Next Article in Journal
Family Decision to Immunize Against Respiratory Syncytial Virus and Associations with Seasonal Influenza and COVID-19 Vaccination
Next Article in Special Issue
Special Issue: Novel Vaccines and Vaccine Technologies for Emerging Infections
Previous Article in Journal
Myriad Pathways to Universality: How Widely Sourced Data, Use of Frameworks and Innovative Analytic Methods Help Tackle Immunization Inequality
Previous Article in Special Issue
Immunogenicity of Sulfated Lactosyl Archaeol Archaeosome-Adjuvanted Versus Non-Adjuvanted SARS-CoV-2 Spike Booster Vaccines in Young and Aged Balb/c Mice
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Exploratory Evaluation of Peptide-Based Immunization Targeting Fusion Glycoprotein-Derived Epitopes of Nipah Virus in Murine Model

1
Division of Vaccine Development Coordination, Center for Vaccine Research, National Institute of Infectious Diseases, National Institute of Health, Korea Disease Control and Prevention Agency, Osong, Cheongju 28159, Chungcheongbuk-do, Republic of Korea
2
College of Veterinary Medicine, Institute of Animal Medicine, Gyeongsang National University, Jinju 52828, Gyeongsangnam-do, Republic of Korea
*
Authors to whom correspondence should be addressed.
These authors contributed equally to this work.
Vaccines 2026, 14(1), 84; https://doi.org/10.3390/vaccines14010084
Submission received: 27 November 2025 / Revised: 9 January 2026 / Accepted: 10 January 2026 / Published: 13 January 2026
(This article belongs to the Special Issue Novel Vaccines and Vaccine Technologies for Emerging Infections)

Abstract

Background: Nipah virus (NiV), a zoonotic paramyxovirus with high case fatality and pandemic potential, remains without a licensed vaccine for humans to date. Although there has been progress in vaccine development, it remains limited, and peptide vaccines have rarely been validated in vivo. Methods: Here, we report the rational antigen selection, synthesis, and preliminary immunogenicity evaluation of NiV fusion glycoprotein (NiV-F)-derived linear peptides as vaccine candidates. Candidate epitopes were identified by in silico, and a total of 18 B- and T-cell epitope-derived peptides were shortlisted for synthesis and antigenicity validation by ELISA. Results: Antigenicity evaluation showed that 9 of the synthesized peptides have A450nm of over 1 (8 from the F11 group, A450nm: 1.13–3.6; 1 from the F18 group, A450nm: 1.51), with the peptide constructs F11-3 (A450nm: 3.5) and F11-4 (A450nm: 3.6) showing the highest antigenicity. Interestingly, peptides from F11 with amidation increased antibody binding (F11-4-NH2, A450nm: 3.05; F11-4-9mer-1-NH2, A450nm: 0.87). The lead peptide candidates, F11-3 and F11-4, were subsequently used for the immunization experiment, and mouse sera were assessed against their homologous peptide antigens or recombinant NiV-F protein. ELISA result showed detectable antibody reactivity against their homologous antigen for the intramuscular (IM) F11-3 vaccinated group (A450nm: 0.30 ± 0.35), whereas increased binding was observed for both IM-administered F11-3 (A450nm: 1.62 ± 0.97) and F11-4 (A450nm: 2.0 ± 0.77) against NiV-F protein, albeit without statistical significance compared to the negative control (NC, p > 0.05), and were markedly lower compared to mice immunized with NiV-F recombinant protein (PC, p < 0.01), underscoring the need for further optimization procedures. Conclusions: Collectively, these results support an exploratory antigen discovery and prioritization framework for NiV-F-derived peptide candidates and provide a foundation for future studies aimed at optimizing immunogenicity and evaluating protective relevance in appropriate preclinical models.

1. Introduction

Nipah virus (NiV) is a highly pathogenic zoonotic Biosafety Level 4 (BSL-4) paramyxovirus that causes sporadic but devastating encephalitis and respiratory illness, with a case fatality rate ranging less than 40% to greater than 70%, and up to 90% in some outbreaks, depending on the strain and availability of intensive support care [1,2,3,4,5]. The virus was first identified in Malaysia in 1998 and has since caused sporadic to near-annual outbreaks in South and Southeast Asia, particularly in Bangladesh and India [4,6,7]. The principal natural reservoirs of NiV are fruit bats or flying foxes of the genus Pteropus spp., which are widely distributed across Southeast Asia, the South Pacific, and Australia, although other hosts including other bat species and mammals such as horses and pigs have also been reported, highlighting the broad species tropism of NiV [8,9,10]. Transmission is often associated with direct bat-to-human contact, through the excretions or secretions of infected animals or consumption and exposure to food products (i.e., meat, fruits, sap, or date palm juice) contaminated by body fluids of infected animals; however, once it spreads to people, human-to-human transmission can occur [11,12]. Due to the high virulence and human-to-human transmission, NiV is classified as a priority disease requiring urgent research and development by the World Health Organization R&D Blueprint [13]. While several candidates are in development, they remain in the early stages of clinical evaluation, and the medical countermeasures available to combat NiV remains severely limited and scarce, underscoring the continued effort for effective, scalable, and innovative strategies to be developed and deployed rapidly in response to an outbreak.
NiV is an enveloped, non-segmented, single-stranded negative-sense RNA virus within the Henipavirus genus of Paramyxoviridae family. Originally, the Henipavirus genus included Nipah and Hendra virus (HeV), but recent discoveries now include other paramyxoviruses within the same genus including bat-borne Cedar virus (CedV), Ghanavirus (GhV), and Angavokely virus (AngV); rodent-borne Mojiang virus (MojV); and shrew-borne Gamak virus (GakV), Daeryong virus (DarV), Langya virus (LayV), Melian virus (MelV), Denwin virus (DewV), and Ninorex virus (NinExV) [14,15,16,17,18,19,20,21]. To date, only NiV, HeV, and LeV are the recognized zoonotic agents capable of spillover into human, underscoring their potential as epidemic or pandemic threats [21,22]. While the majority of the novel henipaviruses have been confined to their reservoir hosts, their evolutionary proximity to recognized zoonotic henipaviruses and the expanding geographic and host range of henipaviruses highlights the likelihood that additional members of this genus may also emerge with zoonotic capacity [15,16,17,19]. Together, these reinforces the importance of integrated One Health approaches, proactive surveillance, and development of cross-protective platforms as part of pandemic preparedness efforts to mitigate risks and ensure global public health security.
Within henipaviruses, NiV is the most pathogenic, transmissible, and well-characterized virus, making it an ideal prototype pathogen to elucidate viral biology and develop translational frameworks in vaccine and therapeutic strategies across relevant emerging henipaviruses and the broader Paramyxoviridae family. NiV is generally categorized into two major genetic lineages, sharing approximately 91.8% nucleotide homology, NiV-Malaysia (NiV-MY), and Ni-V Bangladesh (NiV-BD), each with an approximately 18.2 kilobases (kb)-long genome that encodes for six major structural proteins (surface proteins: attachment glycoprotein G (G) and fusion glycoprotein (F); matrix protein (M); viral nucleocapsid protein (N); RNA-dependent polymerase complex: phosphoprotein (P) and large protein (L)) and three accessory proteins (V, W, and C) encoded by P gene through mRNA editing or an alternative open reading frame [23,24,25]. As with other paramyxovirus, the arrangement of the genes in the NiV genome sequentially follows the order 3′-N-P-M-F-G-L-5′ [24,25]. Both NiV strains are noted to inflict pulmonary and neurological disease in humans and animal models; however, NiV-BD presents a more virulent strain associated with higher mortality rates often exceeding 70% depending on outbreak, shorter mean disease duration from onset of symptom to death at five to six days, and evidence of human-to-human transmission [6,26,27]. Similar to other paramyxoviruses, the mechanism of NiV entry to host cells is mediated by the surface proteins, attachment glycoprotein G (NiV-G) and fusion glycoprotein (NiV-F) [28]. The virus entry is initiated when the NiV-G, a tetrameric type II membrane protein, binds to the host ephrin-B2 and ephrin B3 cell receptors, which are highly conserved across vertebrates and widely expressed in the endothelial and neuronal tissues, triggering a conformational change in the NiV-G structure [29,30,31]. The conformational change in the NiV-G signals the adjacent NiV-F, a trimeric class I fusion protein, to undergo refolding, resulting in viral and cell membrane fusion and subsequent viral genome entry into the cytoplasm [32].
Together, these two surface glycoproteins, NiV-G and NiV-F, are the prime target of neutralizing antibodies, and their role in viral entry places them as the principal focus for vaccine development delivered through diverse platforms including viral vectors, recombinant protein subunits, virus-like particles (VLPs), plasmid DNA, and, more recently, mRNA technologies [28,33]. Additionally, other countermeasures of NiV infection has been investigated using small molecules, antivirals, and monoclonal antibodies [34]. However, none of these candidates, vaccine or therapeutics, has received regulatory approval for human use to date. The majority of the candidates remain in preclinical evaluation, with only one antiviral drug (ribavirin), one monoclonal antibody (mAb102.4, clinical trial identifier: ACTRN12615000395538), mRNA vaccine (mRNA-1215, NCT05398796), subunit protein (HeV-sG-V, NCT04199169), and two viral-vectored vaccines (recombinant vesicular stomatitis-vectored vaccine (PHV02), NCT05178901; recombinant adenoviral-vectored vaccine (ChadOx1 NipahB), ISRCTN87634044) in clinical trials [35,36,37,38].
Over the years, conventional vaccine platforms such as mRNA and viral-vectored vaccines have made significant epidemiological progress in controlling various diseases. However, these vaccines are often limited by persistent manufacturing and logistical constraints associated with the complex vaccine manufacturing processes, high cost of production, potential off-target immune response, and strict biosafety and cold-chain stability requirements for their global deployment [39,40,41,42]. To this end, peptide-based vaccines emerge as a compelling complementary strategy. Unlike conventional vaccine platforms, peptide-based vaccines provide precise structural and operational advantages, with the production of a chemically defined and designed focus epitopes or antigenic determinants that are favorably safe without replicative properties, thermally stable, and feasible for rapid synthesis at scale, making them suitable for timely deployment in global health emergencies or resource-limited settings where manufacturability and cross-strain protection are critical [43,44]. On the other hand, eliciting a durable protective response from peptide vaccines requires a thorough antigen selection and design, as well as strategic incorporation of potent adjuvants or optimized delivery systems, as these vaccines are also limited by their inherently low immunogenicity and high susceptibility to in vivo degradation [43,45]. Despite these challenges in peptide vaccines, recent clinical advances and successes across diverse targets, including cancer and infectious diseases such as dengue, group A streptococci, and COVID-19, demonstrate the feasibility of the platform as a safe and viable vaccine alternative to conventional vaccine strategies to elicit protective immunity [46,47,48,49,50,51,52]. However, this remains unexplored in linear NiV-derived peptide epitopes.
In the context of NiV, the fusion glycoprotein (NiV-F) is a promising vaccine target inherent to its indispensable role for viral entry and its conserved nature across NiV strains [28,32,53]. Rational epitope selection on these conserved elements of NiV-F offers avenue for a design-focused and potentially broadly protective vaccines. Building on these ideas and the evidence that F-derived peptides from heptad repeat C (HRC), especially when conjugated with cholesterol, can inhibit NiV infection in vivo by blocking membrane fusion and act as direct viral fusion inhibitors, we extend these concepts of targeting the fusion protein from therapeutic inhibition to immunogens capable of eliciting adaptive immunity to offer a potentially more durable, population-wide protection essential for pandemic preparedness [54]. Unlike previous studies that focused largely on computational immunoinformatics analyses on NiV-F, our study presents the experimental design, synthesis, and evaluation of NiV-F-derived peptides as immunogens in a murine model [55,56,57]. By synthesizing linear F-derived peptides, our work presents an exploratory antigen discovery and prioritization framework that informs the future development of epitope-driven Nipah vaccine development and extends the scope of F-targeted strategies beyond therapeutic inhibition to preventive immunization against this high consequence pathogen.

2. Materials and Methods

2.1. Study Design Overview

The experimental timeline of the present study followed a systematic transition starting from computational prediction to experimental validation (Figure 1). The study progressed in sequential order, following epitope prediction and antigen selection, peptide synthesis, in vitro antigenicity testing, and in vivo immunization in a murine model.

2.2. Epitope Prediction and Antigen Selection

The NiV-F amino acid sequence (GenBank Accession: OR947674) for vaccine design was selected based on a previously reported NiV-F consensus gene sequence, which exhibited 98.54–100% similarity across NiV strains [46]. The protein structure of NiV-F was obtained from a resolved structure in Protein Data Bank (PDB ID: 6TYS), and protein visualization was performed in a Mol*3D viewer (https://www.rcsb.org/3d-view, accessed on 1 April 2025 to 30 October 2025) [58]. Linear B-cell and T-cell epitopes of NiV-F were identified using the Immune Epitope Database and Tools (IEDB, https://www.iedb.org/, accessed on 1 January 2024 to 31 March 2024) resource as previously described [59]. Briefly, linear B-cell epitopes were predicted using BepiPred-2.0 with a 0.5 threshold and T-cell epitopes including 9-mers were screened with NetMHCpan 4.1 [60,61]. The predicted B- and T-cell epitopes were then cross-referenced, and overlapping regions with high immunogenicity scores were prioritized for peptide synthesis and downstream evaluation.

2.3. Peptide Synthesis

Peptides were synthesized by Fmoc solid-phase peptide synthesis (SPSS) on Rink amide resin as described [52]. In this study, selected peptides were synthesized with C-terminal amidation to assess potential effects on peptide stability and antigenicity, while the remaining peptides were produced without terminal modification. In brief, resin was pre-swollen in N, N′-dimethylforamide (DMF) for 45 min, and the amino acids (5.0 equation, Novabiochem) were coupled using 1-O-Benzotriazole-N, N,N′, N′-tetramethyl-uronium-hexafluoro-phosphate (HBTU, 5.0 equation), hydroxybenzotriazole (HOBt, 5.0 equation), and diisopropylethylamine (DIPEA, 10.0 equation) for 1 h, followed by washing and Fmoc deprotection with 20% piperidine (1 × 10 min, 2 × 3 min). This cycle of coupling, washing, and deprotection was repeated until the sequence is complete, after which resin was thoroughly washed with DMF, methanol, dichloromethane, and ether, and then vacuum-dried. Peptide were cleaved from the resin with triisopropylsilane (TIS, 5%) and H2O (5%) in trifluoroacetic acid (TFA, approximately 2 mL of TFA per 100 mg of resin) for 2 h, precipitated in cold ether, collected by filtration, and dried. Crude products were then analyzed and purified by reverse-phase HPLC using a 10–90% acetonitrile (0.05% TFA) over 30 min on a Phenomenex column (C18, 250 × 4.60 mm, 5 micron) or Vydac HPLC columns (C18, 250 × 10 mm, 5 micron) at 1.0 mL/min or 2.5 mL/min, respectively, with detection at 230 nm. All synthesized peptides are endotoxin-free with >95% purity.

2.4. Antigenicity Assay

Antigenicity preliminary screening of synthesized peptides (Table 1) were assessed by indirect ELISA using serum from mice immunized with commercial recombinant Nipah virus glycoprotein F (Human Fc-Tag, REC31633, The Native Antigen, Oxford, UK). Experimental controls included recombinant NiV-F protein as the positive control (PC) and buffer-only wells as the negative control (NC). Microplates were coated and incubated overnight with 5 µg/mL of the synthesized peptides in coating buffer following established protocols [59]. Briefly, after blocking and incubation with test serum, the plates were probed with 50 µL/well HRP-conjugated goat anti-mouse IgG (1:50,000) H + L, (Abcam, Cambridge, UK), followed by 50 µL/well 1X TMB substrate solution (Thermo Fisher Scientific, Waltham, MA, USA). The assay reaction was then subsequently stopped with stop solution (0.5 M sulfuric acid), and the absorbance was detected at absorbance 450 nm (A450nm) using a microplate reader (SpectraMax i3x, Molecular Devices, San Jose, CA, USA). All assays were conducted in triplicates.

2.5. In Vivo Validation and Evaluation

A prime–booster immunization schedule was conducted over 4 weeks in five-week-old, female, specific-pathogen-free (SPF) BALB/c mice (Samtako, Osan-si, Republic of Korea). The mice were randomly assigned and immunized twice at two-week intervals, receiving either intramuscular (IM) injections of 400 µg peptide formulated with Alhydrogel® adjuvant (100 µg) or intravenous (IV) injections of 100 µg peptide (Table 2), based on a previous study [59]. Experimental controls were immunized intramuscularly with PBS (Negative Control, NC) and a positive control group (PC) receiving recombinant NiV-F protein (25 µg, Human Fc-Tag, REC31633, The Native Antigen, Oxford, UK). Antibody responses were evaluated by indirect ELISA, adapted from a previously described protocol [59]. Briefly, the plates were coated overnight at 4 °C with either their homologous peptide (5 µg/mL) or recombinant NiV-F protein to detect peptide-specific antibodies and recognition of native antigen, respectively. Microplate processing and result detection, thereafter, were performed as above in the antigenicity assay section. Mice were housed under standard laboratory conditions with ad libitum access to food and water. Daily monitoring for clinical signs including distress, lethargy, swelling on injection site, and mortality were strictly followed. Following anesthesia, blood collection was performed via the submandibular vein. All experiments involving animals were reviewed and approved by the Institutional Animal Care and Use Committee (IACUC) of the Korea Centers for Disease Control and Prevention (approval no. KDCA-IACUC-24-009, 26 March 2024).

2.6. Statistical Analysis

The data distribution was first assessed with the Shapiro–Wilk Test, and if at least one group did not meet normality assumptions, a non-parametric method was applied. Results are expressed as mean ± standard deviation (SD). Group comparisons were performed using the Mann–Whitney test for two-group comparison or the Kruskal–Wallis analysis with Dunn’s post hoc test for multiple comparison. Statistical significance was defined as p-value < 0.05. All analyses and data visualization were performed using GraphPad Prism (version 8.0, GraphPad Software Inc., San Diego, CA, USA).

3. Results

3.1. In Silico Prediction of NiV-F B- and T-Cell Epitopes

NiV represents a major biothreat requiring the development of effective vaccine capable of eliciting broad and balanced protective immunity. Ideally, such vaccines should stimulate both humoral and cellular immune responses through the inclusion of appropriate B-cell epitopes and T-cell epitopes that can stimulate antibody production and drive helper and cytotoxic response, respectively. In this context, in silico or computational vaccinology provides a powerful and accelerated strategy for vaccine discovery by integrating specialized computational tools that can rapidly identify and prioritize epitopes exhibiting strong antigenicity and robust Major Histocompatibility Complex (MHC)-binding properties, thereby significantly reducing cost, time, and stringent biosafety requirements with traditional screening. Applying this framework in the current work, NiV-F protein was screened using BepiPred, and 21 putative linear B-cell epitopes were identified, with lengths ranging from a single residue to a 23 amino acid sequence (Figure 2a, Table S1). In order to increase the biological relevance and refine the candidate pool towards immunologically relevant motifs, a stringent in-house selection criterion of retaining only epitopes with a minimum length of ≥9 amino acids was applied. This filter reduced the set to 11 high-confidence B-cell epitope candidates distributed across distinct regions of NiV-F (Figure 2b). These B-cell epitopes were subsequently cross-referenced with T-cell binding sites to identify sequences with dual reactivity. Groups F11 (score: 0.28647), F-18 (score: 0.1771), and F5 (score: 0.13426) demonstrated the highest predicted HLA Class I affinity scores (Table S2). A parallel prediction of nonameric peptides (9-mer) further revealed multiple strong MHC binders with four candidates from F-11 (GYATEDFDD, YATEDFDDL, LGYATEDFD, ATEDFDDLL), one from F-18 (YNSEGIAIG), and two from F-21 (SRLEDRRVR, RLEDRRVRP), with a score of over 0.2 (Figure 2c, Table S3). Together, these analyses identified F-11 and F-18 as the most robust epitope region within NiV-F, supported by strong B-cell prediction scores, overlapping T-cell binding potential, and high-scoring 9-mer cores.

3.2. NiV-F Antigen Selection, Design, and Synthesis

Based on the preliminary screening above, epitopes F11 (ETLLRTLGYATEDFDDLLESDSI) and F18 (LGSVNYNSEGIAIG) were selected as core antigens for vaccine design. In order to cover a broader antigenic coverage and enhance immunogenicity of the candidates, the core sequences were elongated at either the N- or C-termini following the consolidated prediction scores from the current work and from previous prediction reports, demonstrating high immunogenicity from these residues with lengths ranging from 14 to 30 amino acids [55,57,62,63]. Similarly, the four top-ranked 9-mer peptides YNSEGIAIG (score: 0.316, F18), GYATEDFDD (0.282, F11), YATEDFDDL (0.277, F11), and LGYATEDFD (0.257, F11) were synthesized individually to assess their potential as minimal stimulatory units. F-21 9-mer was excluded due to low scores for B/T epitope overlap screening. In order to improve stability of the peptide, C-terminal amidation was introduced selectively to the top and core B/T epitopes (F11: ETLLRTLGYATEDFDDLLESDSI-NH2 and F18: LGSVNYNSEGIAIG-NH2) and top two 9-mers (F18: YNSEGIAIG-NH2 and F11: GYATEDFDD-NH2), while the remaining peptides were synthesized without modification. Collectively, the final list of NiV-F-derived epitopes for peptide synthesis were constructs from F11 and F18. The sequences, amino acid positions, and design features are summarized in Table 1, while their schematic representation and structural distribution in the NiV-F monomer structure are illustrated in Figure 3a,b. The monomeric representation is used at this stage to illustrate the location of the candidate’s peptide prior to preliminary antigenicity evaluation. Notably, mapping all residues for the F11 group were mapped into Domain III, which forms the part of the apical coiled region of NiV-F, whereas the F18 group was mapped in Domain II near the C-terminal ectodomain adjacent to the Heptad repeat region [64].

3.3. Antigenic Profiles of NiV-F-Derived Peptides in Mice Sera

To evaluate the antigenicity of all synthesized peptide candidates, a preliminary screening was performed using indirect ELISA with sera obtained from mice immunized with recombinant NiV-F native protein. In this assay, the synthesized individual peptides were coated onto 96-wells ELISA plates as antigens, and antibody binding from NiV-F immunized mice sera was quantified as absorbance at 450 nm (A450nm) values. Mean endpoint absorbance values were used in this screening to guide peptide prioritization. Nine of the fourteen synthesized peptides from the F11 group showed higher A450nm values compared to NC, with the majority of the positive responses over A450nm values of 1 (Figure 3c). By contrast, F18-derived peptides demonstrated a more uniform reactivity, with all the constructs higher than NC, but only one exceeded an A450nm reading of 1 (F18-1-9-mer, A450nm: 1.51) (Figure 3d). Interestingly, terminal modification with NH2 influenced an increased antigenicity profile of the F11 peptide group (F11-4-NH2, A450nm: 3.05; F11-4-9mer-1-NH2, A450nm: 0.87) but not the F18 group (F18-1-NH2, A450nm: 0.81; F18-1-9-mer-NH2, A450nm: 0.70), as evidenced by an increased antibody binding for F11 A450nm values. Based on these results, the F18 group was excluded from further testing, whereas the top F-11 constructs, which exhibited the highest antibody reactivity (F11-3, A450nm: 3.5; F11-4, A450nm: 3.6), comparable to PC (NiV-F protein, A450nm: 3.98), were prioritized and advanced for in vivo immunization studies.

3.4. Immunogenicity Evaluation of the NiV-F-Derived Peptides in Mice

Based on the preliminary screening of the peptides, F11-3 and F11-4 were subsequently evaluated in a murine immunization model as an exploratory assessment to evaluate peptide-induced antibody responses, while minimizing animal use in accordance with the 3Rs principle (Replacement, Reduction, Refinement). The vaccination regimen and experimental design are illustrated in Figure 4a. Mice were immunized either IM with Alhydrogel® adjuvant or IV, and the sera were collected and evaluated using ELISA for vaccine-induced humoral responses. Specifically, to assess specificity and breath of the induced response, sera were tested against their homologous peptide to measure direct recognition of the antigen, or against recombinant NiV-F protein to evaluate cross-reactivity with the native antigen. At the end of the experiment, no other significant clinical signs or mortality were recorded in any group throughout the study period. ELISA findings showed that, when tested against their homologous peptide antigen, the IM F11-3 group exhibited the highest antibody reactivity with A450nm: 0.30 ± 0.35 (Figure 4b). On the other hand, in relation to the NiV-F recombinant protein, both IM-administered groups, F11-3 (A450nm: 1.62 ± 0.97) and F11-4 (A450nm: 2.0 ± 0.77), showed elevated binding relative to the NC groups (A450nm: 0.81 ± 0.12) but were not statistically significant (Figure 4c). In general, all IV-administered peptides showed a generally lower detectable immune response. As expected, the positive control vaccinated with the recombinant NiV-F vaccine showed the highest antibody reactivity (A450nm: 3.91 ± 0.02), with NC (p < 0.001) and all peptide groups were significantly different (IV: p < 0.001; IM: p < 0.001). The structural location of the peptides used in the in vivo trial showed their position in the central coiled domain, highlighting their spatial orientation and accessibility within the trimeric NiV-F assembly (Figure 5). Collectively, these minimally designed peptides can elicit low level, route-dependent humoral immune response that can recognize both their homologous antigen and the native protein. However, at this stage, further studies are needed to enhance their performance and immunogenicity since the magnitude of response remained significantly reduced compared with the full-length antigen immunization.

4. Discussion

NiV is a highly zoonotic paramyxovirus, considered a high-priority pathogen by the WHO, with broad species tropism, a high case fatality rate, and pandemic potential [13]. Since its first outbreak in 1998, no licensed human vaccine has been available, necessitating continued efforts in vaccine development as part of global preparedness efforts [5]. To date, several therapeutics and vaccine candidates are in various stages of development using different platforms [33,34]. Peptide-based vaccines, although theoretically attractive due to their ease of synthesis, high adaptability in the event of mutations during outbreaks, and generally safer nature, remain unexplored in NiV [44]. The current study investigated the design, synthesis, and evaluation of short NiV-F-derived peptides as potential immunogens in a murine model.
NiV-F is a pivotal therapeutic target in Nipah vaccine research, as it is both a major site for neutralizing antibody binding and essential for mediating the fusion of the viral and host membrane to allow viral entry to host cell [28]. In order to streamline the identification of optimal peptide vaccine candidates in this work, we employed computational analyses to determine immunologically relevant B- and T-cell epitopes of NiV-F based on their high antigenicity scores and strong predicted binding affinity to MHC molecules. Only peptides meeting a stringent threshold for both criteria were prioritized for subsequent synthesis and experimental evaluation. Similar workflows have been employed in other peptide-based vaccine studies for various infectious pathogens to increase the likelihood of identifying highly antigenic and immunogenic epitopes [65,66]. This screening and prioritization process substantially reduce the number of candidate peptides requiring synthesis and experimental validation, demonstrating a more resource-efficient pathway for early vaccine discovery, which is highly adaptable against high-containment pathogens like NiV.
Here, a total of 18 peptides were shortlisted and synthesized. The majority of these peptides were derived from the domain III region (F11 peptide group) of NiV-F, whereas the remaining are mapped to domain II (F18 peptide groups) near the C-terminal ectodomain. Preliminary antigenicity screening of the NiV-F epitope-derived peptides with serum from NiV-F recombinant protein–vaccinated mice showed that antibodies from the sera can recognize F11 peptides more strongly than those from F18. This finding can be attributed to the structural location of the F11 peptides in domain III, specifically in the apical coil region, which is more exposed and immunodominant compared to domain II, which is only transiently exposed and structurally constrained [64]. Similar patterns have been reported, where pre-fusion specific epitopes at the apex of the fusion protein elicit a stronger antibody response than the transiently exposed regions [64,67,68]. Collectively, the results validate the predictive pipeline used to identify NiV-F-derived linear peptide segments and highlight the importance of experimental validation of computational results, as well as the role of structural context in determining which linear peptide segments are most likely to reflect the naturally immunogenic region of the F protein.
Furthermore, chemical stabilization through C-terminal amidation to the top-ranked linear epitopes was investigated herein. Notably, the enhanced antibody binding in ELISA of F11-derived peptides with C-terminal amidation confirms that the modification stabilized the peptide backbone by improving the structural mimicry of the native protein, thereby promoting recognition by antibodies present in NiV-F immune sera. These results concur with the previous literature regarding the enhanced stability of the peptide and peptide–antibody recognition conferred through terminal amidation or other chemical modifications [59,69]. In contrast, amidation of F18-derived peptides yielded no comparable advantage, as their low antigenicity persisted despite the modification. The differential outcomes in the current study suggest that chemical amidation enhance the performance of surface-exposed regions but offers limited benefit for conformationally constrained or less accessible regions within the NiV-F glycoprotein structure.
Epitopes demonstrating highest antibody recognition in the preliminary ELISA-based screening were advanced to in vivo immunization studies. In this phase, selected peptides were administered to mice, and the sera were subsequently evaluated by indirect ELISA using either the homologous vaccination peptide or the recombinant NiV-F protein as coating antigens. This approach enabled qualitative evaluation of peptide-induced antibody binding and antigenic cross-recognition. In the in vivo immunization study, the strongest homologous antibody reactivity was observed in mice immunized IM with F11-3. Furthermore, when sera from these immunized mice were tested against full-length recombinant NiV-F protein, both F11-3 and F11-4 delivered via the IM route exhibited increased cross-reactive binding. The observed cross-reactivity of sera from peptide-vaccinated mice with the native glycoprotein demonstrates that these linear epitopes retain sufficient antigenic fidelity to be recognized in the context of the full fusion glycoprotein, even in the absence of a complete conformational structure [43]. By comparison, intravenous administration of the peptides consistently resulted in a low detectable immune response. This outcome is likely due to rapid clearance of the free peptides from circulation and limited engagement with antigen-presenting cells, in contrast to IM delivery with alum adjuvant, which promotes antigen depot formation and germinal center activation [44,70,71]. Aluminum salt adjuvants are the most widely used adjuvants in vaccine formulation known to elicit strong Th2 immune response [72]. In the present study, IM immunization with alum-adjuvanted peptides elicited lower antibody response compared with recombinant NiV-F protein. This difference could reflect the inherent size- and structure-related limitations, as well as the lower immunogenicity of short linear peptides relative to full-length protein antigens. Earlier reports also demonstrated limited adjuvant potency of aluminum salts for short peptide antigens [73,74]. Although aluminum adjuvants can bind to peptide antigens and modulate their release kinetics to prolong its bioavailability and enhance antigen presentation, the effectiveness of this combination is highly dependent on the charge, size, pH, hydrophobicity, and morphology of the aluminum nanoparticle [43,75]. Despite the lower magnitude of antibody responses relative to recombinant protein controls, peptide immunization elicited detectable cross-reactive antibodies against NiV-F glycoprotein, supporting the antigenic relevance of the selected linear epitopes.

5. Conclusions

Taken together, the results from this work present an exploratory evaluation of linear peptide epitopes derived from NiV-F Domain III, demonstrating detectable antigenicity and low-level immunogenicity following intramuscular administration in a murine model. The observed antibody recognition of recombinant NiV-F protein by sera from peptide-immunized mice indicates partial cross-reactivity with the native antigen; however, immune response was modest, variable, and did not reach statistical significance. These findings underscore the strong influence of epitope selection and route of administration on peptide immunogenicity, as well as the inherent limitations of short linear peptides relative to full-length proteins when administered with baseline aluminum-based adjuvants without structural scaffolding or optimized delivery strategies. In addition, the absence of relevant peptide controls and the high variability observed in the in vivo experiment likely reflect the small group size and the intrinsically low immunogenicity of the formulated linear peptide. Importantly, the results in the current work present an antigen discovery and prioritization effort rather than evidence of protective efficacy. To advance the translational potential of this platform, future studies should focus on strategies to enhance immunogenicity through strategies such as epitope multimerization, conjugation to inert carrier proteins, or optimized adjuvant and delivery systems. Moreover, defining functional correlates of protection using neutralization assay and cellular immune readouts, together with characterization of peptide biodistribution and in vivo persistence, will be critical to inform delivery strategies, dosing, and protective relevance in appropriate models. Collectively, these findings provide a foundation for rational refinement of peptide-based vaccines against NiV, positioning the platform as a resource-efficient and structurally defined complementary strategy within the broader landscape of NiV vaccine development.

Supplementary Materials

The following supporting information can be downloaded at https://www.mdpi.com/article/10.3390/vaccines14010084/s1. Table S1: Summary of Nipah virus fusion (NiV-F) glycoprotein B-cell epitopes in silico prediction results. Table S2: Summary of the predicted T-cell epitope sequences in Nipah virus fusion (NiV-F) glycoprotein. Table S3: List of predicted Nipah virus fusion (NiV-F) glycoprotein 9-mer epitope candidates.

Author Contributions

Conceptualization, S.Y.M., I.-O.O. and W.H.K.; Methodology, S.Y.M., E.B.C., S.K., E.Y.J., H.L. and Y.-K.L.; Investigation, S.Y.M., E.B.C., S.K., E.Y.J., H.L. and Y.-K.L.; Resources and Acquisition of Data for the Work, S.K., H.J., E.Y.J. and Y.-K.L.; Interpretation of Data for the Work, S.Y.M., R.A.F., E.B.C., H.J. and H.L.; Validation, R.A.F. and H.J.; Formal Analysis, R.A.F., S.K., E.Y.J., H.L. and Y.-K.L.; Visualization, R.A.F., E.B.C. and H.J.; Writing—Original Draft, S.Y.M. and R.A.F.; Writing—Review and Editing, all authors; Supervision, Project Administration, and Funding Acquisition, I.-O.O. and W.H.K. All authors have read and agreed to the published version of the manuscript.

Funding

This study received funding from the Korea Disease Control and Prevention Agency (KDCA) [grant number 6634-332, Intramural Research No. 2024-NI-026-01] and the Korea Institute of Planning and Evaluation for Technology in Food, Agriculture and Forestry (IPET) through the High-Risk Animal Infectious Disease Control Technology Development Project, funded by the Ministry of Agriculture, Food, and Rural Affairs (MAFRA) (RS-2024-00399808).

Institutional Review Board Statement

All animal procedures were reviewed and approved by the Institutional Animal Care and Use Committee (IACUC) of the Korea Centers for Disease Control and Prevention (approval no. KDCA-IACUC-24-009, 26 March 2024).

Informed Consent Statement

Not applicable.

Data Availability Statement

All data used in the analyses are provided within this article and its Supplementary Materials. For any additional questions, please reach out to the authors responsible for correspondence.

Conflicts of Interest

The authors affirm that there are no commercial or financial ties that might be seen as a potential conflict of interest.

References

  1. Khan, S.; Akbar, S.M.F.; Mahtab, M.A.; Uddin, M.N.; Rashid, M.M.; Yahiro, T.; Hashimoto, T.; Kimitsuki, K.; Nishizono, A. Twenty-Five Years of Nipah Outbreaks in Southeast Asia: A Persistent Threat to Global Health. IJID Reg. 2024, 13, 100434. [Google Scholar] [CrossRef] [Scilit]
  2. Sun, Y.Q.; Zhang, Y.Y.; Liu, M.C.; Chen, J.J.; Li, T.T.; Liu, Y.N.; Zhang, L.Y.; Wang, T.; Yu, L.J.; Che, T.-L.; et al. Mapping the Distribution of Nipah Virus Infections: A Geospatial Modelling Analysis. Lancet Planet. Health 2024, 8, e463–e475. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Arunkumar, G.; Chandni, R.; Mourya, D.T.; Singh, S.K.; Sadanandan, R.; Sudan, P.; Bhargava, B. Outbreak Investigation of Nipah Virus Disease in Kerala, India, 2018. J. Infect. Dis. 2019, 219, 1867–1878. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Luby, S.P.; Hossain, M.J.; Gurley, E.S.; Ahmed, B.N.; Banu, S.; Khan, S.U.; Homaira, N.; Rota, P.A.; Rollin, P.E.; Comer, J.A.; et al. Recurrent Zoonotic Transmission of Nipah Virus into Humans, Bangladesh, 2001–2007. Emerg. Infect. Dis. 2009, 15, 1229–1235. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Chua, K.; Bellini, W.; Rota, P.; Harcourt, B.; Tamin, A.; Lam, S.; Ksiazek, T.; Rollin, P.; Zaki, S.; Shieh, W.; et al. Nipah Virus: A Recently Emergent Deadly Paramyxovirus. Science 2000, 108, 288. [Google Scholar] [CrossRef] [Scilit]
  6. Tan, F.H.; Sukri, A.; Idris, N.; Ong, K.C.; Schee, J.P.; Tan, C.T.; Tan, S.H.; Wong, K.T.; Wong, L.P.; Tee, K.K.; et al. A Systematic Review on Nipah Virus: Global Molecular Epidemiology and Medical Countermeasures Development. Virus Evol. 2024, 10, veae048. [Google Scholar] [CrossRef] [Scilit]
  7. Sahay, R.R.; Patil, D.Y.; Chenayil, S.; Shete, A.M.; PS, K.S.; Mohandas, S.; Balasubramanian, R.; Gaikwad, S.; Siba, S.; Remesh, A.T.; et al. Encephalitis-Predominant Nipah Virus Outbreaks in Kerala, India during 2024. J. Infect. Public Health 2025, 18, 102782. [Google Scholar] [CrossRef] [Scilit]
  8. Chew, M.H.L.; Arguin, P.M.; Shay, D.K.; Goh, K.T.; Rollin, P.E.; Shieh, W.J.; Zaki, S.R.; Rota, P.A.; Ling, A.E.; Ksiazek, T.G.; et al. Risk Factors for Nipah Virus Infection among Abattoir Workers in Singapore. J. Infect. Dis. 2000, 181, 1760–1763. [Google Scholar] [CrossRef] [Scilit]
  9. Ching, P.K.G.; de Los Reyes, V.C.; Sucaldito, M.N.; Tayag, E.; Columna-Vingno, A.B.; Malbas, F.F.; Bolo, G.C.; Sejvar, J.J.; Eagles, D.; Playford, G.; et al. Outbreak of Henipavirus Infection, Philippines, 2014. Emerg. Infect. Dis. 2015, 21, 328–331. [Google Scholar] [CrossRef] [Scilit]
  10. van den Hurk, S.; Yondo, A.; Velayudhan, B.T. Laboratory Diagnosis of Hendra and Nipah: Two Emerging Zoonotic Diseases with One Health Significance. Viruses 2025, 17, 1003. [Google Scholar] [CrossRef] [Scilit]
  11. Anish, T.S.; Aravind, R.; Radhakrishnan, C.; Gupta, N.; Yadav, P.D.; Cherian, J.J.; Sahay, R.; Chenayil, S.; Anoop Kumar, A.S.; Moorkoth, A.P.; et al. Pandemic Potential of the Nipah Virus and Public Health Strategies Adopted during Outbreaks: Lessons from Kerala, India. PLoS Glob. Public Health 2024, 4, e0003926. [Google Scholar] [CrossRef] [Scilit]
  12. Yadav, P.D.; Baid, K.; Patil, D.Y.; Shirin, T.; Rahman, M.Z.; Peel, A.J.; Epstein, J.H.; Montgomery, J.M.; Plowright, R.K.; Salje, H.; et al. A One Health Approach to Understanding and Managing Nipah Virus Outbreaks. Nat. Microbiol. 2025, 10, 1272–1281. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Bloom, D.E.; Cadarette, D. Infectious Disease Threats in the Twenty-First Century: Strengthening the Global Response. Front. Immunol. 2019, 10, 549. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Drexler, J.F.; Corman, V.M.; Gloza-Rausch, F.; Seebens, A.; Annan, A.; Ipsen, A.; Kruppa, T.; Müller, M.A.; Kalko, E.K.V.; Adu-Sarkodie, Y.; et al. Henipavirus RNA in African Bats. PLoS ONE 2009, 4, e6367. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Horemans, M.; Van Bets, J.; Joly Maes, T.; Maes, P.; Vanmechelen, B. Discovery and Genome Characterization of Six New Orthoparamyxoviruses in Small Belgian Mammals. Virus Evol. 2023, 9, vead065. [Google Scholar] [CrossRef] [Scilit]
  16. Lee, S.H.; Kim, K.; Kim, J.; No, J.S.; Park, K.; Budhathoki, S.; Lee, S.H.; Lee, J.; Cho, S.H.; Cho, S.; et al. Discovery and Genetic Characterization of Novel Paramyxoviruses Related to the Genus Henipavirus in Crocidura Species in the Republic of Korea. Viruses 2021, 13, 2020. [Google Scholar] [CrossRef] [Scilit]
  17. Madera, S.; Kistler, A.; Ranaivoson, H.C.; Ahyong, V.; Andrianiaina, A.; Andry, S.; Raharinosy, V.; Randriambolamanantsoa, T.H.; Ravelomanantsoa, N.A.F.; Tato, C.M.; et al. Discovery and Genomic Characterization of a Novel Henipavirus, Angavokely Virus, from Fruit Bats in Madagascar. J. Virol. 2022, 96, e0092122. [Google Scholar] [CrossRef] [Scilit]
  18. Marsh, G.A.; de Jong, C.; Barr, J.A.; Tachedjian, M.; Smith, C.; Middleton, D.; Yu, M.; Todd, S.; Foord, A.J.; Haring, V.; et al. Cedar Virus: A Novel Henipavirus Isolated from Australian Bats. PLoS Pathog. 2012, 8, e1002836. [Google Scholar] [CrossRef] [Scilit]
  19. Vanmechelen, B.; Meurs, S.; Horemans, M.; Loosen, A.; Maes, T.J.; Laenen, L.; Vergote, V.; Koundouno, F.R.; Magassouba, N.; Konde, M.K.; et al. The Characterization of Multiple Novel Paramyxoviruses Highlights the Diverse Nature of the Subfamily Orthoparamyxovirinae. Virus Evol. 2022, 8, veac061. [Google Scholar] [CrossRef] [Scilit]
  20. Wu, Z.; Yang, L.; Yang, F.; Ren, X.; Jiang, J.; Dong, J.; Sun, L.; Zhu, Y.; Zhou, H.; Jin, Q. Novel Henipa-like Virus, Mojiang Paramyxovirus, in Rats, China, 2012. Emerg. Infect. Dis. 2014, 20, 1062–1064. [Google Scholar] [CrossRef] [Scilit]
  21. Zhang, X.-A.; Li, H.; Jiang, F.-C.; Zhu, F.; Zhang, Y.-F.; Chen, J.-J.; Tan, C.-W.; Anderson, D.E.; Fan, H.; Dong, L.-Y.; et al. A Zoonotic Henipavirus in Febrile Patients in China. N. Engl. J. Med. 2022, 387, 470–472. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Broder, C.C.; Weir, D.L.; Reid, P.A. Hendra Virus and Nipah Virus Animal Vaccines. Vaccine 2016, 34, 3525–3534. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Cox, R.M.; Plemper, R.K. Structure and Organization of Paramyxovirus Particles. Curr. Opin. Virol. 2017, 24, 105–114. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Harcourt, B.H.; Lowe, L.; Tamin, A.; Liu, X.; Bankamp, B.; Bowden, N.; Rollin, P.E.; Comer, J.A.; Ksiazek, T.G.; Hossain, M.J.; et al. Genetic Characterization of Nipah Virus, Bangladesh, 2004. Emerg. Infect. Dis. 2005, 11, 1594–1597. [Google Scholar] [CrossRef] [Scilit]
  25. Vigant, F.; Lee, B. Hendra and Nipah Infection: Pathology, Models and Potential Therapies. Infect. Disord. Drug Targets 2012, 11, 315–336. [Google Scholar] [CrossRef] [Scilit]
  26. Ang, B.S.P.; Lim, T.C.C.; Wang, L. Nipah Virus Infection. J. Clin. Microbiol. 2018, 56, e01875-17. [Google Scholar] [CrossRef] [Scilit]
  27. Pigeaud, D.D.; Geisbert, T.W.; Woolsey, C. Animal Models for Henipavirus Research. Viruses 2023, 15, 980. [Google Scholar] [CrossRef] [Scilit]
  28. Tamin, A.; Harcourt, B.H.; Ksiazek, T.G.; Rollin, P.E.; Bellini, W.J.; Rota, P.A. Functional Properties of the Fusion and Attachment Glycoproteins of Nipah Virus. Virology 2002, 296, 190–200. [Google Scholar] [CrossRef] [Scilit]
  29. Bossart, K.N.; Tachedjian, M.; McEachern, J.A.; Crameri, G.; Zhu, Z.; Dimitrov, D.S.; Broder, C.C.; Wang, L.F. Functional Studies of Host-Specific Ephrin-B Ligands as Henipavirus Receptors. Virology 2008, 372, 357–371. [Google Scholar] [CrossRef] [Scilit]
  30. Bowden, T.A.; Aricescu, A.R.; Gilbert, R.J.C.; Grimes, J.M.; Jones, E.Y.; Stuart, D.I. Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2. Nat. Struct. Mol. Biol. 2008, 15, 567–572. [Google Scholar] [CrossRef] [Scilit]
  31. Ortega, V.; Zamora, J.L.R.; Monreal, I.A.; Hoffman, D.T.; Ezzatpour, S.; Johnston, G.P.; Contreras, E.M.; Vilchez-Delgado, F.J.; Aguilar, H.C. Novel Roles of the Nipah Virus Attachment Glycoprotein and Its Mobility in Early and Late Membrane Fusion Steps. mBio 2022, 13, e0322221. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  32. Zamora, J.L.R.; Ortega, V.; Johnston, G.P.; Li, J.; Aguilar, H.C. Novel Roles of the N1 Loop and N4 Alpha-Helical Region of the Nipah Virus Fusion Glycoprotein in Modulating Early and Late Steps of the Membrane Fusion Cascade. J. Virol. 2021, 95, 10-1128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Gómez Román, R.; Tornieporth, N.; Cherian, N.G.; Shurtleff, A.C.; L’Azou Jackson, M.; Yeskey, D.; Hacker, A.; Mungai, E.; Le, T.T. Medical Countermeasures against Henipaviruses: A Review and Public Health Perspective. Lancet Infect. Dis. 2022, 22, e13–e27. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Chan, X.H.S.; Haeusler, I.L.; Choy, B.J.K.; Hassan, M.Z.; Takata, J.; Hurst, T.P.; Jones, L.M.; Loganathan, S.; Harriss, E.; Dunning, J.; et al. Therapeutics for Nipah Virus Disease: A Systematic Review to Support Prioritisation of Drug Candidates for Clinical Trials. Lancet Microbe 2024, 6, 101002. [Google Scholar] [CrossRef] [Scilit]
  35. Kim, S.; Kang, H.; Skrip, L.; Sahastrabuddhe, S.; Islam, A.; Jung, S.M.; Vesga, J.F.; Endo, A.; Edmunds, W.J.; Abbas, K. Progress and Challenges in Nipah Vaccine Development and Licensure for Epidemic Preparedness and Response. Expert Rev. Vaccines 2025, 24, 183–193. [Google Scholar] [CrossRef] [Scilit]
  36. Playford, E.G.; Munro, T.; Mahler, S.M.; Elliott, S.; Gerometta, M.; Hoger, K.L.; Jones, M.L.; Griffin, P.; Lynch, K.D.; Carroll, H.; et al. Safety, Tolerability, Pharmacokinetics, and Immunogenicity of a Human Monoclonal Antibody Targeting the G Glycoprotein of Henipaviruses in Healthy Adults: A First-in-Human, Randomised, Controlled, Phase 1 Study. Lancet Infect. Dis. 2020, 20, 445–454. [Google Scholar] [CrossRef] [Scilit]
  37. Monath, T.P.; Nichols, R.; Feldmann, F.; Griffin, A.; Haddock, E.; Callison, J.; Meade-White, K.; Okumura, A.; Lovaglio, J.; Hanley, P.W.; et al. Immunological Correlates of Protection Afforded by PHV02 Live, Attenuated Recombinant Vesicular Stomatitis Virus Vector Vaccine against Nipah Virus Disease. Front. Immunol. 2023, 14, 1216225. [Google Scholar] [CrossRef] [Scilit]
  38. Angus, B. A Study of a New Vaccine Against Nipah Virus in Adults Aged 18 to 55 Years (ISRCTN: ISRCTN87634044). 2023. Available online: https://www.isrctn.com/ISRCTN87634044 (accessed on 3 February 2025).
  39. Excler, J.L.; Saville, M.; Berkley, S.; Kim, J.H. Vaccine Development for Emerging Infectious Diseases. Nat. Med. 2021, 27, 591–600. [Google Scholar] [CrossRef] [Scilit]
  40. Rodrigue, V.; Gravagna, K.; Yao, J.; Nafade, V.; Basta, N.E. Current Progress towards Prevention of Nipah and Hendra Disease in Humans: A Scoping Review of Vaccine and Monoclonal Antibody Candidates Being Evaluated in Clinical Trials. Trop. Med. Int. Health 2024, 29, 354–364. [Google Scholar] [CrossRef] [Scilit]
  41. Rosa, S.S.; Prazeres, D.M.F.; Azevedo, A.M.; Marques, M.P.C. MRNA Vaccines Manufacturing: Challenges and Bottlenecks. Vaccine 2021, 39, 2190–2200. [Google Scholar] [CrossRef] [Scilit]
  42. Zafar, S.; Akhtar, A.; Sayed, E.; Onaiwu, E.; Arshad, M.S.; Ahmad, Z. Vaccine Formulation Design: Challenges and Opportunities. RSC Pharm. 2025, 2, 490–516. [Google Scholar] [CrossRef] [Scilit]
  43. Kalita, P.; Tripathi, T. Methodological Advances in the Design of Peptide-Based Vaccines. Drug Discov. Today 2022, 27, 1367–1380. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Purcell, A.W.; McCluskey, J.; Rossjohn, J. More than One Reason to Rethink the Use of Peptides in Vaccine Design. Nat. Rev. Drug Discov. 2007, 6, 404–414. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Malonis, R.J.; Lai, J.R.; Vergnolle, O. Peptide-Based Vaccines: Current Progress and Future Challenges. Chem. Rev. 2020, 120, 3210–3229. [Google Scholar] [CrossRef] [Scilit]
  46. Fujiwara, Y.; Okada, K.; Omori, T.; Sugimura, K.; Miyata, H.; Ohue, M.; Kobayashi, S.; Takahashi, H.; Nakano, H.; Mochizuki, C.; et al. Multiple Therapeutic Peptide Vaccines for Patients with Advanced Gastric Cancer. Int. J. Oncol. 2017, 50, 1655–1662. [Google Scholar] [CrossRef] [Scilit]
  47. Heitmann, J.S.; Tandler, C.; Marconato, M.; Nelde, A.; Habibzada, T.; Rittig, S.M.; Tegeler, C.M.; Maringer, Y.; Jaeger, S.U.; Denk, M.; et al. Phase I/II Trial of a Peptide-Based COVID-19 T-Cell Activator in Patients with B-Cell Deficiency. Nat. Commun. 2023, 14, 5032. [Google Scholar] [CrossRef] [Scilit]
  48. Meier-Stephenson, V.; Hawkes, M.T.; Burton, C.; Calcutt, A.; Davis, C.; Dooley, J.; Good, M.; Houghton, M.; Keeffe, E.; Kim, K.; et al. A Phase 1 Randomized Controlled Trial of a Peptide-Based Group A Streptococcal Vaccine in Healthy Volunteers. Trials 2024, 25, 781. [Google Scholar] [CrossRef] [Scilit]
  49. Miauton, A.; Audran, R.; Besson, J.; Maby-El Hajjami, H.; Karlen, M.; Warpelin-Decrausaz, L.; Sene, L.; Schaufelberger, S.; Faivre, V.; Faouzi, M.; et al. Safety and Immunogenicity of a Synthetic Nanoparticle-Based, T Cell Priming Peptide Vaccine against Dengue in Healthy Adults in Switzerland: A Double-Blind, Randomized, Vehicle-Controlled, Phase 1 Study. eBioMedicine 2024, 99, 104922. [Google Scholar] [CrossRef] [Scilit]
  50. Saxena, M.; Marron, T.U.; Kodysh, J.; Finnigan, J.P.; Onkar, S.; Kaminska, A.; Tuballes, K.; Guo, R.; Sabado, R.L.; Meseck, M.; et al. PGV001, a Multi-Peptide Personalized Neoantigen Vaccine Platform: Phase I Study in Patients with Solid and Hematologic Malignancies in the Adjuvant Setting. Cancer Discov. 2025, 15, 931–947. [Google Scholar] [CrossRef] [Scilit]
  51. Tandler, C.; Heitmann, J.S.; Michel, T.M.; Marconato, M.; Jaeger, S.U.; Tegeler, C.M.; Denk, M.; Richter, M.; Oezbek, M.T.; Maringer, Y.; et al. Long-Term Efficacy of the Peptide-Based COVID-19 T Cell Activator CoVac-1 in Healthy Adults. Int. J. Infect. Dis. 2024, 139, 69–77. [Google Scholar] [CrossRef] [Scilit]
  52. Vavolizza, R.D.; Petroni, G.R.; Mauldin, I.S.; Chianese-Bullock, K.A.; Olson, W.C.; Smith, K.T.; Dengel, L.T.; Haden, K.; Grosh, W.W.; Kaur, V.; et al. Phase I/II Clinical Trial of a Helper Peptide Vaccine plus PD-1 Blockade in PD-1 Antibody-Naïve and PD-1 Antibody-Experienced Patients with Melanoma (MEL64). J. Immunother. Cancer 2022, 10, e005424. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Moon, S.Y.; Flores, R.A.; Yim, M.S.; Lim, H.; Kim, S.; Lee, S.Y.; Lee, Y.; Kim, J.-O.; Park, H.; Bae, S.E.; et al. Immunogenicity and Neutralization of Recombinant Vaccine Candidates Expressing F and G Glycoproteins against Nipah Virus. Vaccines 2024, 12, 999. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Porotto, M.; Rockx, B.; Yokoyama, C.C.; Talekar, A.; DeVito, I.; Palermo, L.M.; Liu, J.; Cortese, R.; Lu, M.; Feldmann, H.; et al. Inhibition of Nipah Virus Infection In Vivo: Targeting an Early Stage of Paramyxovirus Fusion Activation during Viral Entry. PLoS Pathog. 2010, 6, e1001168. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Kamthania, M.; Sharma, D.K. Screening and Structure-Based Modeling of T-Cell Epitopes of Nipah Virus Proteome: An Immunoinformatic Approach for Designing Peptide-Based Vaccine. 3 Biotech 2015, 5, 877–882. [Google Scholar] [CrossRef] [Scilit]
  56. Kaur, B.; Karnwal, A.; Bansal, A.; Malik, T. An Immunoinformatic-Based in Silico Identification on the Creation of a Multiepitope-Based Vaccination Against the Nipah Virus. BioMed Res. Int. 2024, 2024, 4066641. [Google Scholar] [CrossRef] [Scilit]
  57. Sakib, M.S.; Islam, R.; Hasan, A.K.M.M.; Nabi, A.H.M.N. Prediction of Epitope-Based Peptides for the Utility of Vaccine Development from Fusion and Glycoprotein of Nipah Virus Using in Silico Approach. Adv. Bioinform. 2014, 2014, 402492. [Google Scholar] [CrossRef] [Scilit]
  58. Sehnal, D.; Bittrich, S.; Deshpande, M.; Svobodová, R.; Berka, K.; Bazgier, V.; Velankar, S.; Burley, S.K.; Koča, J.; Rose, A.S. Mol*Viewer: Modern Web App for 3D Visualization and Analysis of Large Biomolecular Structures. Nucleic Acids Res. 2021, 49, W431–W437. [Google Scholar] [CrossRef] [Scilit]
  59. Kim, S.; Flores, R.A.; Moon, S.Y.; Lee, S.Y.; Altanzul, B.; Baek, J.; Choi, E.B.; Lim, H.; Jang, E.Y.; Lee, Y.K.; et al. Design and Preliminary Immunogenicity Evaluation of Nipah Virus Glycoprotein G Epitope-Based Peptide Vaccine in Mice. Vaccines 2025, 13, 428. [Google Scholar] [CrossRef] [Scilit]
  60. Jespersen, M.C.; Peters, B.; Nielsen, M.; Marcatili, P. BepiPred-2.0: Improving Sequence-Based B-Cell Epitope Prediction Using Conformational Epitopes. Nucleic Acids Res. 2017, 45, W24–W29. [Google Scholar] [CrossRef] [Scilit]
  61. Reynisson, B.; Alvarez, B.; Paul, S.; Peters, B.; Nielsen, M. NetMHCpan-4.1 and NetMHCIIpan-4.0: Improved Predictions of MHC Antigen Presentation by Concurrent Motif Deconvolution and Integration of MS MHC Eluted Ligand Data. Nucleic Acids Res. 2021, 48, W449–W454. [Google Scholar] [CrossRef] [Scilit]
  62. Kaushik, V. In Silico Identification of Epitope-Based Peptide Vaccine for Nipah Virus. Int. J. Pept. Res. Ther. 2020, 26, 1147–1153. [Google Scholar] [CrossRef] [Scilit]
  63. Rahman, M.M.; Puspo, J.A.; Adib, A.A.; Hossain, M.E.; Alam, M.M.; Sultana, S.; Islam, A.; Klena, J.D.; Montgomery, J.M.; Satter, S.M.; et al. An Immunoinformatics Prediction of Novel Multi-Epitope Vaccines Candidate Against Surface Antigens of Nipah Virus. Int. J. Pept. Res. Ther. 2022, 28, 123. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Byrne, P.O.; Fisher, B.E.; Ambrozak, D.R.; Blade, E.G.; Tsybovsky, Y.; Graham, B.S.; McLellan, J.S.; Loomis, R.J. Structural Basis for Antibody Recognition of Vulnerable Epitopes on Nipah Virus F Protein. Nat. Commun. 2023, 14, 1494. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Chan, Y.; Jazayeri, S.D.; Ramanathan, B.; Poh, C.L. Enhancement of Tetravalent Immune Responses to Highly Conserved Epitopes of a Dengue Peptide Vaccine Conjugated to Polystyrene Nanoparticles. Vaccines 2020, 8, 417. [Google Scholar] [CrossRef] [Scilit]
  66. Quach, H.Q.; Ovsyannikova, I.G.; Poland, G.A.; Kennedy, R.B. Evaluating Immunogenicity of Pathogen-Derived T-Cell Epitopes to Design a Peptide-Based Smallpox Vaccine. Sci. Rep. 2022, 12, 15401. [Google Scholar] [CrossRef] [Scilit]
  67. Avanzato, V.A.; Bushmaker, T.; Oguntuyo, K.Y.; Yinda, C.K.; Duyvesteyn, H.M.E.; Stass, R.; Meade-White, K.; Rosenke, R.; Thomas, T.; van Doremalen, N.; et al. A Monoclonal Antibody Targeting the Nipah Virus Fusion Glycoprotein Apex Imparts Protection from Disease. J. Virol. 2024, 98, e0063824. [Google Scholar] [CrossRef] [Scilit]
  68. Loomis, R.J.; Stewart-Jones, G.B.E.; Tsybovsky, Y.; Caringal, R.T.; Morabito, K.M.; McLellan, J.S.; Chamberlain, A.L.; Nugent, S.T.; Hutchinson, G.B.; Kueltzo, L.A.; et al. Structure-Based Design of Nipah Virus Vaccines: A Generalizable Approach to Paramyxovirus Immunogen Development. Front. Immunol. 2020, 11, 842. [Google Scholar] [CrossRef] [Scilit]
  69. Zhang, L.; Wei, X.; Zhang, R.; Koci, M.; Si, D.; Ahmad, B.; Guo, H.; Hou, Y. C-Terminal Amination of a Cationic Anti-Inflammatory Peptide Improves Bioavailability and Inhibitory Activity Against LPS-Induced Inflammation. Front. Immunol. 2021, 11, 618312. [Google Scholar] [CrossRef] [Scilit]
  70. Di Pasquale, A.; Preiss, S.; Da Silva, F.T.; Garçon, N. Vaccine Adjuvants: From 1920 to 2015 and Beyond. Vaccines 2015, 3, 320–343. [Google Scholar] [CrossRef] [Scilit]
  71. Sami, S.A.; Marma, K.K.S.; Mahmud, S.; Khan, M.A.N.; Albogami, S.; El-Shehawi, A.M.; Rakib, A.; Chakraborty, A.; Mohiuddin, M.; Dhama, K.; et al. Designing of a Multi-Epitope Vaccine against the Structural Proteins of Marburg Virus Exploiting the Immunoinformatics Approach. ACS Omega 2021, 6, 32043–32071. [Google Scholar] [CrossRef] [Scilit]
  72. Azmi, F.; Fuaad, A.A.H.A.; Skwarczynski, M.; Toth, I. Recent Progress in Adjuvant Discovery for Peptide-Based Subunit Vaccines. Hum. Vaccines Immunother. 2014, 10, 778–796. [Google Scholar] [CrossRef] [Scilit]
  73. Lew, A.M.; Anders, R.F.; Edwards, S.J.; Langford, C.J. Comparison of Antibody Avidity and Titre Elicited by Peptide as a Protein Conjugate or as Expressed in Vaccinia. Immunology 1988, 65, 311–314. [Google Scholar]
  74. Geerligs, H.J.; Weijer, W.J.; Welling, G.W.; Welling-Wester, S. The Influence of Different Adjuvants on the Immune Response to a Synthetic Peptide Comprising Amino Acid Residues 9-21 of Herpes Simplex Virus Type 1 Glycoprotein D. J. Immunol. Methods 1989, 124, 95–102. [Google Scholar] [CrossRef] [Scilit]
  75. Wang, Y.; Sun, D.; Laney, V.; Wang, H.; Wang, L.L.; Lu, Z.R. Challenges and Opportunities on Achieving an Adequate Delivery Efficiency and Immunogenicity with Peptide-Based Anticancer Vaccines. Adv. Drug Deliv. Rev. 2025, 225, 115675. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Schematic diagram of the experimental workflow for the design and evaluation of NiV-F peptide vaccine candidates. The image was generated in Biorender.com with the right to publish.
Figure 1. Schematic diagram of the experimental workflow for the design and evaluation of NiV-F peptide vaccine candidates. The image was generated in Biorender.com with the right to publish.
Vaccines 14 00084 g001
Figure 2. In silico prediction of B- and T-cell epitopes in of NiV-F protein sequence. (a) Computational analyses using BepiPred at threshold 0.5 for B-cell epitopes. Residues above the threshold and high antigenicity are indicated in yellow color. (b) NiV-F amino acid residue scores from BepiPred. Predicted B-cell epitope groups with over >9 amino acid residues and overlapping MHC-binding affinity are highlighted with their designated group ID. (c) 9-mer peptides and their HLA Class I immunogenicity scores. Vertical dashed lines indicate separation between peptide groups. F2, NiV-F epitope group 2; F4, NiV-F epitope group 4; F5, NiV-F epitope group 5; F9, NiV-F epitope group 9; F11, NiV-F epitope group 11; F13, NiV-F epitope group 13; F16, NiV-F epitope group 16; F18, NiV-F epitope group 18; F19, NiV-F epitope group 19; F20, NiV-F epitope group 20; F21, NiV-F epitope group 21.
Figure 2. In silico prediction of B- and T-cell epitopes in of NiV-F protein sequence. (a) Computational analyses using BepiPred at threshold 0.5 for B-cell epitopes. Residues above the threshold and high antigenicity are indicated in yellow color. (b) NiV-F amino acid residue scores from BepiPred. Predicted B-cell epitope groups with over >9 amino acid residues and overlapping MHC-binding affinity are highlighted with their designated group ID. (c) 9-mer peptides and their HLA Class I immunogenicity scores. Vertical dashed lines indicate separation between peptide groups. F2, NiV-F epitope group 2; F4, NiV-F epitope group 4; F5, NiV-F epitope group 5; F9, NiV-F epitope group 9; F11, NiV-F epitope group 11; F13, NiV-F epitope group 13; F16, NiV-F epitope group 16; F18, NiV-F epitope group 18; F19, NiV-F epitope group 19; F20, NiV-F epitope group 20; F21, NiV-F epitope group 21.
Vaccines 14 00084 g002
Figure 3. Mapping and preliminary antigenicity evaluation of the shortlisted synthesized NiV-F peptides. Location of the NiV-F epitope-derived peptide candidates, (a) F11 and (b) F18, in a resolved in monomeric NiV-F protein from PDB (6TYS). The protein was visualized in Mol*3D viewer and adjusted. The specific location of the epitope is highlighted in color and in an inlet to show the simplified cartoon representation, whereas the specific residue and subgroupings for each peptide group are shown as a sequence diagram. Indirect ELISA results of the synthesized peptide group (c) F11 and (d) F18 using sera from recombinant NiV-F vaccinated mice. Data are from triplicate values and presented as mean absorbance at 450 nm (A450nm).
Figure 3. Mapping and preliminary antigenicity evaluation of the shortlisted synthesized NiV-F peptides. Location of the NiV-F epitope-derived peptide candidates, (a) F11 and (b) F18, in a resolved in monomeric NiV-F protein from PDB (6TYS). The protein was visualized in Mol*3D viewer and adjusted. The specific location of the epitope is highlighted in color and in an inlet to show the simplified cartoon representation, whereas the specific residue and subgroupings for each peptide group are shown as a sequence diagram. Indirect ELISA results of the synthesized peptide group (c) F11 and (d) F18 using sera from recombinant NiV-F vaccinated mice. Data are from triplicate values and presented as mean absorbance at 450 nm (A450nm).
Vaccines 14 00084 g003
Figure 4. Immunogenicity evaluation of NiV-F peptide vaccine candidates in mice. (a) Schedule of immunization regimen and sampling collection for the in vivo validation experiment in mice. Specific-pathogen-free (SPF) mice (n = 3) were immunized twice at two-week intervals, either intramuscularly (IM. with Alhydrogel ® adjuvant) or intravenously (IV). Sera were collected 2 weeks post-booster vaccination and were evaluated for humoral response by ELISA. Image was created in Biorender with license. (b) Antibody binding against their homologous peptide antigen. (c) Antibody binding against recombinant NiV-F protein. Data are presented as mean absorbance value at 450 nm (A450nm) ± SD. Statistical significance on all groups was determined using Kruskal–Wallis test followed by Dunn’s multiple comparison test. ***, p < 0.001 against positive control (PC); **, p < 0.01 against positive control (PC). NC, negative control.
Figure 4. Immunogenicity evaluation of NiV-F peptide vaccine candidates in mice. (a) Schedule of immunization regimen and sampling collection for the in vivo validation experiment in mice. Specific-pathogen-free (SPF) mice (n = 3) were immunized twice at two-week intervals, either intramuscularly (IM. with Alhydrogel ® adjuvant) or intravenously (IV). Sera were collected 2 weeks post-booster vaccination and were evaluated for humoral response by ELISA. Image was created in Biorender with license. (b) Antibody binding against their homologous peptide antigen. (c) Antibody binding against recombinant NiV-F protein. Data are presented as mean absorbance value at 450 nm (A450nm) ± SD. Statistical significance on all groups was determined using Kruskal–Wallis test followed by Dunn’s multiple comparison test. ***, p < 0.001 against positive control (PC); **, p < 0.01 against positive control (PC). NC, negative control.
Vaccines 14 00084 g004aVaccines 14 00084 g004b
Figure 5. Location of the NiV-F epitope-derived F11-3 and F11-4 peptide vaccine in the trimeric NiV-F resolved protein structure. The protein structure was retrieved in PDB (6TYS), and the protein is visualized in their molecular surface representation using Mol*3D. Highlighted in blue is the specific location of F11-3, whereas yellow is for F11-4. The inlet box shows a representation of a monomeric structure of NiV-F.
Figure 5. Location of the NiV-F epitope-derived F11-3 and F11-4 peptide vaccine in the trimeric NiV-F resolved protein structure. The protein structure was retrieved in PDB (6TYS), and the protein is visualized in their molecular surface representation using Mol*3D. Highlighted in blue is the specific location of F11-3, whereas yellow is for F11-4. The inlet box shows a representation of a monomeric structure of NiV-F.
Vaccines 14 00084 g005
Table 1. List of Nipah virus fusion (NiV-F) glycoprotein-derived peptide sequences chemically synthesized for experimental validation.
Table 1. List of Nipah virus fusion (NiV-F) glycoprotein-derived peptide sequences chemically synthesized for experimental validation.
Epitope GroupPeptide IDSequenceModificationAmino Acid PositionPeptide Length (aa)
F11F11-1VSNSMTIQAISQAFGGNYETLLRTLGYATE 222–25130
F11-2DFDDLLESDSITGQIIYVDLSGYYIIVRVY 252–28130
F11-3LSDLLFVFGPNLQDPVSNSMTIQAISQAFG 207–23630
F11-3-C5FVFGPNLQDPVSNSMTIQAI 212–23120
F11-3-C10FVFGPNLQDPVSNSM 212–22615
F11-4GNYETLLRTLGYATEDFDDLLESDSITGQ 237–26529
F11-4-N5LLRTLGYATEDFDDLLESDS 242–26120
F11-4-N10GYATEDFDDLLESDS 247–26115
F11-4-NH2ETLLRTLGYATEDFDDLLESDSI-NH2Amidation240–26123
F11-4-9mer-1GYATEDFDD 247–2559
F11-4-9mer-1-NH2GYATEDFDD-NH2Amidation247–2559
F11-4-9mer-2YATEDFDDL 248–2569
F11-4-9mer-3LGYATEDFD 246–2549
F11-5IIYVDLSGYYIIVRVY FPILTEIQQAYIQE 266–29530
F18F18-1GKYLGSVNYNSEGIAIGPPVFTDKV 430–45425
F18-1-NH2LGSVNYNSEGIAIG-NH2Amidation433–44614
F18-1-9merYNSEGIAIG 438–4469
F18-1-9mer-NH2YNSEGIAIG-NH2Amidation438–4469
G17-NH2NTVISRPGQSQCPRFNKC-NH2Amidation482–49918
Table 2. Experimental groups and vaccination strategies for in vivo validation of Nipah virus fusion glycoprotein (NiV-F) peptide vaccine candidates.
Table 2. Experimental groups and vaccination strategies for in vivo validation of Nipah virus fusion glycoprotein (NiV-F) peptide vaccine candidates.
GroupPeptide VaccineRouteDoseAdjuvant *Sample Size (n)
F11-3F11-3 peptideIV100 µg/dose 3
F11-3 peptideIM400 µg/doseAlhydrogel®3
F11-4F11-4 peptideIV100 µg/dose 3
F11-4 peptideIM400 µg/doseAlhydrogel®3
PCNiV-F recombinant protein 1IM25 µg/doseAlhydrogel®3
NCPBSIM 3
IM, intramuscular; IV, intravenous; NC, negative control; PBS, phosphate-buffered saline; PC, positive control; * Alhydrogel® adjuvant 2% (Invivogen, San Diego, CA, USA); 1 Nipah virus glycoprotein F (Human Fc-Tag; REC31633; The Native Antigen, Oxford, UK).
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Moon, S.Y.; Flores, R.A.; Choi, E.B.; Kim, S.; Je, H.; Jang, E.Y.; Lim, H.; Lee, Y.-K.; Ouh, I.-O.; Kim, W.H. Exploratory Evaluation of Peptide-Based Immunization Targeting Fusion Glycoprotein-Derived Epitopes of Nipah Virus in Murine Model. Vaccines 2026, 14, 84. https://doi.org/10.3390/vaccines14010084

AMA Style

Moon SY, Flores RA, Choi EB, Kim S, Je H, Jang EY, Lim H, Lee Y-K, Ouh I-O, Kim WH. Exploratory Evaluation of Peptide-Based Immunization Targeting Fusion Glycoprotein-Derived Epitopes of Nipah Virus in Murine Model. Vaccines. 2026; 14(1):84. https://doi.org/10.3390/vaccines14010084

Chicago/Turabian Style

Moon, Seo Young, Rochelle A. Flores, Eun Bee Choi, Seungyeon Kim, Hyunjin Je, Eun Young Jang, Heeji Lim, Yoo-Kyoung Lee, In-Ohk Ouh, and Woo H. Kim. 2026. "Exploratory Evaluation of Peptide-Based Immunization Targeting Fusion Glycoprotein-Derived Epitopes of Nipah Virus in Murine Model" Vaccines 14, no. 1: 84. https://doi.org/10.3390/vaccines14010084

APA Style

Moon, S. Y., Flores, R. A., Choi, E. B., Kim, S., Je, H., Jang, E. Y., Lim, H., Lee, Y.-K., Ouh, I.-O., & Kim, W. H. (2026). Exploratory Evaluation of Peptide-Based Immunization Targeting Fusion Glycoprotein-Derived Epitopes of Nipah Virus in Murine Model. Vaccines, 14(1), 84. https://doi.org/10.3390/vaccines14010084

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop