Next Article in Journal
Immunogenicity and Reactogenicity of mRNA BNT162b2 COVID-19 Vaccine among Thai Adolescents with Chronic Diseases
Next Article in Special Issue
Designing a Multi-Epitope Vaccine against Toxoplasma gondii: An Immunoinformatics Approach
Previous Article in Journal
Pulmonary Embolism after Moderna Vaccination in Kidney Transplant Patients: Two Case Reports and Literature Review
Previous Article in Special Issue
Designing of a Novel Multi-Antigenic Epitope-Based Vaccine against E. hormaechei: An Intergraded Reverse Vaccinology and Immunoinformatics Approach
 
 
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Execution and Design of an Anti HPIV-1 Vaccine with Multiple Epitopes Triggering Innate and Adaptive Immune Responses: An Immunoinformatic Approach

1
Department of Biotechnology, Faculty of Life Sciences, University of Central Punjab, Lahore 54000, Pakistan
2
Department of Medical Education, King Edward Medical University, Lahore 54000, Pakistan
3
Molecular Diagnostic Laboratory, Johns Hopkins Aramco Healthcare, Dhahran 31311, Saudi Arabia
4
College of Medicine, Alfaisal University, Riyadh 11533, Saudi Arabia
5
Department of Public Health and Nutrition, The University of Haripur, Haripur 22610, Pakistan
6
Department of Community Medicine and Health Care for Pilgrims, Faculty of Medicine, Umm Al-Qura University, Makkah 21955, Saudi Arabia
7
Department of Medical Microbiology, Faculty of Medicine, Al Baha University, Al Baha 4781, Saudi Arabia
8
Research Center, Almoosa Specialist Hospital, Al-Ahsa 36342, Saudi Arabia
9
College of Nursing, Princess Norah Bint Abdulrahman University, Riyadh 11564, Saudi Arabia
10
School of Nursing, Wollongong University, Wollongong, NSW 2522, Australia
11
Administration of Pharmaceutical Care, Al-Ahsa Health Cluster, Ministry of Health, Al-Ahsa 31982, Saudi Arabia
12
Division of Allergy and Immunology, College of Medicine, King Faisal University, Al-Ahsa 31982, Saudi Arabia
13
Department of Clinical Laboratory Sciences, Mohammed AlMana College of Health Sciences, Dammam 34222, Saudi Arabia
14
Department of Medical Microbiology and Parasitology, School of Medical Sciences, Universiti Sains Malaysia, Kubang Kerian, Kota Bharu 16150, Malaysia
*
Authors to whom correspondence should be addressed.
Vaccines 2022, 10(6), 869; https://doi.org/10.3390/vaccines10060869
Received: 24 March 2022 / Revised: 20 May 2022 / Accepted: 26 May 2022 / Published: 29 May 2022
(This article belongs to the Special Issue Computer and Technology Supported Development of Vaccines)

Abstract

:
Human Parainfluenza Virus (HPIV) Type-1, which is an anti-sense ribonucleic acid (RNA) virus belonging to the paramyxoviridae family, induces upper and lower respiratory tract infections. The infections caused by the HPIV Type-1 virus are usually confined to northwestern regions of America. HPIV-1 causes infections through the virulence of the hemagglutinin-neuraminidase (HN) protein, which plays a key role in the attachment of the viral particle with the host’s receptor cells. To the best of our knowledge, there is no effective antiviral drugs or vaccines being developed to combat the infection caused by HPIV-1. In the current study, a multiple epitope-based vaccine was designed against HPIV-1 by taking the viral HN protein as a probable vaccine candidate. The multiple epitopes were selected in accordance with their allergenicity, antigenicity and toxicity scoring. The determined epitopes of the HN protein were connected simultaneously using specific conjugates along with an adjuvant to construct the subunit vaccine, with an antigenicity score of 0.6406. The constructed vaccine model was docked with various Toll-like Receptors (TLRs) and was computationally cloned in a pET28a (+) vector to analyze the expression of vaccine sequence in the biological system. Immune stimulations carried out by the C-ImmSim Server showed an excellent result of the body’s defense system against the constructed vaccine model. The AllerTop tool predicted that the construct was non-allergen with and without the adjuvant sequence, and the VaxiJen 2.0 with 0.4 threshold predicted that the construct was antigenic, while the Toxinpred predicted that the construct was non-toxic. Protparam results showed that the selected protein was stable with 36.48 instability index (II) scores. The Grand average of Hydropathicity or GRAVY score indicated that the constructed protein was hydrophilic in nature. Aliphatic index values (93.53) confirmed that the construct was thermostable. This integrated computational approach shows that the constructed vaccine model has a potential to combat laryngotracheobronchitis infections caused by HPIV-I.

1. Introduction

HPIVs are non-segmented and enclosed viruses, having anti-sense RNA that infect the respiratory tract, especially its ciliated epithelial cells [1], of any person of any age [2,3,4,5]. As reported, the HPIV genome contains more than 15,000 nucleotides which encode six different structural proteins [6]. HPIVs are the most common pathogens that cause seasonal respiratory tract infections; the first three types mostly affect infants, young children, and immuno-compromised persons causing lower respiratory tract infections (LRTIs) with conditions such as bronchiolitis, mild cold to croup, and viral pneumonia [4,7,8].
In the United States of America (USA), HPIV-1 is proved to be the most common reason for laryngotracheobronchitis or simply known as croup, which is the reason for the hospitalization of more than 30,000 victims every year in the USA [9,10,11]. In Pakistan, however, incidents of HPIV have not been evaluated since 1985, whereby HPIV-1 and HPIV-3 were recorded as the most pathogenic [12]. Although HPIV outbreaks are widely studied in Western nations, they remain underexplored and are not included in the usual laboratory confirmation in many Asian countries. Adding to it, there is no effective vaccine available to prevent the infection. However, by using a multi-disciplinary approach, a study reported on suramin, a drug that inhibits the hemagglutinin-neuraminidase of HPIV by non-competitive interaction and slows down replication of the virus in mammalian host cells [9].
To overcome or more specifically reduce any kind of allergic reactions, researchers are adapting to peptide-based vaccine designed by the use of recent advancements in computational biology [13,14]. Vaccines based on T and B cell-specific epitopes are designed to activate the immune system of the person to protect its body against possible viral attacks in the future; for designing such vaccines, immunoinformatic contributes crucially in data analysis and management using computer-aided research strategies with high-confidence predictions [15,16,17].
The establishment of epitope-based vaccines involves the attachment of predicted epitopes and adjuvant through linkers. In epitope-based vaccines, the antigenic effect is limited as compared to live attenuated vaccines. In case of a purified epitope vaccine, the adjuvant is an essential component that can enhance the magnitude of antigenicity of antigens (epitopes) in adaptive immune responses. This magnification of antigens by an adjuvant can enhance antibody production and affects the longevity of the vaccine through the co-administration of epitopes. A limited number of reported adjuvants are available that are incorporated into human vaccines [18]. Here, a widely acclaimed immunoinformatic approach was pertained to constructing a vaccine against HPIV-1 targeting the host’s immune cells using available molecular data about the virus.
To the best of our knowledge, there is no vaccine of HPIV-1 using HN protein that has been reported yet. Epitope-based vaccines hold promise over other types because of their ability to induce a substantial immune response in a lower concentration. The current study was designed to identify the highly antigenic peptides having a tendency to induce the immune cells (B cells; Th and TC cells) and interferons. The construct was screened for antigenicity, allergenicity, and physicochemical properties along with protein–protein docking with TLR receptors. Immune simulations were performed to predict vaccine efficiency.

2. Materials and Methods

2.1. Viral Proteins’ Sequence Retrieval

The FASTA format sequences of fusion glycoprotein (F), membrane (M) protein, hemagglutinin-neuraminidase (HN) protein, nucleocapsid (N) protein, and nucleoprotein of several HPIV-1 strains were fetched from the UniPort database (https://www.uniprot.org/ (accessed on 25 July 2021)) having UniProt IDs P12605, Q01427, P16071, J7FXM0, and P26590, respectively. VaxiJen score of five selected proteins along with their UniProt IDs has been mentioned in the Supplementary Table S1. While the flow chart of methodology has been shown in Supplementary Figure S1.

2.2. Antigenic Protein Identification

The retrieved proteins were screened for vaccine candidacy on the VaxiJen v2.0 server to evaluate their antigenicity values [19]; the server is reachable at http://www.ddg-pharmfac.net/vaxijen/ (accessed on 25 July 2021).

2.3. Physicochemical Analysis

The physicochemical characteristics of the selected protein were computed via ProtParam, which is available at the ExPasy server [20]. The parameters calculated by ProtParam (https://web.expasy.org/protparam/ (accessed on 25 July 2021) include but are not limited to atomic composition, amino acid composition, instability and aliphatic index, extinction coefficient, Grand average of Hydropathicity (GRAVY), and theoretical PI.

2.4. Two-Dimensional (2D) and 3D Structural Analysis

Secondary structure analyses of the protein were rendered by PSIPRED [21], while I-TASSER [22] provided the 3D model of the protein according to the highest C-Score value.

2.5. B-Cell-Specific Epitopes Identification via IEDB Tools

The B-cell Antigen Sequence Properties tool of IEDB [23] (http://tools.iedb.org/bcell/ (accessed on 26 July 2021) calculated the linear epitopes confined to B cells. The Bepipred Linear Epitope Prediction 2.0 method of prediction was selected with a threshold of 0.500 and 4 center positions; this method predicts B-cell epitopes from a protein sequence, using a Random Forest algorithm trained on epitopes and non-epitope amino acids. It determines the results from crystal structures, which follows by the sequential prediction later.

2.6. Predicting T-Cells Restricted Epitopes

Tools of the IEDB T-cell database were utilized to analyze the epitopes restricted by both types, type I (http://tools.iedb.org/mhci/ (accessed on 26 July 2021) and II (http://tools.iedb.org/mhcii/ (accessed on 26 July 2021) of the major histocompatibility complex [24].

2.7. Selected Epitopes’ Population Coverage

To check which epitopes cover the maximum world population, we used the population coverage analysis integrated in the IEDB server [25], which is provided at http://tools.iedb.org/population/ (accessed on 27 July 2021). In this tool, interaction of the selective alleles of the major histocompatibility complex with the selected epitopes was examined, screening the ones that cover the maximum population (most number of alleles).

2.8. Profiling of Predicted Epitopes

The finalization of the suitable epitopes was completed by further filtration of predicted epitopes. To this end, Toxinpred analysis (https://webs.iiitd.edu.in/raghava/toxinpred/algo.php (accessed on 27 July 2021) [26]), VaxiJen v2.0 [27], and AllerTOP [28], available at https://www.ddg-pharmfac.net/AllerTOP/method.html (accessed on 27 July 2021), were employed for toxicity, antigenicity, and allergenicity profiling sequentially.

2.9. Vaccine Design and Profiling

A vaccine construct consists of four main components namely, an adjuvant, linkers, B and T cell epitopes, and 6X histidine molecules. All epitopes with the target were linked using specific linkers along with adjuvant Human Beta Defensin 3 with UniProt ID: Q5U7J2 [29]. Antigenic and allergenic profiling of the construct was executed by the implementation of Allertop and Vaxijen (version 2.0 for both), while ExPasy ProtParam examined the physicochemical attributes of the assembled vaccine.

2.10. Disulfide Engineering of Vaccine

The Disulfide tool on Design 2.0 (DbD2) was employed to perform the Disulfide concoction of the constructed vaccine [30]; this tool helped in designing novel disulfide bonds in the constructed vaccine.

2.11. Three-Dimensional (3D) Structural Analysis

RaptorX was employed to investigate the tertiary structure of the fabricated vaccine [31] (http://raptorx.uchicago.edu/ (accessed on 28 July 2021). ProSA-web, introduced by [32], provided at https://prosa.services.came.sbg.ac.at/prosa.php (accessed on 28 July 2021), and Ramachandran plot assessment was executed via PROCHECK v6.0 [33] (https://saves.mbi.ucla.edu/ (accessed on 28 July 2021), for the validation and stability confirmation of the constructed vaccine model. GalaxyRefine [34] available at (http://galaxy.seoklab.org/cgi-bin/submit.cgi?type=REFINE (accessed on 28 July 2021) refined the 3D vaccine model.

2.12. Molecular Docking and Dynamics

Molecular docking was performed by online docking servers, i.e., ClusPro (https://cluspro.bu.edu/login.php?redir=/home.php (accessed on 29 July 2021) [35] and PatchDock [36] (https://bioinfo3d.cs.tau.ac.il/PatchDock/php.php (accessed on 29 July 2021). The refined vaccine model and different Toll-like receptors (TLR2 with PDB ID: 6nig, TLR3 with PDB ID: 2a0z, TLR4 with 4g8a, TLR5 with PDB ID: 3j0a, and TLR8 with 4r0A) were docked using both online servers. TLRs are the main human body receptors recognizing and binding to various epitopes to generate an immune response against them. The vaccine was docked against these receptors to evaluate whether it fits in the binding pocket and interacts enough to elicit a response. Molecular dynamic simulations of the docked complexes were performed using the iMODS server [37].

2.13. Codon Improvement and Cloning

The Java Codon Adaptation Tool was applied to perfect the codons of refined vaccine construct for enhanced expression [38] (https://www.jcat.de/ (accessed on 31 July 2021), and in silico cloning was performed after optimization through the SnapGene software introduced by Insightful Science (snapgene.com (accessed on 31 July 2021)).

2.14. Immune Simulation

The C-IMMSIM server produced immune simulations (https://kraken.iac.rm.cnr.it/C-IMMSIM/ (accessed on 31 July 2021) [39], as it estimates the immunological response to the proposed immunization construct.

3. Results

3.1. Antigenicity, Structural and Physicochemical Analysis of Viral HN Protein

The antigenicity scores-based analysis of all the candidate proteins showed that the HN protein was a viable candidate for vaccine construction, and the physicochemical parameters of selected protein are given in Table 1. The HN protein contains 575 amino acids weighing 63,981.34 Da. Protparam results revealed that the selected protein is stable with instability index (II) scores of 36.48. The tertiary structure of the HN protein is shown in Figure 1A. It contains 10.78% α helixes, 30.26% β sheets, and 58.96% loops (Figure 1C). The residues from 42 to 60 were found to be inside the transmembrane region, and residues from 1 to 41 were found to be in the cytoplasmic region, and the core-region of the HN protein is extracellular (Figure 1B,D). Ramachandran plot predicted by the PROCHECK using the refined model of vaccine has been shown in Supplementary Figure S2. While the Graphical representation of Z-score calculation of Peptide compared with the native protein energies has been shown in Supplementary Figure S3.

3.2. B-Cell-Restricted Epitope Predictions

Residues of the HN protein having scores above the threshold of 0.500 of the tools (IEDB’s Bepipred Linear Epitope Prediction 2.0 method) were predicted to be a member of an epitope. The tool predicted a total number of 19 B-cell epitopes, but for further analysis, only the epitopes with the length of 9–50 amino acids were picked. B-cell-restricted epitope predictions of HN protein objectively allowed the finding of potential antigens that would interact efficiently with B-lymphocytes. B-cell-restricted epitopes of HN protein will generate rich immune responses against viral infection upon recognition by the surface receptors of B-lymphocytes. The stimulation by these epitopes will trigger the differentiation of B-cells to plasma cells, generating the antibodies able to recognize the epitopes of the viral HN protein. The Supplementary Table S2 shows the B-Cell epitopes predicted by the IEDB server along with the length of each epitope.

3.3. Predicting T-Cells Restricted Epitopes

More than 30,000 possible MHC-I binding epitopes were predicted; out of these, the top 50 epitopes, based on the IC50 value, were filtered and analyzed for the vaccine construct. Similarly, epitopes from the viral core peptides binding to MHC-II molecules were selected and analyzed. The prediction of epitopes restricted to MHC-I and MHC-II using the viral HN protein is crucial, as the MHCs (more specifically HLAs in humans) are the coordinators between innate and adaptive immune defense, which help in response transition. Both classes, MHC-I and MHC-II, are restricted to CD8+ cytotoxic T-lymphocytes (CTLs) and CD4+ helper T-lymphocytes, respectively, and both play a vital role in viral infections. The antigen-presenting cells (APCs) from the innate immune response deliver the viral epitopes to MHC molecules, which activate the adaptive immune response, i.e., activation of B-cells and production of antibodies. T-cell-restricted epitopes of HN protein will just stimulate the MHC molecules available at T-cells and create immunity against HPIV-1 viral infection. Reference set alleles for MHC-1 and MHC-II molecules has been shown in Supplementary Table S3.

3.4. Filtration of Predicted Epitopes

Out of 19, only three epitopes of the B-cell were picked to become part of the final vaccine construct; similarly, 16 epitopes restricted by MHC-I and 15 epitopes for MHC-II passed the filtration tests and were selected for the construct. All epitopes that passed the filters are given in Table 2 and Table 3.

3.5. Population-Coverage Analysis

A cumulative coverage of the selected epitopes illustrated 98.55% and 72.18% against MHC-I and II molecules sequentially, advocating the efficiency of the construct. The individual epitope coverage for each MHC class is depicted in Figure 2. Coverage of some alleles was not available for computation, and therefore, they were omitted from the analysis.

3.6. Assembly of a Multi-Epitope Vaccine

The assembly started by joining all the B-cell epitopes to the adjuvant sequence using EAAAK linkers, which were then connected to the MHC-I epitopes, using the GPGPG linkers. Furthermore, MHC-II was linked to the chain via AYY linkers. The 6xHis tag was utilized at the carbon and the amino-terminus of the sequence for protein identification and purification during the cloning process. The construct is provided in Figure 3.

3.7. Quality Check Analysis and Profiling of Designed Vaccine

AllerTop predicted the construct is non-allergen with and without the adjuvant sequence, and the VaxiJen 2.0 predicted that the construct is antigenic with 0.6406 and 0.6510 scores, respectively, with and without the adjuvant. According to Toxinpred predictions, the construct was evaluated to be non-toxic in nature.

3.8. Physicochemical Properties

The construct composed of 641 amino acids having 69661.70 Da of molecular weight, and the molecular formula exhibited the exact number of atoms present in the vaccine peptide, while the other physicochemical properties are shown in Table 1. Protparam results showed that the constructed protein was highly stable with a 33.32 instability index score, indicating that it can initiate a viable immune response with adequate dosage. A theoretical pI of 9.04 suggested a good structural fold of the vaccine helping with the vaccine purification methods. According to the Grand average of Hydropathicity scores, the constructed protein is hydrophilic, allowing it to interact with water residues in the host cells promoting its immunogenicity. The high aliphatic index (93.53) proves the thermostability of the vaccine, indicating that it can tolerate sudden temperature changes effectively. The short half-life of the construct (3.5 h), evidenced in vitro, depicts that the antigen remains in the host for a short span that is enough to induce the host’s immune response but not long enough to be pathogenic.

3.9. Prediction of Secondary and Tertiary Structure

Raptor X demonstrated that the protein has 34% helices, 4% beta sheets, and 61% coils. More than half (59%) of the protein residues were categorized as exposed (E), 19% were found to be medium exposed (M), and 20% of the residues were considered buried (B). There was a total of 50 residues, constituting 7% of total protein content, that were found to be disordered. The three-dimensional vaccine construct with the Highest CNS-solve program score was further processed for refinement and validation analysis.

3.10. Tertiary Structure Refinement and Validation

The GalaxyRefine server considered different parameters in the refinement process. It was noted from the Ramachandran plot that 90.5% residue of the refined protein was in the highly acceptable region, 8.3% residues were found in the moderately allowed region, 0.8% were present in the scarcely allowed sector of the plot, and 0.4% residues were in the outlier or unfavorable region. The predicted z-score was −5.06, validating the refined 3D structure. Scores of different parameters used by GalaxyRefine for the refinement of 3-D model has been shown in Supplementary Table S4.

3.11. Vaccine Stability by Disulfide Engineering

The disulfide engineering was completed using a DbD2 server between the 12 selected residue pairs, selected on the basis of energy level between them. The mutated structure with possible predicted disulfide bonds in yellow color is given in Supplementary Figure S6b, whereas Supplementary Figure S6a showed the original structure (wireframe structure). The list of 12 selected residue pairs for disulfide engineering has been shown in Supplementary Table S5.

3.12. Molecular Docking of Designed Vaccine with Ligand Binding TLRs

Figure 4A–E represent the docked structures of the vaccine construct and the chosen TLRs. Out of the 30 models depicted for all the complexes, the TLR2 + vaccine model with −1403.6 kCal/mole binding energy (Figure 4A), TLR3 + vaccine model with −1237.9 kCal/mole energy (Figure 4B), TLR4 + vaccine model with −1258.0 kCal/mole energy (Figure 4C), TLR5 + vaccine model with −1832.9 kCal/mole energy (Figure 4D), and TLR8 + vaccine model with −1475.6 kCal/mole energy (Figure 4E) were selected. The selection of models was made based on the lowest binding energy (highest negative energy), as it is indicative of excellent binding affinity, since greater negative energy stabilizes the reaction toward the product (in our case, the vaccine and the TLR complex). These calculations suggested that the vaccine construct has the strongest interaction with TLR5, allowing this receptor to take part in immune response initiation most influentially; however, the other receptors also generate a suitable immune response. The maximum ClusPro energies, cluster members and patchdock of all the TLRs used for Molecular docking has been shown in Supplementary Table S6.

3.13. Molecular Dynamic Simulations

MD simulations results were almost immediately available for the provided complex (TLR2; Vaccine). The models revealed little contortion at each residue’s capacity level. The NMA-calculated B-factor scores were the same as the RMS values. An elasticated network model, shown in Figure 5, was developed to detect the pairings of atoms linked with springs. Every dot in the figure represented a spring in between respective atomic pairs and was shaded based on its rigidity. The springs became firmer as the grays became darker. The goal of ENM (depicted in Figure 5) is to linearize the complex motions of a macromolecule (in our case, the vaccine: TLR complex). It helps understanding the atomic motions of the complex. As discussed above, the darker-gray dots represent stiff atoms corresponding to limited motion and reflecting the fact that the conformation of the complex is stable. The 3-D model, B-factor/Mobility, Eigenvalues, Variance, Covariance map, and Elastic network of TLR-2, TLR-3, TLR-4, TLR-5 and TLR-8 Complex has been shown in Supplementary Figures S4, S5, S7, S8 and S9 respectively.

3.14. Adaptation and Enhancement of Codon along with In-Silico Cloning

The refined codon series was 1923 nucleotides in length, with a CAI of 0.97 and a GC content of 53.25% (Figure 6). The improved nucleotide sequence was integrated into the pET28a (+) plasmid after being replicated in silico by employing SnapGene software to generate a recombinant plasmid (Figure 7).

3.15. Immune Simulations

The vaccine was simulated with three doses with a gap of 4 weeks and 1050 Simulation Steps were adjusted; these settings gave the elapsed time of 349 days. The result showed an increase in B-cells along with a rise in IgM and IgG antibodies, as shown in Figure 8A,B. The primary and secondary response also represented the rise in T-cell (TH, TR, TC) population within 50 days and an increase in the NK cell population (Figure 9A,B). Figure 10 shows peaks representing the production of different immune molecules such as IFN-g, IL4, IL-12, IFN-a, IL-2, etc. The production pattern of NK cells has been shown in Supplementary Figure S10.

4. Discussion

The innovation in computational biology helps the researchers search for new drugs and vaccines [39]. The primary objective of current study was to construct libraries of all the possible epitopes of B-cell and MHC class I and II of T-cells with the most interacting human leukocyte using the IEDB server (with reference HLA alleles) and to filter those epitopes by the fixed criteria to select the best possible residue to become part of the vaccine construct. Then, the selected epitopes were joined together via linkers (EAAAK, GPGPG, AYY). In the next step, the construct was checked for allergenicity using AllerTop and for antigenicity using VaxiJen.
Designing novel vaccines is much needed to immunize human beings against such seasonal epidemic diseases [40,41]. Improvement in bioinformatics tools, rapid advancement in biotechnology, and a vast understanding of immunology helped researchers to develop new methods to design vaccines [42]. Bioinformatics tools, databases, and programs can predict epitope peptides, which can act as ligands to initiate immune responses [43]. The identification of potential epitopes (peptides of pathogen) for B-cells and T-cells using an immunoinformatic approach can lead to designing a peptide-based vaccine to induce immunity against a specific pathogen with higher efficacy and fewer side effects. Bioinformatics tools and databases can predict epitope-based peptides, which can act as ligands to initiate the immune response [44]. Epitope-based vaccines against Fowlpox Virus [45], Hepatitis B Virus [46], Nipah Henipavirus [47], and novel SARS-CoV-2 had been reported using the Immunoinformatics approach [42].
Several reports and a few clinical trials suggested the spike protein of any virus [17,48], such as the HN protein of HPIV-1, can be used for epitope vaccine designing [49]. Some studies targeted the sequences of more than one viral protein together to predict the B-cell and T-cell epitopes [29,42]; on the other hand, some researchers target a single protein to design the in silico vaccines [50,51]. The reported therapeutics targeting the glycoproteins of HPIV-1 envelope is the use of suramin, a non-competitive inhibitor of HN protein [52], and the utilization of monoclonal antibodies to neutralize the hemagglutinin-neuraminidase [53]; both strategies involve the inhibition of fusion protein activity by deactivating and neutralizing the HN protein. This study focuses on the same protein; the secondary structure and physicochemical analysis of the targeted protein show it to be highly antigenic, making it a great candidate for multi-epitope vaccine designing.
MHC-I and MHC-II are involved in an adaptive immune response where these peptides present the antigen to CD4+ (cytotoxic T-cells) and CD8+ (helper T-cells), respectively [54]. Meanwhile, the B-cell epitopes are recognized by the B-lymphocytes (via B-cell receptors) [55]. So, the current study utilizes the combination of MHC-I and MHC-II T-cell restricted epitopes and B-cell cell restricted epitopes of the HN protein for the development of strong immunity.
The selected epitopes in this study were combined together via linkers (i.e., EAAAK, GPGPG, AYY) as discussed in a previous study by Naveed, Tehreem, Arshad, Bukhari, Shabbir, Essa, Ali, Zaib, Khan, Al-Harrasi and Khan [48]; the construct also contains an adjuvant with the purpose to increase the immunoreactive property of the vaccine as put forward by Tahir Ul Qamar et al. [56]. Several studies have reported different adjuvants in epitope vaccine designs including the 50S ribosomal protein L7/L12 with UniProt ID: P9WHE3 [48], HABA Protein with accession number: AGV15514.1, and Human Beta Defensin 1, 2, 3 [57]. The vaccine construct in the current study includes Human Beta Defensin 3 with UniProt ID: Q5U7J2, because other adjuvants such as 50S ribosomal protein L7/L12 and HABA Protein reduced the antigenicity score (0.5984 and 0.5668, respectively) and increased the construct size from the ideal length.
The vaccine 3D structure predicted, refined and validated so we can perform docking with TLRs, because TLRs play an important role in the initiation of innate immune response [58]. TLRs are essential receptor proteins that recognize pathogens through Pathogen-Associated Molecular Patterns (PAMPs) and activate immune response by interacting with pathogens’ nucleic acid and envelope proteins [58]. Hence, this study focused on the interaction between the vaccine construct and five different TLRs (TLR 2, TLR 3, TLR 4, TLR5, and TLR 8). According to Gibney et al. [59], various interactions, i.e., electrostatic, Van der Waals, hydrophobic and hydrophilic, describe the stable configuration of complexes in docked clusters, which were mirrored here. The B-factor/mobility, variance, covariance analysis, and elastic network of the complexes supported the fact that the vaccine construct tends to initiate the humoral immune response as reported by Ali et al. [60].
Study limitations: The current study was performed in silico, and no wet lab experiments were carried out to empower the reported outcomes. Although excellent results were observed in the B-cell and T-cell epitope analysis, problems such as the non-availability of most HLAs in the IEDB, the 9–14 AA-specific immune response that may lead to variable results when tested in vivo and in vitro due to length restriction, the poorly defined motifs in the epitopes, and the TLR–vaccine complex could not be addressed in the study. It is therefore recommended for future researchers to find alternative for these limitations, especially providing wet-lab evidence wherever possible.

5. Conclusions

HPIV-1 is not catered by any of the existing preventive measures, leading to limits regarding the consistent increase in its incidences. The current study construct provides a clinical breakthrough in response against HPIV infections with hope to limit its spread and pathogenesis by designing an epitope-based vaccine using the HN protein as an immunogenic target by an immunoinformatic approach. The protein–protein interaction showed that the construct has the potential to be recognized by the immune cell receptors. The cloning of a construct in the PET28a (+) plasmid using snapgene showed that the expression level of the vaccine peptide was excellent. Immune simulations illustrated that this construct can generate a good immune response by the significant production of T-cells, B-cells, and other immune molecules. This integrated computational approach saves time, is cost effective, and guides experiments with less chance of errors and with fewer trials. However, the efficacy of any drug or vaccine can be ensured via experimental validations (both in vitro and in vivo). At clinical trials levels, the other peptide vaccines had shown good results with much better immune response, so the current vaccine construct could be considered a good candidate against Human Parainfluenza Virus Type-1.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/vaccines10060869/s1, Figure S1: Flow Chart of Methodology; Figure S2: Ramachandran plot predicted by the PROCHECK using the refined model of vaccine, the score is above 90, showing that the 3D model is valid; Figure S3: Graphical representation of Z-score calculation of peptide compared with the native protein energies, the negative 5.06 z-score is another proof of the validation of 3D model of the vaccine construct; Figure S4: Above diagrams shows 3D model, B-factor/mobility, eigenvalues, variance, covariance map, and elastic network of TLR-2 complex, respectively from left to right; Figure S5: Above diagrams show 3D model, B-factor/mobility, eigenvalues, variance, covariance map, and elastic network of TLR-3 complex, respectively, from left to right; Figure S6: Wireframe structure of real and mutated model. 6(a) original structure of model 6(b) Mutated model showing the disulfide bonds (yellow) between the selected pairs of residues; Figure S7: Above diagrams shows 3D model, B-factor/mobility, eigenvalues, variance, covariance map, and elastic network of TLR-4 complex, respectively, from left to right; Figure S8: Above diagrams show 3D model, B-factor/mobility, eigenvalues, variance, covariance map, and elastic network of TLR-5 complex, respectively, from left to right; Figure S9: Above diagrams shows 3D model, B-factor/mobility, eigenvalues, variance, covariance map, and elastic network of TLR-8 complex, respectively from left to right; Figure S10: Graph showing Natural Killer (NK) cells production pattern; Table S1: VaxiJen score of five selected proteins along with their UniProt IDs; Table S2: All the B-Cell epitopes predicted by the IEDB server along with the length of each epitope; Table S3: Reference set alleles for MHC-1 and MHC-II molecules; Table S4: Scores of different parameters used by GalaxyRefine for the refinement of 3D model; Table S5: List of 12 selected residue pairs for disulfide engineering, all the selected pairs have bond energy less than 2.20 kcal/mol; Table S6: Maximum ClusPro energies, cluster members and patchdock of all the TLRs used for molecular docking.

Author Contributions

Conceptualization, M.N., A.R.Y. and U.A.; methodology, N.A., H.K. and A.A.R.; software, M.N., A.R.Y. and U.A.; validation, N.A., H.K. and A.A.R.; formal analysis, M.G., M.A.H. and A.A.M.; investigation, M.G., M.A.H. and A.A.M.; resources, S.A., Z.A.A. and Y.N.A.; data curation, S.A., Z.A.A. and Y.N.A.; writing—original draft preparation, M.N., N.A. and C.Y.Y.; writing—review and editing, C.Y.Y., A.A.R. and M.N.; supervision, C.Y.Y., A.A.R. and M.N.; project administration, N.A. and M.N. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

More data related to this study can be accessed by sending a reasonable email to [email protected].

Acknowledgments

We acknowledge the support of the Department of Biotechnology, the University of Central Punjab for providing us with resources to carry out this study.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Branche, A.R.; Falsey, A.R. Parainfluenza virus infection. Semin. Respir. Crit. Care Med. 2016, 37, 538–554. [Google Scholar] [CrossRef] [PubMed]
  2. Coronel, E.C.; Murti, K.G.; Takimoto, T.; Portner, A. Human parainfluenza virus type 1 matrix and nucleoprotein genes transiently expressed in mammalian cells induce the release of virus-like particles containing nucleocapsid-like structures. J. Virol. 1999, 73, 7035–7038. [Google Scholar] [CrossRef] [PubMed][Green Version]
  3. Lamb, R.; Kolakofsky, D. Paramyxoviridae: The viruses and their replication. In Fields Virology, 3rd ed.; Lippincott-Raven Press: Philadelphia, PA, USA, 1996; pp. 1177–1204. [Google Scholar]
  4. Vilchez, R.A.; McCurry, K.; Dauber, J.; Iacono, A.; Keenan, R.; Zeevi, A.; Griffith, B.; Kusne, S. The epidemiology of parainfluenza virus infection in lung transplant recipients. Clin. Infect. Dis. 2001, 33, 2004–2008. [Google Scholar] [CrossRef] [PubMed]
  5. Hasham, K.; Ahmed, N.; Zeshan, B. Circulating microRNAs in oncogenic viral infections: Potential diagnostic biomarkers. SN Appl. Sci. 2020, 2, 442. [Google Scholar] [CrossRef][Green Version]
  6. Beck, E.T.; He, J.; Nelson, M.I.; Bose, M.E.; Fan, J.; Kumar, S.; Henrickson, K.J. Genome sequencing and phylogenetic analysis of 39 human parainfluenza virus type 1 strains isolated from 1997–2010. PLoS ONE 2012, 7, e46048. [Google Scholar] [CrossRef]
  7. Denny, F.W., Jr. The clinical impact of human respiratory virus infections. Am. J. Respir. Crit. Care Med. 1995, 152, S4. [Google Scholar] [CrossRef]
  8. Woo, P.C.; Young, K.; Tsang, K.W.; Ooi, C.G.; Peiris, M.; Yuen, K.-Y. Adult croup: A rare but more severe condition. Respiration 2000, 67, 684–688. [Google Scholar] [CrossRef]
  9. Bailly, B.; Dirr, L.; El-Deeb, I.M.; Altmeyer, R.; Guillon, P.; von Itzstein, M. A dual drug regimen synergistically blocks human parainfluenza virus infection. Sci. Rep. 2016, 6, 24138. [Google Scholar] [CrossRef][Green Version]
  10. Palmer, S.G.; Porotto, M.; Palermo, L.M.; Cunha, L.F.; Greengard, O.; Moscona, A. Adaptation of human parainfluenza virus to airway epithelium reveals fusion properties required for growth in host tissue. MBio 2012, 3, e00137-12. [Google Scholar] [CrossRef][Green Version]
  11. Slobod, K.S.; Shenep, J.L.; Luján-Zilbermann, J.; Allison, K.; Brown, B.; Scroggs, R.A.; Portner, A.; Coleclough, C.; Hurwitz, J.L. Safety and immunogenicity of intranasal murine parainfluenza virus type 1 (Sendai virus) in healthy human adults. Vaccine 2004, 22, 3182–3186. [Google Scholar] [CrossRef]
  12. Rafeek, R.A.; Divarathna, M.V.; Noordeen, F. A review on disease burden and epidemiology of childhood parainfluenza virus infections in Asian countries. Rev. Med. Virol. 2021, 31, e2164. [Google Scholar] [CrossRef] [PubMed]
  13. Dorosti, H.; Eslami, M.; Negahdaripour, M.; Ghoshoon, M.B.; Gholami, A.; Heidari, R.; Dehshahri, A.; Erfani, N.; Nezafat, N.; Ghasemi, Y. Vaccinomics approach for developing multi-epitope peptide pneumococcal vaccine. J. Biomol. Struct. Dyn. 2019, 37, 3524–3535. [Google Scholar] [CrossRef] [PubMed]
  14. Faisal, A.-R.M.; Imtiaz, S.H.; Zerin, T.; Rahman, T.; Shekhar, H.U. Computer aided epitope design as a peptide vaccine component against Lassa virus. Bioinformation 2017, 13, 417. [Google Scholar] [CrossRef] [PubMed]
  15. Ali, S.A.; Almofti, Y.A.; Abd-Elrahman, K.A. Immunoinformatics approach for multiepitopes vaccine prediction against glycoprotein B of avian infectious laryngotracheitis virus. Adv. Bioinform. 2019, 2019, 1270485. [Google Scholar] [CrossRef] [PubMed][Green Version]
  16. Kaliamurthi, S.; Selvaraj, G.; Kaushik, A.C.; Gu, K.-R.; Wei, D.-Q. Designing of CD8+ and CD8+-overlapped CD4+ epitope vaccine by targeting late and early proteins of human papillomavirus. Biol. Targets Ther. 2018, 12, 107. [Google Scholar] [CrossRef][Green Version]
  17. Urrutia-Baca, V.H.; Gomez-Flores, R.; De La Garza-Ramos, M.A.; Tamez-Guerra, P.; Lucio-Sauceda, D.G.; Rodríguez-Padilla, M.C. Immunoinformatics approach to design a novel epitope-based oral vaccine against Helicobacter pylori. J. Comput. Biol. 2019, 26, 1177–1190. [Google Scholar] [CrossRef][Green Version]
  18. Maeda, D.L.N.F.; Batista, M.T.; Pereira, L.R.; de Jesus Cintra, M.; Amorim, J.H.; Mathias-Santos, C.; Pereira, S.A.; Boscardin, S.B.; Silva, S.D.R.; Faquim-Mauro, E.L.; et al. Adjuvant-Mediated Epitope Specificity and Enhanced Neutralizing Activity of Antibodies Targeting Dengue Virus Envelope Protein. Front. Immunol. 2017, 8, 1175. [Google Scholar] [CrossRef][Green Version]
  19. Doytchinova, I.A.; Flower, D.R. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007, 8, 4. [Google Scholar] [CrossRef][Green Version]
  20. Gasteiger, E.; Hoogland, C.; Gattiker, A.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein identification and analysis tools on the ExPASy server. In The Proteomics Protocols Handbook; Springer: Berlin/Heidelberg, Germany, 2005; pp. 571–607. [Google Scholar]
  21. Buchan, D.W.; Jones, D.T. The PSIPRED protein analysis workbench: 20 years on. Nucleic Acids Res. 2019, 47, W402–W407. [Google Scholar] [CrossRef][Green Version]
  22. Yang, J.; Yan, R.; Roy, A.; Xu, D.; Poisson, J.; Zhang, Y. The I-TASSER Suite: Protein structure and function prediction. Nat. Methods 2015, 12, 7–8. [Google Scholar] [CrossRef][Green Version]
  23. Fleri, W.; Paul, S.; Dhanda, S.K.; Mahajan, S.; Xu, X.; Peters, B.; Sette, A. The immune epitope database and analysis resource in epitope discovery and synthetic vaccine design. Front. Immunol. 2017, 8, 278. [Google Scholar] [CrossRef] [PubMed][Green Version]
  24. Dar, H.A.; Zaheer, T.; Shehroz, M.; Ullah, N.; Naz, K.; Muhammad, S.A.; Zhang, T.; Ali, A. Immunoinformatics-aided design and evaluation of a potential multi-epitope vaccine against Klebsiella pneumoniae. Vaccines 2019, 7, 88. [Google Scholar] [CrossRef] [PubMed][Green Version]
  25. Bui, H.-H.; Sidney, J.; Dinh, K.; Southwood, S.; Newman, M.J.; Sette, A. Predicting population coverage of T-cell epitope-based diagnostics and vaccines. BMC Bioinform. 2006, 7, 153. [Google Scholar] [CrossRef] [PubMed][Green Version]
  26. Gupta, S.; Kapoor, P.; Chaudhary, K.; Gautam, A.; Kumar, R.; Consortium, O.S.D.D.; Raghava, G.P. In silico approach for predicting toxicity of peptides and proteins. PLoS ONE 2013, 8, e73957. [Google Scholar] [CrossRef][Green Version]
  27. Doytchinova, I.A.; Flower, D.R. Bioinformatic approach for identifying parasite and fungal candidate subunit vaccines. Open Vaccine J. 2008, 1, 4. [Google Scholar] [CrossRef]
  28. Dimitrov, I.; Flower, D.R.; Doytchinova, I. AllerTOP—A server for in silico prediction of allergens. BMC Bioinform. 2013, 14, S4. [Google Scholar] [CrossRef][Green Version]
  29. Khan, M.; Khan, S.; Ali, A.; Akbar, H.; Sayaf, A.M.; Khan, A.; Wei, D.-Q. Immunoinformatics approaches to explore Helicobacter Pylori proteome (Virulence Factors) to design B and T cell multi-epitope subunit vaccine. Sci. Rep. 2019, 9, 13321. [Google Scholar] [CrossRef]
  30. Craig, D.B.; Dombkowski, A.A. Disulfide by Design 2.0: A web-based tool for disulfide engineering in proteins. BMC Bioinform. 2013, 14, 346. [Google Scholar] [CrossRef][Green Version]
  31. Zhang, L.; Xu, Y.; Jin, X.; Shi, Z.; Wu, M.; Xu, N.; Yu, X.; Deng, S.; Zhang, K.; Zhang, L. Retrospective study on the effectiveness of a prevention strategy in a dental hospital during the COVID-19 pandemic. Clin. Oral Investig. 2021, 25, 5815–5822. [Google Scholar] [CrossRef]
  32. Wiederstein, M.; Sippl, M.J. ProSA-web: Interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 2007, 35, W407–W410. [Google Scholar] [CrossRef][Green Version]
  33. Lovell, S.C.; Davis, I.W.; Arendall III, W.B.; de Bakker, P.I.W.; Word, J.M.; Prisant, M.G.; Richardson, J.S.; Richardson, D.C. Structure validation by Cα geometry: ϕ,ψ and Cβ deviation. Proteins Struct. Funct. Bioinform. 2003, 50, 437–450. [Google Scholar] [CrossRef] [PubMed]
  34. Lee, G.R.; Won, J.; Heo, L.; Seok, C. GalaxyRefine2: Simultaneous refinement of inaccurate local regions and overall protein structure. Nucleic Acids Res. 2019, 47, W451–W455. [Google Scholar] [CrossRef] [PubMed]
  35. Kozakov, D.; Hall, D.R.; Xia, B.; Porter, K.A.; Padhorny, D.; Yueh, C.; Beglov, D.; Vajda, S. The ClusPro web server for protein-protein docking. Nat. Protoc. 2017, 12, 255–278. [Google Scholar] [CrossRef] [PubMed]
  36. Schneidman-Duhovny, D.; Inbar, Y.; Nussinov, R.; Wolfson, H.J. PatchDock and SymmDock: Servers for rigid and symmetric docking. Nucleic Acids Res. 2005, 33, W363–W367. [Google Scholar] [CrossRef][Green Version]
  37. López-Blanco, J.R.; Aliaga, J.I.; Quintana-Ortí, E.S.; Chacón, P. iMODS: Internal coordinates normal mode analysis server. Nucleic Acids Res. 2014, 42, W271–W276. [Google Scholar] [CrossRef]
  38. Grote, A.; Hiller, K.; Scheer, M.; Münch, R.; Nörtemann, B.; Hempel, D.C.; Jahn, D. JCat: A novel tool to adapt codon usage of a target gene to its potential expression host. Nucleic Acids Res. 2005, 33, W526–W531. [Google Scholar] [CrossRef]
  39. Rapin, N.; Lund, O.; Bernaschi, M.; Castiglione, F. Computational Immunology Meets Bioinformatics: The Use of Prediction Tools for Molecular Binding in the Simulation of the Immune System. PLoS ONE 2010, 5, e9862. [Google Scholar] [CrossRef][Green Version]
  40. Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. Epitope-based vaccine as a universal vaccination strategy against Toxoplasma gondii infection: A mini-Review. J. Adv. Vet. Anim. Res. 2019, 6, 174. [Google Scholar] [CrossRef]
  41. Rizvi, A.; Hussain, N.; Anjum, A.A.; Ahmed, N.; Naeem, A.; Khan, M.; Altaf, I. Effect of cell density on the biological titer and yield of 146S fraction of foot-and-mouth disease virus O in cell suspension. J. Virol. Methods 2022, 300, 114379. [Google Scholar] [CrossRef]
  42. Naveed, M.; Ali, U.; Karobari, M.I.; Ahmed, N.; Mohamed, R.N.; Abullais, S.S.; Kader, M.A.; Marya, A.; Messina, P.; Scardina, G.A. A Vaccine Construction against COVID-19-Associated Mucormycosis Contrived with Immunoinformatics-Based Scavenging of Potential Mucoralean Epitopes. Vaccines 2022, 10, 664. [Google Scholar] [CrossRef]
  43. Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. Immunogenicity of multiepitope vaccine candidate against Toxoplasma gondii infection in BALB/c mice. Iran. J. Parasitol. 2018, 13, 215. [Google Scholar] [PubMed]
  44. Khazaei-Poul, Y.; Farhadi, S.; Ghani, S.; Ahmadizad, S.A.; Ranjbari, J. Monocyclic peptides: Types, synthesis and applications. Curr. Pharm. Biotechnol. 2021, 22, 123–135. [Google Scholar] [CrossRef] [PubMed]
  45. St, I.; Salih, S.; M, B.; A, E.; S, K.; Mohammed, K.A.; Hamdi, A.; Hassan, M. In silico Prediction of Peptide based Vaccine against Fowlpox Virus (FPV). Immunome Res. 2018, 14, 1000154. [Google Scholar] [CrossRef]
  46. Zheng, J.; Lin, X.; Wang, X.; Zheng, L.; Lan, S.; Jin, S.; Ou, Z.; Wu, J. In Silico Analysis of Epitope-Based Vaccine Candidates against Hepatitis B Virus Polymerase Protein. Viruses 2017, 9, 112. [Google Scholar] [CrossRef]
  47. Mohammed, A.A.; Shantier, S.W.; Mustafa, M.I.; Osman, H.K.; Elmansi, H.E.; Osman, I.-A.A.; Mohammed, R.A.; Abdelrhman, F.A.; Elnnewery, M.E.; Yousif, E.M.; et al. Epitope-Based Peptide Vaccine against Glycoprotein G of Nipah Henipavirus Using Immunoinformatics Approaches. J. Immunol. Res. 2020, 2020, 2567957. [Google Scholar] [CrossRef][Green Version]
  48. Naveed, M.; Tehreem, S.; Arshad, S.; Bukhari, S.A.; Shabbir, M.A.; Essa, R.; Ali, N.; Zaib, S.; Khan, A.; Al-Harrasi, A.; et al. Design of a novel multiple epitope-based vaccine: An immunoinformatics approach to combat SARS-CoV-2 strains. J. Infect. Public Health 2021, 14, 938–946. [Google Scholar] [CrossRef]
  49. Gao, Q.; Bao, L.; Mao, H.; Wang, L.; Xu, K.; Yang, M.; Li, Y.; Zhu, L.; Wang, N.; Lv, Z.; et al. Development of an inactivated vaccine candidate for SARS-CoV-2. Science 2020, 369, 77–81. [Google Scholar] [CrossRef]
  50. Rahman, M.S.; Hoque, M.N.; Islam, M.R.; Akter, S.; Rubayet Ul Alam, A.S.M.; Siddique, M.A.; Saha, O.; Rahaman, M.M.; Sultana, M.; Crandall, K.A.; et al. Epitope-based chimeric peptide vaccine design against S, M and E proteins of SARS-CoV-2, the etiologic agent of COVID-19 pandemic: An in silico approach. PeerJ 2020, 8, e9572. [Google Scholar] [CrossRef]
  51. Choudhury, A.; Gupta, P.S.S.; Panda, S.K.; Rana, M.K.; Mukherjee, S. Designing AbhiSCoVac-A single potential vaccine for all ‘corona culprits’: Immunoinformatics and immune simulation approaches. J. Mol. Liq. 2022, 351, 118633. [Google Scholar] [CrossRef]
  52. Altmeyer, R.; Bailly, B. Inhibitors and Antiviral Drugs Designed to Target the Human Res. Microbes Infect 2014, 3, e62. [Google Scholar]
  53. Iorio, R.M.; Glickman, R.L.; Sheehan, J.P. Inhibition of fusion by neutralizing monoclonal antibodies to the haemagglutinin-neuraminidase glycoprotein of Newcastle disease virus. J. Gen. Virol. 1992, 73 Pt 5, 1167–1176. [Google Scholar] [CrossRef]
  54. Wieczorek, M.; Abualrous, E.T.; Sticht, J.; Álvaro-Benito, M.; Stolzenberg, S.; Noé, F.; Freund, C. Major Histocompatibility Complex (MHC) Class I and MHC Class II Proteins: Conformational Plasticity in Antigen Presentation. Front. Immunol. 2017, 8, 292. [Google Scholar] [CrossRef] [PubMed][Green Version]
  55. Adler, L.N.; Jiang, W.; Bhamidipati, K.; Millican, M.; Macaubas, C.; Hung, S.-C.; Mellins, E.D. The Other Function: Class II-Restricted Antigen Presentation by B Cells. Front. Immunol. 2017, 8, 319. [Google Scholar] [CrossRef] [PubMed][Green Version]
  56. Tahir Ul Qamar, M.; Shokat, Z.; Muneer, I.; Ashfaq, U.A.; Javed, H.; Anwar, F.; Bari, A.; Zahid, B.; Saari, N. Multiepitope-Based Subunit Vaccine Design and Evaluation against Respiratory Syncytial Virus Using Reverse Vaccinology Approach. Vaccines 2020, 8, 288. [Google Scholar] [CrossRef] [PubMed]
  57. Sarkar, B.; Ullah, M.A.; Araf, Y.; Das, S.; Rahman, M.H.; Moin, A.T. Designing novel epitope-based polyvalent vaccines against herpes simplex virus-1 and 2 exploiting the immunoinformatics approach. J. Biomol. Struct. Dyn. 2020, 39, 6585–6605. [Google Scholar] [CrossRef] [PubMed]
  58. Xagorari, A.; Chlichlia, K. Toll-like receptors and viruses: Induction of innate antiviral immune responses. Open Microbiol. J. 2008, 2, 49–59. [Google Scholar] [CrossRef] [PubMed]
  59. Gibney, K.B.; Attwood, L.O.; Nicholson, S.; Tran, T.; Druce, J.; Healy, J.; Strachan, J.; Franklin, L.; Hall, R.; Cross, G.B. Emergence of attenuated measles illness among IgG-positive/IgM-negative measles cases: Victoria, Australia, 2008–2017. Clin. Infect. Dis. 2020, 70, 1060–1067. [Google Scholar] [CrossRef] [PubMed]
  60. Ali, M.; Pandey, R.K.; Khatoon, N.; Narula, A.; Mishra, A.; Prajapati, V.K. Exploring dengue genome to construct a multi-epitope based subunit vaccine by utilizing immunoinformatics approach to battle against dengue infection. Sci. Rep. 2017, 7, 9232. [Google Scholar] [CrossRef]
Figure 1. (A) Three-dimensional (3D) structure of the HN protein obtained from PDB, (B) MEMSAT predicted by PsiPred showing the Topology of the HN protein, (C) Secondary structure of HN protein predicted by SOPMA showing different components in different colors, (D) MEMSAT showing extracellular part of HN protein.
Figure 1. (A) Three-dimensional (3D) structure of the HN protein obtained from PDB, (B) MEMSAT predicted by PsiPred showing the Topology of the HN protein, (C) Secondary structure of HN protein predicted by SOPMA showing different components in different colors, (D) MEMSAT showing extracellular part of HN protein.
Vaccines 10 00869 g001
Figure 2. Population coverage of all the selected epitopes for both MHC-II classes. (a) World-Class I Coverage. (b) World-Class II Coverage.
Figure 2. Population coverage of all the selected epitopes for both MHC-II classes. (a) World-Class I Coverage. (b) World-Class II Coverage.
Vaccines 10 00869 g002
Figure 3. Prepared vaccine construct with the His-tag and linkers in red, adjuvant in black, B-cell epitopes in purple, MHC-I epitopes in blue, and MHC-II epitopes in green and its 3D model.
Figure 3. Prepared vaccine construct with the His-tag and linkers in red, adjuvant in black, B-cell epitopes in purple, MHC-I epitopes in blue, and MHC-II epitopes in green and its 3D model.
Vaccines 10 00869 g003
Figure 4. Docked complexes of the vaccine and the TLRs. (A) TLR-2, (B) TLR-3, (C) TLR-4, (D) TLR-5, (E) TLR-8. The TLRs are shown in green color, whereas the vaccine construct is in blue color. Interacting residues are highlighted with an orange circle.
Figure 4. Docked complexes of the vaccine and the TLRs. (A) TLR-2, (B) TLR-3, (C) TLR-4, (D) TLR-5, (E) TLR-8. The TLRs are shown in green color, whereas the vaccine construct is in blue color. Interacting residues are highlighted with an orange circle.
Vaccines 10 00869 g004
Figure 5. Elastic network of TLR-2: vaccine complex.
Figure 5. Elastic network of TLR-2: vaccine complex.
Vaccines 10 00869 g005
Figure 6. Sequence adaptation predicted via JCAT.
Figure 6. Sequence adaptation predicted via JCAT.
Vaccines 10 00869 g006
Figure 7. In silico replication of the pET28a (+) plasmid using SnapGene software to construct a recombinant plasmid.
Figure 7. In silico replication of the pET28a (+) plasmid using SnapGene software to construct a recombinant plasmid.
Vaccines 10 00869 g007
Figure 8. (A) Showed the increase in B-cells, (B) Rapid peak rise shows an increase in active B-cells.
Figure 8. (A) Showed the increase in B-cells, (B) Rapid peak rise shows an increase in active B-cells.
Vaccines 10 00869 g008
Figure 9. (A) Representation of regulatory T-cell production in immune response, (B) Graph showing the sharp rise in Cytotoxic T-cells.
Figure 9. (A) Representation of regulatory T-cell production in immune response, (B) Graph showing the sharp rise in Cytotoxic T-cells.
Vaccines 10 00869 g009
Figure 10. Graphical representation about the production of various immunogenic molecules such as interferons (IFNs) and interleukins (IL); the small graph has a dark blue line, which shows the dangerous level, but that line is almost straight, showing there is no overreaction of vaccine.
Figure 10. Graphical representation about the production of various immunogenic molecules such as interferons (IFNs) and interleukins (IL); the small graph has a dark blue line, which shows the dangerous level, but that line is almost straight, showing there is no overreaction of vaccine.
Vaccines 10 00869 g010
Table 1. Physiochemical properties of HN protein and vaccine predicted by ProtParam.
Table 1. Physiochemical properties of HN protein and vaccine predicted by ProtParam.
MoleculeMW (Da)Instability IndexHalf-LifeTheoretical pIAA No.GRAVYAliphatic Index
HN protein63,981.3436.4830 h8.17575−0.16194.94
Vaccine69,661.7033.323.5 h9.04641−0.06093.53
Table 2. Selected B-cell epitopes for the vaccine.
Table 2. Selected B-cell epitopes for the vaccine.
StartEndPeptideLengthAntigenicity Score
343375TTPLQGDTKCVTNRCANVNQSVCNDALKITWLK330.5002
445470MTIKWAPHEVLSRPGNQDCNWYNRCP260.8932
520528RLKNVQLEA91.3398
Allergenicity: Non-Allergen. Toxicity: Non-Toxin.
Table 3. Selected T-cell epitopes for the vaccine.
Table 3. Selected T-cell epitopes for the vaccine.
StartEndAllelePeptideLengthAntigenicity Score
MHC-I EPITOPES
399407HLA-A * 26:01ETIPITQNY90.9982
150159HLA-B * 57:01ISPLDPHDFW100.9645
150159HLA-B * 58:01ISPLDPHDFW100.9538
94102HLA-A * 68:02EVISRTINI90.9457
247256HLA-A * 68:01HTYDINDNRK100.9373
305313HLA-A * 24:02RYKNEDITF90.9317
4149HLA-B * 57:01TTMHTILSF90.9105
389397HLA-A * 02:03YLSDRPKIV90.8992
305313HLA-A * 23:01RYKNEDITF90.8926
364373HLA-B * 57:01VCNDALKITW100.8925
211HLA-B * 44:03AEKGKTNSSY100.8767
211HLA-B * 44:02AEKGKTNSSY100.8757
150159HLA-B * 53:01ISPLDPHDFW100.8588
367375HLA-A * 68:01DALKITWLK90.8520
4149HLA-B * 58:01TTMHTILSF90.8503
290298HLA-A * 68:01LVFDILDLK90.8461
MHC-II EPITOPES
4660HLA-DRB4 * 01:01ILSFIIMILCIDLII140.08
4559HLA-DRB4 * 01:01TILSFIIMILCIDL140.08
96110HLA-DRB4 * 01:01ISRTINIQSSVQSGI140.15
95109HLA-DRB4 * 01:01VISRTINIQSSVQSG140.2
94108HLA-DRB4 * 01:01EVISRTINIQSSVQS140.23
166180HLA-DRB3 * 02:02PLLSNNPNISLLPGP140.46
4458HLA-DRB4 * 01:01HTILSFIIMILCIDL140.76
514528HLA-DRB4 * 01:01EIINMLRLKNVQLEA141.2
515529HLA-DRB4 * 01:01IINMLRLKNVQLEAA141.2
516530HLA-DRB4 * 01:01INMLRLKNVQLEAAY141.4
415429HLA-DRB1 * 15:01LKLGKKIYIYTRSSG141.5
4357HLA-DRB1 * 15:01MHTILSFIIMILCID141.6
4357HLA-DRB4 * 01:01MHTILSFIIMILCID142.3
517531HLA-DRB4 * 01:01NMLRLKNVQLEAAYT142.6
511525HLA-DRB4 * 01:01NTSEIINMLRLKNVQ142.9
Allergenicity: Non-Allergen. Toxicity: Non-Toxin. * Proposed peptides.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Naveed, M.; Yaseen, A.R.; Khalid, H.; Ali, U.; Rabaan, A.A.; Garout, M.; Halwani, M.A.; Al Mutair, A.; Alhumaid, S.; Al Alawi, Z.; et al. Execution and Design of an Anti HPIV-1 Vaccine with Multiple Epitopes Triggering Innate and Adaptive Immune Responses: An Immunoinformatic Approach. Vaccines 2022, 10, 869. https://doi.org/10.3390/vaccines10060869

AMA Style

Naveed M, Yaseen AR, Khalid H, Ali U, Rabaan AA, Garout M, Halwani MA, Al Mutair A, Alhumaid S, Al Alawi Z, et al. Execution and Design of an Anti HPIV-1 Vaccine with Multiple Epitopes Triggering Innate and Adaptive Immune Responses: An Immunoinformatic Approach. Vaccines. 2022; 10(6):869. https://doi.org/10.3390/vaccines10060869

Chicago/Turabian Style

Naveed, Muhammad, Allah Rakha Yaseen, Hira Khalid, Urooj Ali, Ali A. Rabaan, Mohamed Garout, Muhammad A. Halwani, Abbas Al Mutair, Saad Alhumaid, Zainab Al Alawi, and et al. 2022. "Execution and Design of an Anti HPIV-1 Vaccine with Multiple Epitopes Triggering Innate and Adaptive Immune Responses: An Immunoinformatic Approach" Vaccines 10, no. 6: 869. https://doi.org/10.3390/vaccines10060869

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop