A Peptide-Based Assay Discriminates Individual Antibody Response to the COVID-19 Pfizer/BioNTech mRNA Vaccine
Abstract
:1. Introduction
2. Materials and Methods
2.1. Study Design and Informed Consent
2.2. Blood Samples
2.3. ELISA Assay
3. Results and Discussion
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
| COVID-19 | Coronavirus disease 2019 |
| mRNA | Messenger ribonucleic acid |
| SARS-CoV-2 | Severe acute respiratory syndrome coronavirus 2 |
| ELISA | Enzyme-linked immunosorbent assay |
References
- World Health Organization. Coronavirus Disease (COVID-19) Dashboard. Available online: https://covid19.who.int/ (accessed on 21 June 2021).
- Forni, G.; Mantovani, A. COVID-19 vaccines: Where we stand and challenges ahead. Cell Death Differ. 2021, 28, 626–639. [Google Scholar] [CrossRef] [PubMed]
- Pormohammad, A.; Zarei, M.; Ghorbani, S.; Mohammadi, M.; Razizadeh, M.H.; Turner, D.L.; Turner, R.J. Efficacy and Safety of COVID-19 Vaccines: A Systematic Review and Meta-Analysis of Randomized Clinical Trials. Vaccines 2021, 9, 467. [Google Scholar] [CrossRef] [PubMed]
- Walsh, E.E.; Frenck, R.W., Jr.; Falsey, A.R.; Kitchin, N.; Absalon, J.; Gurtman, A.; Lockhart, S.; Neuzil, K.; Mulligan, M.J.; Bailey, R.; et al. Safety and Immunogenicity of Two RNA-Based Covid-19 Vaccine Candidates. N. Engl. J. Med. 2020, 383, 2439–2450. [Google Scholar] [CrossRef] [PubMed]
- Polack, F.P.; Thomas, S.J.; Kitchin, N.; Absalon, J.; Gurtman, A.; Lockhart, S.; Perez, J.L.; Pérez Marc, G.; Moreira, E.D.; Zerbini, C.; et al. C4591001 Clinical Trial Group. Safety and Efficacy of the BNT162b2 mRNA Covid-19 Vaccine. N. Engl. J. Med. 2020, 383, 2603–2615. [Google Scholar] [CrossRef] [PubMed]
- Sahin, U.; Muik, A.; Vogler, I.; Derhovanessian, E.; Kranz, L.M.; Vormehr, M.; Quandt, J.; Bidmon, N.; Ulges, A.; Baum, A.; et al. BNT162b2 vaccine induces neutralizing antibodies and poly-specific T cells in humans. Nature 2021, 595, 572–577. [Google Scholar]
- Frenck, R.W., Jr.; Klein, N.P.; Kitchin, N.; Gurtman, A.; Absalon, J.; Lockhart, S.; Perez, J.L.; Walter, E.B.; Senders, S.; Bailey, R.; et al. C4591001 Clinical Trial Group. Safety, Immunogenicity, and Efficacy of the BNT162b2 Covid-19 Vaccine in Adolescents. N. Engl. J. Med. 2021, 385, 239–250. [Google Scholar] [CrossRef] [PubMed]
- Polvere, I.; Voccola, S.; Cardinale, G.; Fumi, M.; Aquila, F.; Parrella, A.; Madera, J.R.; Stilo, R.; Vito, P.; Zotti, T. A peptide-based assay discriminates individual antibody response to SARS-CoV-2. Genes Dis. 2021. Epub ahead of print. [Google Scholar] [CrossRef] [PubMed]
- Edara, V.V.; Lai, L.; Sahoo, M.K.; Floyd, K.; Sibai, M.; Solis, D.; Flowers, M.W.; Hussaini, L.; Ciric, C.R.; Bechnack, S.; et al. Infection and vaccine-induced neutralizing antibody responses to the SARS-CoV-2 B.1.617.1 variant. bioRxiv 2021, 385, 664–666. [Google Scholar]
- Amanat, F.; Thapa, M.; Lei, T.; Ahmed, S.M.S.; Adelsberg, D.C.; Carreño, J.M.; Strohmeier, S.; Schmitz, A.J.; Zafar, S.; Zhou, J.Q.; et al. SARS-CoV-2 mRNA vaccination induces functionally diverse antibodies to NTD, RBD, and S2. Cell 2021, 184, 3936–3948. [Google Scholar] [CrossRef] [PubMed]
- Krammer, F.; Srivastava, K.; Alshammary, H.; Amoako, A.A.; Awawda, M.H.; Beach, K.F.; Bermúdez-González, M.C.; Bielak, D.A.; Carreño, J.M.; Chernet, R.L.; et al. Antibody Responses in Seropositive Persons after a Single Dose of SARS-CoV-2 mRNA Vaccine. N. Engl. J. Med. 2021, 384, 1372–1374. [Google Scholar] [CrossRef] [PubMed]
- Nelde, A.; Bilich, T.; Heitmann, J.S.; Maringer, Y.; Salih, H.R.; Roerden, M.; Lübke, M.; Bauer, J.; Rieth, J.; Wacker, M.; et al. SARS-CoV-2-derived peptides define heterologous and COVID-19-induced T cell recognition. Nat. Immunol. 2021, 22, 74–85. [Google Scholar] [CrossRef] [PubMed]
- Altmann, D.M.; Boyton, R.J. SARS-CoV-2 T cell immunity: Specificity, function, durability, and role in protection. Sci. Immunol. 2020, 5, eabd6160. [Google Scholar] [CrossRef] [PubMed]
- Gallagher, K.M.E.; Leick, M.B.; Larson, R.C.; Berger, T.R.; Katsis, K.; Yam, J.Y.; Brini, G.; Grauwet, K. MGH COVID-19 Collection & Processing Team; Maus, M.V. SARS-CoV-2 T-cell immunity to variants of concern following vaccination. bioRxiv 2021. [Google Scholar] [CrossRef]




| Peptide | Sequence | Position |
|---|---|---|
| Pep2_Spike | DAVDCALDPLSETKCTLKSFTVEKGIYQTSN | 287–317 |
| Pep5_Spike | FSQILPDPSKPSKRSFIE | 802–819 |
| Pep6_Spike | GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS | 601–640 |
| Pep10_Spike | VCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVI | 524–598 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Polvere, I.; Voccola, S.; Parrella, A.; Cardinale, G.; Zerillo, L.; Varricchio, R.; Madera, J.R.; Stilo, R.; Vito, P.; Zotti, T. A Peptide-Based Assay Discriminates Individual Antibody Response to the COVID-19 Pfizer/BioNTech mRNA Vaccine. Vaccines 2021, 9, 987. https://doi.org/10.3390/vaccines9090987
Polvere I, Voccola S, Parrella A, Cardinale G, Zerillo L, Varricchio R, Madera JR, Stilo R, Vito P, Zotti T. A Peptide-Based Assay Discriminates Individual Antibody Response to the COVID-19 Pfizer/BioNTech mRNA Vaccine. Vaccines. 2021; 9(9):987. https://doi.org/10.3390/vaccines9090987
Chicago/Turabian StylePolvere, Immacolata, Serena Voccola, Alfredina Parrella, Gaetano Cardinale, Lucrezia Zerillo, Romualdo Varricchio, Jessica Raffaella Madera, Romania Stilo, Pasquale Vito, and Tiziana Zotti. 2021. "A Peptide-Based Assay Discriminates Individual Antibody Response to the COVID-19 Pfizer/BioNTech mRNA Vaccine" Vaccines 9, no. 9: 987. https://doi.org/10.3390/vaccines9090987
APA StylePolvere, I., Voccola, S., Parrella, A., Cardinale, G., Zerillo, L., Varricchio, R., Madera, J. R., Stilo, R., Vito, P., & Zotti, T. (2021). A Peptide-Based Assay Discriminates Individual Antibody Response to the COVID-19 Pfizer/BioNTech mRNA Vaccine. Vaccines, 9(9), 987. https://doi.org/10.3390/vaccines9090987

