzheimers [10]. Therefore, studies of the relationships between fluidity and phase transitions in membranes are relevant. For this reason, there has been a great interest in the use of artificial model lipid membranes with a simplified composition to study membrane properties, structure, and activity of natural or synthetic compounds [11].
There are several techniques used for studying a wide variety of temperature-induced transitions in biological systems such as Differential Scanning Calorimetry (DSC) [12]. DSC is a non-perturbing thermodynamic technique that measures the heat exchange associated with cooperative lipid phase transitions in model and biological membranes. This technique is useful not only in determining thermotropic phase behavior (Tm) and energy, but also in obtaining information on the cooperativity of the transitions [13]. The most important parameters obtained by DSC are the change in the main phase transition temperature, the width of the main transition peak (cooperativity) and the enthalpy change (ΔH) associated with the process. One of the most common techniques used for studying a membrane state is fluorescence spectroscopy. The technique is based on the use of membrane probes such as 6-dodecanoyl-2-dimethylaminonaphthalene (laurdan) and 1,6-diphenyl-1,3,5-hexatriene (DPH) [14,15]. The Laurdan fluorescent spectrum is sensitive to polarity (hydration level), dipolar dynamics of the environment and the phase state of phospholipid bilayers [16]. Therefore, laurdan provides information about molecular dynamics at the level of the glycerol backbone and can distinguish whether a membrane is in a gel or liquid-crystalline state. The laurdan molecule is strongly anchored in the hydrophobic core of the bilayer by hydrophobic interactions between its lauric acid tail and the lipid alkyl tails while the fluorescent moiety is located at the glycerol level of the phospholipid headgroups [17]. The fluorescent probe DPH was widely used to study the structure and dynamic properties of the model and natural membranes. DPH was originally proposed as a probe to estimate the microviscosity of cell membranes and the rigidity of binding sites on proteins [14].
Another technique extensively used in the study of membrane properties is Fourier transform infrared spectroscopy (FT-IR). Chemical bonds undergo different forms of vibrations such as stretching, twisting and rotating. The energy of most molecular vibrations corresponds to the infrared region of the electromagnetic spectrum. Infrared spectroscopy measures these vibrations and provides information about molecular structure and structural interactions. One of the most important advantages of FT-IR spectroscopy is that experiments with biomolecules and without the addition of probes can be performed in diverse environments such as water, thin films, organic solvents, detergent micelles and lipid bilayer matrix [18]. Applications such as attenuated total reflection (ATR) provide rapid and sensitive monitoring of one of the most important physicochemical parameters of membranes, fluidity. If an exogenous molecule interacts with the phospholipid bilayer, changes can be detected and monitored [18].
However, the simplification of model membranes used in these techniques was extensively questioned on the basis that it does not represent the membrane properly, especially the fluidity, charge, and lipid headgroup complexity [19]. For this reason, the aim of this study was to use multi-component lipid systems in order to understand the direct relationship of membrane lipid composition to fluidity, and how these complex systems represent a better approximation between Gram-negative and Gram-positive bacteria and, in eukaryotes, between cancer and non-cancer cell membranes. Additionally, we used two multi-component lipid systems that represent the bacterial and erythrocyte cell membranes to study the conformational change undergone by a recognized peptide such as LL-37. Human cathelicidin LL-37 is a well-studied peptide with a + 6 charge at pH 7.4 that has several physiological roles in the body, being recognized for its antimicrobial, antifungal and antiviral activities [20,21,22,23]. When the peptide interacts with membranes it assumes an α-helical structure that was reported by circular dichroism [24,25].

2. Materials and Methods

2.1. Chemical Reagents

1,2-dimyristoyl-sn-glycero-3-phosphoglycerol sodium salt (DMPG, Lot. 140PG-167), 1’,3’-bis [1,2-dimyristoleoyl-sn-glycero-3-phospho]-glycerol sodium salt (CL, Lot. 750332P-200MG-A-030), 1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine (DMPE, Lot. 140PE-63), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC, Lot. 160PC-318), Sphingomyelin Egg Chicken (SM, Lot. 860061P-25MG-A-116), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE, Lot. 160PE-106), 1,2-dipalmitoyl-sn-glycero-3-phospho-L-serine (sodium salt), (DPPS, Lot. 840037P-500MG-A-078CL750332P-200MG-A-030) and Cholesterol (CH, Lot. CH-92) were purchased from Avanti Polar Lipids (Alabaster, AL, USA). Breast cancer cell line MCF-7 (HTB-22™) was purchased from ATCC® (Manassas, VA, USA). HPLC-grade methanol and chloroform were purchased from Merck (Kenilworth, NJ, USA). HEPES was purchased from Sigma-Aldrich (St. Louis, MO, USA), NaCl from Carlo Erba (Val de Reuil, NOR, FR) and EDTA from Amresco (Solon, OH, USA).
LL-37 peptide ([LL-37, 37 aa], Lot. V1440EE070/PE1324) was purchased from GenScript (Piscataway Township, NJ, USA) and synthesized according to the sequence by solid-phase method. The purity of the peptide was determined to be higher than 95% by analytical HPLC, TFA removal was performed, and the molecular weight was confirmed with MALDI-TOF mass spectrometry.

2.2. Cell Cultures and Lipid Extraction

MCF-7 breast cancer cell line (ATCC HTB-22) was cultured in Dulbecco’s modified Eagle’s medium (DMEM), supplemented with 5% fetal calf serum, 100 µg/mL penicillin and 100 µg/mL streptomycin. The cells were grown at 37 °C in a humidified incubator with 5% CO2/95% air. Cell cultures were examined under a microscope for correct morphology, adherence, and exponential growth. To extract the lipids, cells were trypsinized, pelleted, washed with 2 mL of water and re-centrifuged at 6000 rpm for 15 min at 4 °C in 15 mL polyethylene centrifuge tubes. The supernatant was discarded, while the pellet was freeze-dried (Chamber temperature −60 °C, SP Scientific, Gardiner, NY, USA, pressure < 7 × 10−1 mbar).
Lipid extraction was performed according to the two-step Bligh and Dyer lipid extraction method suitable for samples in incubation medium, tissue or cell suspensions [26]. A total of 65 mg of MCF-7 cells were weighed in a clean test tube and resuspended in 5 mL deionized water, and the mixture was then vortexed for homogenization. The cell suspension was quantitatively transferred into a clean glass separatory funnel. The tube was rinsed with 5 mL deionized water. A total volume of 96 mL of solvent consisting of chloroform, methanol and water (1:2:0.8; v/v/v) was then added. The samples were shaken for 20 s immediately after the solvent had been added and allowed to stand for about 18 h, with occasional shaking. Phase separation of the biomass–solvent mixtures in the separatory funnels involved adding chloroform and water to each separation funnel to obtain a final chloroform–methanol–water ratio of 1:1:0.4 (v/v/v). The chloroform phase was transferred into a clean 50 mL flask bottle to remove the solvent and concentrate the samples, which were then washed 3 times at the same volume of 0.9% NaCl (w/v). The organic phase containing the lipid extract was collected and concentrated by evaporating the solvent under a stream of nitrogen.

2.3. Phase Transition Measurements by Infrared Spectroscopy

Supported lipid bilayers (SLBs) were prepared in situ in a BioATR II cell. The unit was integrated with a Tensor II spectrometer (Bruker Optics, Ettlingen, Germany) with a liquid nitrogen MCT detector using a spectral resolution of 4 cm−1 and 120 scans per spectrum. The desired temperature was set by a Huber Ministat 125 computer-controlled circulating water bath (Huber, Offenburg, Germany) with an accuracy of ±0.1 °C. First, the background was taken using 20 mM HEPES buffer, 500 mM NaCl and 1 mM EDTA in the same temperature range. Subsequently, to coat the silicon crystal, stock solutions of the different lipid systems were dissolved in chloroform. The preparation of stock solutions was carried out depending on the lipid system to analyze. For non-tumoral and tumoral membrane composition this was DPPC/SM/DPPE 4.35:4.35:1 (w/w) and DPPC/SM/DPPE/DPPS/3.85:3.85:0.8:1.5 (w/w), respectively [27,28]. For Escherichia coli (E. coli) lipid system it was PE:PG:CL 75:20:5 [29]. For Pseudomonas aeruginosa (P. aeruginosa) lipid system it was PE:PG:CL 65:23:12 (w/w) [30]. Finally, for Staphylococcus aureus (S. aureus) lipid system it was DMPG:CL 80:20 (w/w) [31].
The cell was filled with 20 µL of the lipid stock solution, and the chloroform was evaporated, resulting in a lipid multilayer film. For in situ measurements the cell was subsequently filled with 20 µL of buffer or peptide solution and incubated over the phase transition temperature for 10 min. To determine the position of the vibrational band in the range of the second derivative of the spectra, all the absorbance spectra were cut in the 2970–2820 cm−1 range, shifted to a zero baseline and the peak picking function included in OPUS software. The results were plotted as a function of the temperature. To determine the transition temperature (Tm) of the lipids, the curve was fitted according to the Boltzmann model to calculate the inflection point of the obtained thermal transition curves using the OriginPro 8.0 software (OriginLab Corporation, Northampton, MA, USA).

2.4. Determination of the Secondary Structure of LL-37 Using Multi-Component Lipid Systems

LL-37 Peptide solution was prepared at 1mM concentration in buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4). Appropriate amounts of DMPC:SM:DMPE (22:20:6) for erythrocyte membrane [32], and DMPG:CL (80:20) for S. aureus membrane [31] were weighed in order to obtain a 5 mM final concentration of representative liposomes. Lipids were dissolved in pure chloroform in a glass test tube, the solvent was dried under a stream of nitrogen and the traces were removed by keeping the samples under reduced pressure (about 13.3 Pa) for 30 min. Dried lipids were hydrated in buffer. Multilamellar vesicles (MLVs) were formed by sonicating the samples above the main phase transition temperature of the lipids for at least 15 min. For the determination of the secondary structure, LL-37 was added to the liposome suspension to obtain a 15 molar% concentration. The experiments were performed at 37 °C in an AquaSpec Cell (Bruker Optics, Ettlingen, Germany). The unit was integrated with a Tensor II spectrometer with a liquid nitrogen MCT using a spectral resolution of 4 cm−1 and 120 scans per spectrum. The secondary structure elements α-helix and β-sheet were predicted following the methods supplied by the ConfocheckTM system (Bruker Optics, Ettlingen, Germany). These methods calculate the secondary structure with a multivariate partial-least-squares algorithm (PLS) based on a calibration data set of 45 different proteins.

3. Results

3.1. Phase Transition Experiments by Infrared Spectroscopy

One of the most important physicochemical parameters to follow the lipid order and packing of the hydrophobic core of membranes is the wavenumber peak position of the νsCH2 band. Depending on the temperature, the lipid bilayer has different states. At lower temperatures, in the gel phase, νsCH2 lies around 2850 cm−1; while at higher temperatures, in the liquid crystalline phase, the band lies around 2853 cm−1. Following the phase transition, it is possible to calculate the main transition temperature (Tm) of a lipid system. The results of the phase transition measurements of four pure lipid systems are summarized in Figure 1. The change in the peak position of the symmetric stretching vibration band of the methylene group as a function of the temperature of the four pure lipids produced a sigmoidal curve, which reflects the high degree of molecular aggregation of these systems. The transitions of saturated phospholipids were shown to be highly cooperative events, with transition ranges of less than 0.1 °C. Afterward, multi-component lipid systems to mimic two cell membrane systems were prepared, considering the reported composition for cancer PC:SM:PE:PS (3.85:3.85:0.8:1.5 w/w), and non-cancer membranes PC:SM:PE (4.35:4.35:1 w/w) proposed by Li et al. [33] and Yeung and collaborators [28]. The results obtained by FT-IR are summarized in Figure 2. As expected, the phase transition for the multi-component lipid systems is broader than for the pure systems. However, obtaining a sigmoidal curve allows the same method as for pure lipid systems to be applied in order to determine the phase transition temperature through Boltzmann fitting. The Tm obtained for non-cancer and cancer cell membranes are 39.9 and 41.0 °C, respectively.
One important component of the eukaryotic cell membrane is cholesterol. For this reason, we evaluated a multi-component lipid system including cholesterol. Figure 3 shows the thermal behavior of the non-cancer model including cholesterol and the comparison of this with the thermal behavior of the total lipid extract from breast cancer cell line MCF-7. When cholesterol was included in the multi-component lipid system, the characteristic sigmoidal curve was lost. Analysis of the results of the phase transitions of multi-component lipid system and MCF-7 lipid extract showed that both systems exhibited similar thermal behavior, and the transitions obtained were more lineal than sigmoidal.
The results showed that transitions are broader than the previous results obtained in Figure 2. Nonetheless, there is a remarkable difference in the peak positions of the νsCH2 vibration; the vibration of the lipid extract is located at higher frequencies than the νsCH2 vibrations of the synthetic model, showing that the lipid extract is more fluid.
As part of our results, we also evaluated the thermal behavior of representative multi-component lipid systems of two Gram-negative bacterial membranes P. aeruginosa [30], and E. coli [29]. The results of these two lipid systems are represented in Figure 4. The results showed a very similar Tm of 45.6 and 45.9 °C for P. aeruginosa and E. coli, respectively. However, the SLBs behave differently in the two models, considering that the P. aeruginosa and E. coli systems have different proportions of PG:CL, lipids related with the electrostatic properties and the negative charge of the membrane surface in each model.
Finally, we studied a multi-component lipid system representative of S. aureus. The results of this are summarized in Figure 5. The pure lipid systems of PG and CL are included in the graph to compare the results obtained with the different proportions of PG:CL evaluated. The first model was the sensitive S. aureus, based on our previous results on lipid quantification of total lipids of S. aureus strain RN4220. We reported a ratio of PG:CL (80:20) [31]. However, for antibiotic-resistant and other S. aureus strains, different PG:CL ratios, such as 70:30 and 60:40, were reported [34,35]. As can be observed in the results, the extremes in the graph correspond to the pure PG and CL lipids. From the left side of the graph, increasing concentrations of CL caused an increase in the Tm of the model lipid system from 28.8 °C in the sensitive S. aureus model to 38.3 °C in the resistant model. Additionally, the increasing concentrations of CL in the gel phase for all the lipid systems induced a reduction in the νsCH2 vibration to lower wavenumbers.

3.2. Determination of the Secondary Structure of LL-37

Given that the structural conformation of antimicrobial peptides changes through interaction with membranes, we evaluated the conformational change in the human cathelicidin LL-37, a very highly-studied peptide, in two representative lipid systems. The obtained results are summarized in Table 1. Analysis of the secondary structure found that in the buffer, the LL-37 peptide was partially helical. In the case of the representative multi-component lipid system of erythrocyte membrane (DMPC:SM:DMPE) the results showed a conformational change of 8% of the LL-37 helical structure. However, when the peptide interacted with the bacterial model of S. aureus (DMPG:CL) the peptide acquired 63.1% of its secondary structure as an α-helix.

4. Discussion

Membranes are fluid, heterogeneous and dynamic systems. Fluidity is related to the viscosity of the lipid membrane, which is an important mechanical property of the cell membrane. It is an intensive and bulk property related to the translational, rotational, and vibrational movement of membrane lipids, with important consequences for other molecules inserted in the hydrophobic core such as proteins [36,37]. Increased fluidity enhances the free movement of phospholipid molecules and protein moieties in the membrane to facilitate various biological functions including ion transport, cell signaling and cell growth [10]. Fluidity is affected by lipid chemical structure, temperature, and cholesterol content [38]. In the case of fatty acids, fluidity has a characteristic value depending on the unsaturation and length of the acyl chains [39], and on the structure of the head groups of the phospholipid [40]. At low temperatures, the hydrocarbon chains of lipids are organized in an orderly arrangement called the gel state. In contrast, with increasing temperature, lipid molecules vibrate faster, causing fusion that leads to a liquid crystalline state, which is more fluid and disordered [2]. These phases consist of hydrated phospholipid aggregates. The aggregation process is driven by the hydrophobic effect of acyl chains. Therefore, transitions between phases can be induced by varying temperatures. For pure lipid systems, the temperature value where the lipids change state is called the main transition temperature (Tm). For multi-component lipid mixtures, Tm will correspond to a value depending on the participating lipids and their proportions. This thermal process is highly cooperative and easy to monitor using several techniques. Cholesterol has been extensively studied given its considerable effects on the conformation, fluidity and thermotropic properties of membranes [41,42,43,44]. Additionally, malignant cells have been described as more fluid, due to their lower cholesterol content than normal cells. This lower cholesterol content makes malignant cells more susceptible to membrane acting-drugs by facilitating the destabilization of the membrane [45].
One of the most versatile techniques to follow thermal behavior is Fourier transformed infrared spectroscopy. This allows monitoring of the order of the lipid acyl chains in terms of the symmetric vibration of CH2 of phospholipid molecules and the changes due to temperature, which is a measurement of fluidity. Low frequencies of methylene groups are associated with a less mobile phase and high frequencies with a high mobile state. In addition, this technique can be used to study the effects of changes in pH, solute concentration, and the interaction with exogenous agents [46] in the absence and presence of an agent as a function of temperature and at different lipid:compound ratios. Since biological membranes are very complex systems given the current understanding of lipid behavior, model membranes have been extensively used for study purposes instead of natural membranes. The most well-known biomimetic systems for such purposes are lipid monolayers, lipid vesicles, and supported lipid bilayers [47]. These models have been extensively studied using different biophysical techniques. These analytical or spectroscopic techniques are based on the fact that molecules can produce changes in the physical and thermodynamic properties of model membranes [48].
We worked with SLBs as model membranes to study the thermal behavior of several lipid systems. Analysis was carried out on symmetric stretching CH2 vibration through FT-IR as a function of temperature. The first step in the evaluation was obtaining the phase transitions of the pure lipids DPPC, DPPE, DPPS, and SM. The results of the pure lipid systems were sigmoidal functions representing the transitions from gel to the liquid-crystalline states. The temperature-dependent changes in the νsCH2 stretching band allowed the determination of the phase transition temperature for the studied SLBs. This method was based on calculating the second derivative of the sigmoidal curves. The results of the determination of the Tm were consistent with data previously reported in the literature using differential scanning calorimetry (DSC) [49,50,51,52], which is a very precise calorimetric technique to obtain the phase transitions of lipid suspensions [53].
Although pure lipid systems such as PC and PS have been extensively used to represent non-cancer and cancer cell membranes, respectively [54,55,56], these simplified models are far from representing the composition of a complex biological membrane. For this reason, the next step was to prepare multi-component lipid systems representative of both membranes. We used the composition reported by Almarwani et al. for the normal cell membrane, and an anionic phospholipid range of 10–20% for the cancer model, without including cholesterol in the multi-component lipid model [28]. In the absence of cholesterol, slightly broader sigmoidal curves were obtained, through which it was possible to calculate the Tm of the systems. The results showed that the temperatures obtained for non-tumoral and tumoral cells were 39.9 and 41.0 °C, respectively. These results could be considered similar, but the charge of the systems is not. The cancer model is slightly but not completely negatively charged at the surface, in comparison to a single-component system built exclusively from PS. The phosphatidylserine in the multi-component system is in principle distributed along the surface of the model membrane, which is more representative of a cancer cell membrane. It was extensively reported that malignant cells of several types of cancer lose their asymmetric distribution [57,58], which results in the exposure of the negatively charged PS on the surface of their membranes. In the case of the non-cancer cell membrane, there is no charge at the membrane surface since all lipids used in the model were zwitterionic. This is also in accordance with the typical non-charge of a eukaryotic membrane but has the headgroup complexity from it. Our results represented the different fluidity of cancer cell membranes in comparison with non-cancer cell membranes. This characteristic can be monitored through the analysis of the wavenumber at a specific temperature, for example at 37 °C, which is 2850.8 for the cancer model membrane, and 2850.5 cm−1 for the non-cancer membrane. Our findings are in accordance with the previously-described characteristic of cancer cell membranes as more fluid systems than normal cell membranes [4,59].
Our attempt to include cholesterol in the multi-component lipid systems resulted in a very broad transition, where the inflection point characteristic of the gel to liquid-crystalline change was not evident. This transition was compared with the one obtained from the total lipid extract from MCF-7 cells. The result was very similar, consisting of a very broad phase transition. The main difference was that the νsCH2 stretching vibrations from the lipid extract were located at higher frequencies, which could suggest that the extract contains unsaturated lipids and higher cholesterol content. The broadening effect of the cholesterol in the phase transition is not surprising, as cholesterol acts as a phase modulator in mammalian membranes, generating modifications in membrane dynamics and fluidity [41,51].
Multi-component lipid systems representative of P. aeruginosa (PE:PG:CL; 65:23:12 w/w) and E. coli (PE:PG:CL; 75:20:5 w/w) were also evaluated to identify the Tm of the systems. Both are Gram-negative bacteria and represent a major health problem worldwide. They are related to several infections and are difficult to treat due to the absence of new antimicrobial agents active against this group of pathogens [60,61]. The results obtained showed very similar values for Tm, which is closely related to the similar composition of the cell membranes. However, the technique is sensitive enough to detect small variations in the lipid composition of the systems, resulting in slight differences in the Tm obtained of 45.6 and 45.9 °C for P. aeruginosa and E. coli, respectively.
Another very interesting system to study was S. aureus model membrane. In this Gram-positive bacteria, two lipids were identified as major components, phosphatidylglycerol (PG) and cardiolipin (CL) [31]. However, the role of CL is not completely understood. Several authors have suggested that increasing concentrations of CL in S. aureus membrane is associated with a resistance mechanism based on the modification of membrane composition in the bacteria [62,63]. The polar headgroups of the cardiolipin structure have a relatively small size, which promotes greater cohesion between the CL hydrocarbon chains [64]. For this reason, it was proposed that higher concentrations of the lipid in the bilayer increase the membrane packing due to an increase in the lateral density of fatty acids. Some studies have suggested that an elevated CL content in the membrane of S. aureus may contribute to bacterial resistance to antibiotics, including Daptomycin [65]. Considering the relevant physical–chemical properties of CL in S. aureus membrane, we evaluated different proportions of CL in the SLBs by FT-IR. The results suggest that CL plays an important role in the membrane characteristics of S. aureus. Specifically, they showed that increasing concentrations of CL have an effect on the fluidity of the system, increasing the Tm of the model membranes and a fixed temperature. For example, the νsCH2 vibration of the system 60:40 appeared at wavenumbers lower than 70:30 or 80:20. These results provide evidence that CL imposes structural consequences on the bilayer core of the S. aureus membrane.
Finally, a very attractive application of the multi-component lipid systems is the determination of the secondary structure of bioactive peptides. The conformational change that peptides undergo when they interact with the cell membrane has been extensively studied [66,67]. The most extensively used technique for the determination of the secondary structure is circular dichroism. In this technique solvents such as trifluoroethanol are used to represent the membrane environment. However, the possibility of using multi-component lipids systems that can be designed depending on the membrane under study, opens in turn the possibility of using more representative model systems to study the conformational change. Most peptides change conformation from random coiled to an α-helical structure. In this study the very highly-studied peptide LL-37 was made to interact with two different multi-component lipid systems, representative of erythrocytes and S. aureus membranes, to evaluate the conformational change depending on the composition of the model membrane used. It was demonstrated that human cathelicidin LL-37 after binding to the membrane assumes an α-helical structure [24]. This peptide has several physiological roles in the body, being recognized for its antimicrobial, antifungal and antiviral activities [20,21,22,68,69,70]. The results showed that, in solution, LL-37 was partially helical. This result could be explained by the fact that cathelicidins often show a slightly α-helical structure at low concentrations in buffer solution [25]. In the presence of liposomes representative of the erythrocyte membrane the peptide underwent a mild conformational change, but in the presence of the liposomes representative of S. aureus membrane the change in conformation was very strong. LL-37 peptide is known to interact with negatively charged phospholipid vesicles, leading to the induction of a secondary structure [24,71], which is highly associated with its biological activity.

5. Conclusions

The complexity of the cell membrane makes it a very intricate system to study in its natural state. However, given the importance of understanding how molecules interact and affect the physicochemical properties of membranes, it is necessary to use representative models of these systems. Our results demonstrated the possibility of using multi-component lipid systems to monitor membrane fluidity by infrared spectroscopy. This application opens the possibility of studying the thermal behavior of eukaryotic and bacterial model membranes, where the lipid composition and charge mainly influence the phase transition temperature. The results of this study have led to the identification of differences in both tumoral and non-tumoral membrane fluidity, and even to comparisons between the thermal behavior of synthetic and natural lipids, thereby allowing the main effect of cholesterol on the phase transition to be appreciated. The results also showed that, despite the similarity in the phospholipid composition between Gram-positive and Gram-negative bacteria, proportions established significant differences in the lipid system charge, thereby conditioning the Tm parameter. We finally wanted to highlight one more application of multi-component lipid systems for the conformational change that peptides can undergo in the presence of a lipid environment. Thus, the helical content of the recognized LL-37 peptide was evaluated in aqueous, erythrocyte, and bacterial model membranes. The folding trend is consistent with reports using circular dichroism. As a future perspective, further investigations with multi-component lipid systems will be used as a strategy to study the effect of potential antimicrobial and antitumoral agents in the biophysical properties of eukaryotic and bacterial membranes, as well as the secondary structure prediction of peptides in those lipid environments.

Author Contributions

M.C.K.-L. original draft preparation and formal analysis, and M.M.-M. writing, review and editing. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the MinCiencias Research Grant (111584467189, 946-2019).

Acknowledgments

The authors wish to acknowledge Gloria A. Santa-Gonzalez from the Instituto Tecnológico Metropolitano for the MCF-7 cell line and Vanessa Gallego from University of Antioquia for preparing the cell cultures.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Nicolson, G.L.; Ferreira de Mattos, G. A Brief Introduction to Some Aspects of the Fluid–Mosaic Model of Cell Membrane Structure and Its Importance in Membrane Lipid Replacement. Membranes 2021, 11, 947. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Los, D.A.; Murata, N. Membrane fluidity and its roles in the perception of environmental signals. Biochim. Biophys. Acta 2004, 1666, 142–157. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Seu, K.J.; Cambrea, L.R.; Everly, R.M.; Hovis, J.S. Influence of lipid chemistry on membrane fluidity: Tail and headgroup interactions. Biophys. J. 2006, 91, 3727–3735. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Sok, M.; Šentjurc, M.; Schara, M. Membrane fluidity characteristics of human lung cancer. Cancer Lett. 1999, 139, 215–220. [Google Scholar] [CrossRef] [Scilit]
  5. Lipowsky, R. Remodeling of membrane compartments: Some consequences of membrane fluidity. Biol. Chem. 2014, 395, 253–274. [Google Scholar] [CrossRef] [Scilit]
  6. Nicolson, G.L. The Fluid—Mosaic Model of Membrane Structure: Still relevant to understanding the structure, function and dynamics of biological membranes after more than 40 years. Biochim. Biophys. Acta Biom. 2014, 1838, 1451–1466. [Google Scholar] [CrossRef] [Scilit]
  7. Tsuda, K.; Nishio, I. Membrane fluidity and hypertension. Am. J. Hypertens. 2003, 16, 259–261. [Google Scholar] [CrossRef] [Scilit]
  8. Aloia, R.C.; Boggs, J.M. Membrane Fluidity in Biology: Disease Processes; Academic Press: Cambridge, MA, USA, 2013. [Google Scholar]
  9. Bianchetti, G.; Viti, L.; Scupola, A.; Di Leo, M.; Tartaglione, L.; Flex, A.; De Spirito, M.; Pitocco, D.; Maulucci, G. Erythrocyte membrane fluidity as a marker of diabetic retinopathy in type 1 diabetes mellitus. Eur. J. Clin. Investig. 2021, 51, e13455. [Google Scholar] [CrossRef] [Scilit]
  10. Vignini, A.; Alia, S.; Pugnaloni, S.; Giulietti, A.; Bacchetti, T.; Mazzanti, L.; Luzzi, S.; Fiorini, R. Erythrocyte membrane fluidity in mild cognitive impairment and Alzheimer’ s disease patients. Exp. Gerontol. 2019, 128, 110754. [Google Scholar] [CrossRef] [Scilit]
  11. Pignatello, R. Drug-Biomembrane Interaction Studies: The Application of Calorimetric Techniques; Elsevier: Amsterdam, The Netherlands, 2013. [Google Scholar]
  12. Ohline, S.M.; Campbell, M.L.; Turnbull, M.T.; Kohler, S.J. Differential scanning calorimetric study of bilayer membrane phase transitions-A biophysical chemistry experiment. J. Chem. Educ. 2001, 78, 1251–1256. [Google Scholar] [CrossRef] [Scilit]
  13. Lewis, R.N.A.H.; Zhang, Y.-P.; McElhaney, R.N. Calorimetric and spectroscopic studies of the phase behavior and organization of lipid bilayer model membranes composed of binary mixtures of dimyristoylphosphatidylcholine and dimyristoylphosphatidylglycerol. Biochim. Biophys. Acta 2005, 1668, 203–214. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Parasassi, T.; De Stasio, G.; Rusch, R.M.; Gratton, E. A photophysical model for diphenylhexatriene fluorescence decay in solvents and in phospholipid vesicles. Biophys. J. 1991, 59, 466–475. [Google Scholar] [CrossRef] [Scilit]
  15. Parasassi, T.; Giusti, A.M.; Raimondi, M.; Gratton, E. Abrupt modifications of phospholipid bilayer properties at critical cholesterol concentrations. Biophys. J. 1995, 68, 1895–1902. [Google Scholar] [CrossRef] [Scilit]
  16. Yu, W.M.; So, P.T.C.; French, T.; Gratton, E. Fluorescence generalized polarization of cell membranes: A two-photon scanning microscopy approach. Biophys. J. 1996, 70, 626–636. [Google Scholar] [CrossRef] [Scilit]
  17. Bagatolli, L.A.; Parasassi, T.; Gerardo, D.; Gratton, F.E. A model for the interaction of 6-lauroyl-2-(N,N-dimethylamino)naphthalene with lipid environments: Implications for spectral properties. Photochem. Photobiol. 1999, 70, 557–564. [Google Scholar] [CrossRef] [Scilit]
  18. Silvestro, L.; Axelsen, P.H. Infrared spectroscopy of supported lipid monolayer, bilayer, and multibilayer membranes. Chem. Phys. Lipids 1998, 96, 69–80. [Google Scholar] [CrossRef] [Scilit]
  19. StoÖckl, M.; Plazzo, A.P.; Korte, T.; Herrmann, A. Detection of lipid domains in model and cell membranes by fluorescence lifetime imaging microscopy of fluorescent lipid analogues. J. Biol. Chem. 2008, 283, 30828–30837. [Google Scholar] [CrossRef] [Scilit]
  20. Bergman, P.; Walter-Jallow, L.; Broliden, K.; Agerberth, B.; Soderlund, J. The antimicrobial peptide LL-37 inhibits HIV-1 replication. Curr. HIV Res. 2007, 5, 410–415. [Google Scholar] [CrossRef] [Scilit]
  21. den Hertog, A.L.; van Marle, J.; Bolscher, J.G.; Veerman, E.C.; Arie, V. Candidacidal effects of two antimicrobial peptides: Histatin 5 causes small membrane defects, but LL-37 causes massive disruption of the cell membrane. Biochem. J. 2005, 388, 689–695. [Google Scholar] [CrossRef] [Scilit]
  22. Overhage, J.; Campisano, A.; Bains, M.; Torfs, E.C.; Rehm, B.H.; Hancock, R.E. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect. Immun. 2008, 76, 4176–4182. [Google Scholar] [CrossRef] [Scilit]
  23. Wang, G. Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. J. Biol. Chem. 2008, 283, 32637–32643. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Burton, M.F.; Steel, P.G. The chemistry and biology of LL-37. Nat. Prod. Rep. 2009, 26, 1572–1584. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Dean, S.N.; Bishop, B.M.; Van Hoek, M.L. Susceptibility of Pseudomonas aeruginosa biofilm to alpha-helical peptides: D-enantiomer of LL-37. Front. Microbiol. 2011, 2, 128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Cseke, L.J.; Kirakosyan, A.; Kaufman, P.B.; Westfall, M.V. Handbook of Molecular and Cellular Methods in Biology and Medicine; CRC Press: Boca Raton, FL, USA, 2011. [Google Scholar]
  27. Almarwani, B.; Phambu, E.N.; Alexander, C.; Nguyen, H.A.T.; Phambu, N.; Sunda-Meya, A. Vesicles mimicking normal and cancer cell membranes exhibit differential responses to the cell-penetrating peptide Pep-1. Biochim. Biophys. Acta Biom. 2018, 1860, 1394–1402. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  28. Yeung, T.; Gilbert, G.E.; Shi, J.; Silvius, J.; Kapus, A.; Grinstein, S. Membrane phosphatidylserine regulates surface charge and protein localization. Science 2008, 319, 210–213. [Google Scholar] [CrossRef] [Scilit]
  29. Nowotarska, S.W.; Nowotarski, K.J.; Friedman, M.; Situ, C. Effect of structure on the interactions between five natural antimicrobial compounds and phospholipids of bacterial cell membrane on model monolayers. Molecules 2014, 19, 7497–7515. [Google Scholar] [CrossRef] [Scilit]
  30. Gilleland Jr, H.; Champlin, F.; Conrad, R.S. Chemical alterations in cell envelopes of Pseudomonas aeruginosa upon exposure to polymyxin: A possible mechanism to explain adaptive resistance to polymyxin. Can. J. Microbiol. 1984, 30, 869–873. [Google Scholar] [CrossRef] [Scilit]
  31. Hernández-Villa, L.; Manrique-Moreno, M.; Leidy, C.; Jemioła-Rzemińska, M.; Ortíz, C.; Strzałka, K. Biophysical evaluation of cardiolipin content as a regulator of the membrane lytic effect of antimicrobial peptides. Biophys. Chem. 2018, 238, 8–15. [Google Scholar] [CrossRef] [Scilit]
  32. Seydel, J.K. Function, composition, and organization of membranes. In Methods and Principles in Medicinal Chemistry; John Wiley and Sons: Hoboken, NJ, USA, 2002; Volume 15. [Google Scholar]
  33. Li, G.; Huang, Y.; Feng, Q.; Chen, Y. Tryptophan as a probe to study the anticancer mechanism of action and specificity of α-helical anticancer peptides. Molecules 2014, 19, 12224–12241. [Google Scholar] [CrossRef] [Scilit]
  34. Jiang, J.-H.; Bhuiyan, M.S.; Shen, H.-H.; Cameron, D.R.; Rupasinghe, T.W.; Wu, C.-M.; Le Brun, A.P.; Kostoulias, X.; Domene, C.; Fulcher, A.J. Antibiotic resistance and host immune evasion in Staphylococcus aureus mediated by a metabolic adaptation. Proc. Nat. Acad. Sci. USA 2019, 116, 3722–3727. [Google Scholar] [CrossRef] [Scilit]
  35. Epand, R.F.; Savage, P.B.; Epand, R.M. Bacterial lipid composition and the antimicrobial efficacy of cationic steroid compounds (Ceragenins). Biochim. Biophys. Acta Biom. 2007, 1768, 2500–2509. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Lee, A.G. How lipids affect the activities of integral membrane proteins. Biochim. Biophys. Acta 2004, 1666, 62–87. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Sevcsik, E.; Pabst, G.; Jilek, A.; Lohner, K. How lipids influence the mode of action of membrane-active peptides. Biochim. Biophys. Acta 2007, 1768, 2586–2595. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Shinitzky, M. Membrane fluidity in malignancy adversative and recuperative. Biochim. Biophys. Acta Rev. Cancer 1984, 738, 251–261. [Google Scholar] [CrossRef] [Scilit]
  39. Gauger, D.R.; Selle, C.; Fritzsche, H.; Pohle, W. Chain-length dependence of the hydration properties of saturated phosphatidylcholines as revealed by FTIR spectroscopy. J. Mol. Struct. 2001, 565–566, 25–29. [Google Scholar] [CrossRef] [Scilit]
  40. Domingo, J.C.; Mora, M.; Africa de Madariaga, M. Role of headgroup structure in the phase behaviour of N-acylethanolamine phospholipids: Hydrogen-bonding ability and headgroup size. Chem. Phys. Lipids 1994, 69, 229–240. [Google Scholar] [CrossRef] [Scilit]
  41. Bach, D.; Miller, I.R. Hydration of phospholipid bilayers in the presence and absence of cholesterol. Chem. Phys. Lipids 2005, 136, 67–72. [Google Scholar] [CrossRef] [Scilit]
  42. Frey, L.; Hiller, S.; Riek, R.; Bibow, S. Lipid-and cholesterol-mediated time-scale-specific modulation of the outer membrane protein X dynamics in lipid bilayers. J. Am. Chem. Soc. 2018, 140, 15402–15411. [Google Scholar] [CrossRef] [Scilit]
  43. McMullen, T.P.W.; Lewis, R.N.A.H.; McElhaney, R.N. Calorimetric and spectroscopic studies of the effects of cholesterol on the thermotropic phase behavior and organization of a homologous series of linear saturated phosphatidylglycerol bilayer membranes. Biochim. Biophys. Acta 2009, 1788, 345–357. [Google Scholar] [CrossRef] [Scilit]
  44. Oncul, S.; Klymchenko, A.S.; Kucherak, O.A.; Demchenko, A.P.; Martin, S.; Dontenwill, M.; Arntz, Y.; Didier, P.; Duportail, G.; Mély, Y. Liquid ordered phase in cell membranes evidenced by a hydration-sensitive probe: Effects of cholesterol depletion and apoptosis. Biochim. Biophys. Acta 2010, 1798, 1436–1443. [Google Scholar] [CrossRef] [Scilit]
  45. Chiangjong, W.; Chutipongtanate, S.; Hongeng, S. Anticancer peptide: Physicochemical property, functional aspect and trend in clinical application. Int. J. Oncol. 2020, 57, 678–696. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Brandenburg, K.; Seydel, U. Infrared spectroscopy of glycolipids. Chem. Phys. Lipids 1998, 96, 23–40. [Google Scholar] [CrossRef] [Scilit]
  47. Andrade, S.; Ramalho, M.J.; Loureiro, J.A.; Pereira, M.C. Liposomes as Biomembrane Models: Biophysical techniques for Drug-Membrane Interaction Studies. J. Mol. Liq. 2021, 344, 116141. [Google Scholar] [CrossRef] [Scilit]
  48. Deleu, M.; Crowet, J.-M.; Nasir, M.N.; Lins, L. Complementary biophysical tools to investigate lipid specificity in the interaction between bioactive molecules and the plasma membrane: A review. Biochim. Biophys. Acta 2014, 1838, 3171–3190. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  49. Garidel, P.; Blume, A. Miscibility of phosphatidylethanolamine-phosphatidylglycerol mixtures as a function of pH and acyl chain length. Eur. Biophys. J. 2000, 28, 629–638. [Google Scholar] [CrossRef] [Scilit]
  50. Garidel, P.; Blume, A. Miscibility of phospholipids with identical headgroups and acyl chain lengths differing by two methylene units: Effects of headgroup structure and headgroup charge. Biochim. Biophys. Acta 1998, 1371, 83–95. [Google Scholar] [CrossRef] [Scilit]
  51. McMullen, T.P.W.; Lewis, R.; McElhaney, R.N. Differential scanning calorimetric and Fourier transform infrared spectroscopic studies of the effects of cholesterol on the thermotropic phase behavior and organization of a homologous series of linear saturated phosphatidylserine bilayer membranes. Biophys. J. 2000, 79, 2056–2065. [Google Scholar] [CrossRef] [Scilit]
  52. Arsov, Z.; González-Ramírez, E.J.; Goñi, F.M.; Tristram-Nagle, S.; Nagle, J.F. Phase behavior of palmitoyl and egg sphingomyelin. Chem. Phys. Lipids 2018, 213, 102–110. [Google Scholar] [CrossRef] [Scilit]
  53. Lewis, R.N.A.H.; Mannock, D.A.; McElhaney, R.N. Differential scanning calorimetry in the study of lipid phase transitions in model and biological membranes. In A Glance at the Structural and Functional Diversity of Membrane Lipids; Dopico, A.M., Ed.; Humana Press Inc.: Totowa, NJ, USA, 2006; Volume 400, pp. 171–195. [Google Scholar]
  54. Bilge, D.; Kazanci, N.; Severcan, F. Acyl chain length and charge effect on Tamoxifen–lipid model membrane interactions. J. Mol. Struct. 2013, 1040, 75–82. [Google Scholar] [CrossRef] [Scilit]
  55. Bilge, D.; Sahin, I.; Kazanci, N.; Severcan, F. Interactions of tamoxifen with distearoyl phosphatidylcholine multilamellar vesicles: FTIR and DSC studies. Spectrochim. Acta Part Mol. Biom. Spectrosc. 2014, 130, 250–256. [Google Scholar] [CrossRef] [Scilit]
  56. Zhao, L.; Feng, S.-S.; Kocherginsky, N.; Kostetski, I. DSC and EPR investigations on effects of cholesterol component on molecular interactions between paclitaxel and phospholipid within lipid bilayer membrane. Int. J. Pharm. 2007, 338, 258–266. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Riedl, S.; Rinner, B.; Asslaber, M.; Schaider, H.; Walzer, S.; Novak, A.; Lohner, K.; Zweytick, D. In search of a novel target—phosphatidylserine exposed by non-apoptotic tumor cells and metastases of malignancies with poor treatment efficacy. Biochim. Biophys. Acta Biom. 2011, 1808, 2638–2645. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Zwaal, R.; Comfurius, P.; Bevers, E. Surface exposure of phosphatidylserine in pathological cells. Cell. Mol. Life Sci. 2005, 62, 971–988. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Kozłowska, K.; Nowak, J.; Kwiatkowski, B.; Cichorek, M. ESR study of plasmatic membrane of the transplantable melanoma cells in relation to their biological properties. Exp. Toxicol. Pathol. 1999, 51, 89–92. [Google Scholar] [CrossRef] [Scilit]
  60. Azam, M.W.; Khan, A.U. Updates on the pathogenicity status of Pseudomonas aeruginosa. Drug Discov. Today 2019, 24, 350–359. [Google Scholar] [CrossRef] [Scilit]
  61. Tamma, P.D.; Aitken, S.L.; Bonomo, R.A.; Mathers, A.J.; van Duin, D.; Clancy, C. Infectious Diseases Society of America antimicrobial resistant treatment guidance: Gram-negative bacterial infections. Practice 2020, 6, 8. [Google Scholar]
  62. Tsai, M.; Ohniwa, R.L.; Kato, Y.; Takeshita, S.L.; Ohta, T.; Saito, S.; Hayashi, H.; Morikawa, K. Staphylococcus aureus requires cardiolipin for survival under conditions of high salinity. BMC Microbiol. 2011, 11, 13. [Google Scholar] [CrossRef] [Scilit]
  63. Poger, D.; Pöyry, S.; Mark, A.E. Could cardiolipin protect membranes against the action of certain antimicrobial peptides? Aurein 1.2, a Case Study. ACS Pmega 2018, 3, 16453–16464. [Google Scholar] [CrossRef] [Scilit]
  64. Lewis, R.N.; McElhaney, R.N. The physicochemical properties of cardiolipin bilayers and cardiolipin-containing lipid membranes. Biochim. Biophys. Acta Biom. 2009, 1788, 2069–2079. [Google Scholar] [CrossRef] [Scilit]
  65. Zhang, T.; Muraih, J.K.; Tishbi, N.; Herskowitz, J.; Victor, R.L.; Silverman, J.; Uwumarenogie, S.; Taylor, S.D.; Palmer, M.; Mintzer, E. Cardiolipin prevents membrane translocation and permeabilization by daptomycin. J. Biol. Chem. 2014, 289, 11584–11591. [Google Scholar] [CrossRef] [Scilit]
  66. Eiríksdóttir, E.; Konate, K.; Langel, Ü.; Divita, G.; Deshayes, S. Secondary structure of cell-penetrating peptides controls membrane interaction and insertion. Biochim. Biophys. Acta 2010, 1798, 1119–1128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Tossi, A.; Sandri, L.; Giangaspero, A. Amphipathic, α-helical antimicrobial peptides. Peptide Sci. 2000, 55, 4–30. [Google Scholar] [CrossRef]
  68. López-García, B.; Lee, P.H.; Yamasaki, K.; Gallo, R.L. Anti-fungal activity of cathelicidins and their potential role in Candida albicans skin infection. J. Investig. Dermatol. 2005, 125, 108–115. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Wang, G.; Watson, K.M.; Buckheit, R.W. Anti-human immunodeficiency virus type 1 activities of antimicrobial peptides derived from human and bovine cathelicidins. Antimicrob. Agents Chemother. 2008, 52, 3438–3440. [Google Scholar] [CrossRef] [Scilit]
  70. Chennupati, S.K.; Chiu, A.G.; Tamashiro, E.; Banks, C.A.; Cohen, M.B.; Bleier, B.S.; Kofonow, J.M.; Tam, E.; Cohen, N.A. Effects of an LL-37-derived antimicrobial peptide in an animal model of biofilm Pseudomonas sinusitis. Am. J. Rhinol. Allerg. 2009, 23, 46–51. [Google Scholar] [CrossRef] [Scilit]
  71. Oren, Z.; Lerman, J.C.; Gudmundsson, G.H.; Agerberth, B.; Shai, Y. Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: Relevance to the molecular basis for its non-cell-selective activity. Biochem. J. 1999, 341, 501. [Google Scholar] [CrossRef]
Figure 1. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of the temperature of the pure supported lipid bilayers of DPPC (), DPPS (), DPPE () and SM () in buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Figure 1. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of the temperature of the pure supported lipid bilayers of DPPC (), DPPS (), DPPE () and SM () in buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Membranes 12 00534 g001
Figure 2. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of the representative model of (a) non-cancer (PC:SM:PE; 4.35:4.35:1 w/w) and (b) cancer cell membranes (PC:SM:PE:PS; 3.85:3.85:0.8:1.5 w/w) in buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Figure 2. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of the representative model of (a) non-cancer (PC:SM:PE; 4.35:4.35:1 w/w) and (b) cancer cell membranes (PC:SM:PE:PS; 3.85:3.85:0.8:1.5 w/w) in buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Membranes 12 00534 g002
Figure 3. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of (a) non-cancer cell model membrane (PC:SM:PE:CH; 4.35:4.35:1:1 w/w) and (b) lipid extract of breast cancer MCF-7 cell line, both transitions were obtained using buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Figure 3. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of (a) non-cancer cell model membrane (PC:SM:PE:CH; 4.35:4.35:1:1 w/w) and (b) lipid extract of breast cancer MCF-7 cell line, both transitions were obtained using buffer (10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4).
Membranes 12 00534 g003
Figure 4. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of (a) P. aeruginosa PE:PG:CL 65:23:12 (w/w) and (b) E. coli PE:PG:CL 75:20:5 (w/w) multi-component lipid systems in 10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4.
Figure 4. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of (a) P. aeruginosa PE:PG:CL 65:23:12 (w/w) and (b) E. coli PE:PG:CL 75:20:5 (w/w) multi-component lipid systems in 10 mM HEPES, 500 mM NaCl, 1 mM EDTA, pH 7.4.
Membranes 12 00534 g004
Figure 5. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of () DMPG, () DMPG:CL (80:20), () DMPG:CL (70:30), () DMPG:CL (60:40), and () CL in Buffer (20 mM Hepes, 500 mM NaCl and 1mM EDTA).
Figure 5. Peak positions of the νsCH2 vibration bands of the methylene groups as a function of temperature of () DMPG, () DMPG:CL (80:20), () DMPG:CL (70:30), () DMPG:CL (60:40), and () CL in Buffer (20 mM Hepes, 500 mM NaCl and 1mM EDTA).
Membranes 12 00534 g005
Table 1. Prediction of the secondary structure analysis of the peptide LL-37 in buffer and in different lipid systems.
Table 1. Prediction of the secondary structure analysis of the peptide LL-37 in buffer and in different lipid systems.
Peptide/Lipid Systemα-Helix prediction (%)
LL-37 in Hepes32.0
LL-37 + DMPC:SM:DMPE40.0
LL-37 + DMPG:CL63.1
Prediction of secondary structure elements α-helix were performed using the methods supplied by the ConfocheckTM systems.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Klaiss-Luna, M.C.; Manrique-Moreno, M. Infrared Spectroscopic Study of Multi-Component Lipid Systems: A Closer Approximation to Biological Membrane Fluidity. Membranes 2022, 12, 534. https://doi.org/10.3390/membranes12050534

AMA Style

Klaiss-Luna MC, Manrique-Moreno M. Infrared Spectroscopic Study of Multi-Component Lipid Systems: A Closer Approximation to Biological Membrane Fluidity. Membranes. 2022; 12(5):534. https://doi.org/10.3390/membranes12050534

Chicago/Turabian Style

Klaiss-Luna, Maria C., and Marcela Manrique-Moreno. 2022. "Infrared Spectroscopic Study of Multi-Component Lipid Systems: A Closer Approximation to Biological Membrane Fluidity" Membranes 12, no. 5: 534. https://doi.org/10.3390/membranes12050534

APA Style

Klaiss-Luna, M. C., & Manrique-Moreno, M. (2022). Infrared Spectroscopic Study of Multi-Component Lipid Systems: A Closer Approximation to Biological Membrane Fluidity. Membranes, 12(5), 534. https://doi.org/10.3390/membranes12050534

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop