Perinatal Hypoxic-Ischemic Encephalopathy and Neuroprotective Peptide Therapies: A Case for Cationic Arginine-Rich Peptides (CARPs)
Abstract
:1. Introduction
2. Pathophysiology of Perinatal Hypoxia-Ischemic Brain Injury
2.1. Initiation of the Pathophysiological Cascade in HIE
2.2. Excitotoxicity
2.3. Oxidative Stress
2.4. Mitochondrial Dysfunction
2.5. Inflammation
3. Current Clinical Treatments: Hypothermia
4. Neuroprotective Peptides and Their Therapeutic Application in HIE
4.1. Peptide Therapeutics
4.2. CARPs Are Intrinsically Neuroprotective
4.3. Cationic Arginine-Rich Cell-Penetrating Peptide Neuroprotective Mechanisms of Actions
4.4. Studies Using CARPs in Animal Models of HIE
4.4.1. TAT-NEMO Binding Domain (NBD)
4.4.2. TAT-mGluR1
4.4.3. c-Jun N-Terminal Kinase (JNK) Inhibitors
4.4.4. TAT-BH4
4.4.5. Osteopontin (OPN) and TAT-Fused OPN Peptide (TAT-OPN)
4.4.6. P5-TAT
4.4.7. D-TAT-GESV
4.4.8. TAT-NR2B9c/NA-1
4.4.9. Poly-Arginine-18 (R18 and R18D)
4.5. Other Peptides Examined in Animal Models of HIE
4.5.1. COG133
4.5.2. Connexin 43 (Cx43) Derived Peptides
4.5.3. Apelin-36
4.5.4. Innate Defense Regulator (IDR) Peptide IDR-1018
5. Do All CARPs Including TAT-Fused Peptides Share a Common Neuroprotective Mechanism of Action?
6. Conclusions
7. Future Directions
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Chalak, L.F.; Rollins, N.; Morriss, M.C.; Brion, L.P.; Heyne, R.; Sánchez, P.J. Perinatal acidosis and hypoxic-ischemic encephalopathy in preterm infants of 33 to 35 weeks’ gestation. J. Pediatr. 2012, 160, 388–394. [Google Scholar] [CrossRef] [PubMed]
- Wall, S.N.; Lee, A.C.; Carlo, W.; Goldenberg, R.; Niermeyer, S.; Darmstadt, G.L.; Keenan, W.; Bhutta, Z.A.; Perlman, J.; Lawn, J.E. Reducing intrapartum-related neonatal deaths in low- and middle-income countries-what works? Semin. Perinatol. 2010, 34, 395–407. [Google Scholar] [CrossRef] [PubMed]
- Chowdhury, H.R.; Thompson, S.; Ali, M.; Alam, N.; Yunus, M.; Streatfield, P.K. Causes of neonatal deaths in a rural subdistrict of Bangladesh: Implications for intervention. J. Health Popul. Nutr. 2010, 28, 375–382. [Google Scholar] [CrossRef] [PubMed]
- Simiyu, I.N.; Mchaile, D.N.; Katsongeri, K.; Philemon, R.N.; Msuya, S.E. Prevalence, severity and early outcomes of hypoxic ischemic encephalopathy among newborns at a tertiary hospital, in northern Tanzania. BMC Pediatr. 2017, 17, 131. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lawn, J.; Shibuya, K.; Stein, C. No cry at birth: Global estimates of intrapartum stillbirths and intrapartum-related neonatal deaths. Bull. World Health Organ. 2005, 83, 409–417. [Google Scholar] [PubMed]
- Lee, A.C.; Kozuki, N.; Blencowe, H.; Vos, T.; Bahalim, A.; Darmstadt, G.L.; Niermeyer, S.; Ellis, M.; Robertson, N.J.; Cousens, S.; et al. Intrapartum-related neonatal encephalopathy incidence and impairment at regional and global levels for 2010 with trends from 1990. Pediatr. Res. 2013, 74 (Suppl. 1), 50–72. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Perlman, J.M. Intrapartum hypoxic-ischemic cerebral injury and subsequent cerebral palsy: Medicolegal issues. Pediatrics 1997, 99, 851–859. [Google Scholar] [CrossRef] [PubMed]
- Kolevzon, A.; Gross, R.; Reichenberg, A. Prenatal and Perinatal Risk Factors for Autism. Arch. Pediatr. Adolesc. Med. 2007, 161, 326–333. [Google Scholar] [CrossRef] [PubMed]
- O’Shea, T.M. Diagnosis, treatment, and prevention of cerebral palsy. Clin. Obstet. Gynecol. 2008, 51, 816–828. [Google Scholar] [CrossRef] [PubMed]
- Pisani, F.; Orsini, M.; Braibanti, S.; Copioli, C.; Sisti, L.; Turco, E.C. Development of epilepsy in newborns with moderate hypoxic-ischemic encephalopathy and neonatal seizures. Brain Dev. 2009, 31, 64–68. [Google Scholar] [CrossRef] [PubMed]
- De Haan, M.; Wyatt, J.S.; Roth, S.; Vargha-Khadem, F.; Gadian, D.; Mishkin, M. Brain and cognitive-behavioural development after asphyxia at term birth. Dev. Sci. 2006, 9, 350–358. [Google Scholar] [CrossRef] [PubMed]
- Meloni, B.; Craig, A.; Milech, N.; Hopkins, R.; Watt, P.; Knuckey, N. The neuroprotective efficacy of cell-penetrating peptides TAT, penetratin, Arg-9, and Pep-1 in glutamic acid, kainic acid, and in vitro ischemia injury models using primary cortical neuronal cultures. Cell. Mol. Neurobiol. 2014, 34, 173–181. [Google Scholar] [CrossRef] [PubMed]
- Vaslin, A.; Rummel, C.; Clarke, P.G.H. Unconjugated TAT carrier peptide protects against excitotoxicity. Neurotox. Res. 2009, 15, 123–126. [Google Scholar] [CrossRef] [PubMed]
- Craig, A.J.; Meloni, B.P.; Watt, P.; Knuckey, N.W. Attenuation of Neuronal Death by Peptide Inhibitors of AP-1 Activation in Acute and Delayed In Vitro Ischaemia (Oxygen/Glucose Deprivation) Models. Int. J. Pept. Res. Ther. 2010, 17, 1–6. [Google Scholar] [CrossRef]
- Meade, A.J.; Meloni, B.P.; Mastaglia, F.L.; Watt, P.M.; Knuckey, N.W. AP-1 inhibitory peptides attenuate in vitro cortical neuronal cell death induced by kainic acid. Brain Res. 2010, 1360, 8–16. [Google Scholar] [CrossRef] [PubMed]
- Meade, A.J.; Meloni, B.P.; Cross, J.; Bakker, A.J.; Fear, M.W.; Mastaglia, F.L.; Watt, P.M.; Knuckey, N.W. AP-1 inhibitory peptides are neuroprotective following acute glutamate excitotoxicity in primary cortical neuronal cultures. J. Neurochem. 2010, 112, 258–270. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xu, W.; Zhou, M.; Baudry, M. Neuroprotection by cell permeable TAT-mGluR1 peptide in ischemia: Synergy between carrier and cargo sequences. Neuroscientist 2008, 14, 409–414. [Google Scholar] [CrossRef] [PubMed]
- Milani, D.; Knuckey, N.; Anderton, R.; Cross, J.; Meloni, B. The R18 Polyarginine Peptide Is More Effective Than the TAT-NR2B9c (NA-1) Peptide When Administered 60 min after Permanent Middle Cerebral Artery Occlusion in the Rat. Stroke Res. Treat. 2016, 2016, 2372710. [Google Scholar] [PubMed]
- Meloni, B.P.; Milani, D.; Edwards, A.B.; Amderton, R.S.; O’Hare Doig, R.L.; Fitzgerald, M.; Palmer, T.N.; Kunckey, N.W. Neuroprotective peptides fused to arginine-rich cell penetrating peptides: Neuroprotective mechanism likely mediated by peptide endocytic properties. Pharmacol. Ther. 2015, 153, 36–54. [Google Scholar] [CrossRef] [PubMed]
- Milani, D.; Bakeberg, M.C.; Cross, J.L.; Clark, V.W.; Anderton, R.S.; Blacker, D.J.; Knuckey, N.W.; Meloni, B.P. Comparison of neuroprotective efficacy of poly-arginine R18 and R18D (D-enantiomer) peptides following permanent middle cerebral artery occlusion in the Wistar rat and in vitro toxicity studies. PLoS ONE 2018, 13, e0193884. [Google Scholar] [CrossRef] [PubMed]
- Edwards, A.B.; Anderton, R.S.; Knuckey, N.W.; Meloni, B.P. Assessment of therapeutic window for poly-arginine-18D (R18D) in a P7 rat model of perinatal hypoxic-ischaemic encephalopathy. In Press. J. Neurosci. Res. 2018. [Google Scholar]
- Edwards, A.B.; Cross, J.L.; Anderton, R.S.; Knuckey, N.W.; Meloni, B.P. Poly-arginine R18 and R18D (D-enantiomer) peptides reduce infarct volume and improves behavioural outcomes following perinatal hypoxic-ischaemic encephalopathy in the P7 rat. Mol. Brain 2018, 11, 8. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- MacDougall, G.; Anderton, R.S.; Edwards, A.B.; Knuckey, N.W.; Meloni, B.P. The Neuroprotective Peptide Poly-Arginine-12 (R12) Reduces Cell Surface Levels of NMDA NR2B Receptor Subunit in Cortical Neurons; Investigation into the Involvement of Endocytic Mechanisms. J. Mol. Neurosci. 2016, 61, 235–246. [Google Scholar] [CrossRef] [PubMed]
- Milani, D.; Clark, V.; Cross, J.; Anderton, R.; Knuckey, N.; Meloni, B. Poly-arginine peptides reduce infarct volume in a permanent middle cerebral artery rat stroke model. BMC Neurosci. 2016, 17, 19. [Google Scholar] [CrossRef] [PubMed]
- Chiu, L.S.; Anderton, R.S.; Cross, J.L.; Clark, V.W.; Edwards, A.B.; Knuckey, N.W.; Meloni, B.P. Assessment of R18, COG1410, and APP96-110 in excitotoxicity and traumatic brain injury. Transl. Neurosci. 2017, 8, 147–157. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Milani, D.; Cross, J.; Anderton, R.; Blacker, D.; Knuckey, N.; Meloni, B. Neuroprotective efficacy of poly-arginine R18 and NA-1 (TAT-NR2B9c) peptides following transient middle cerebral artery occlusion in the rat. Neurosci. Res. 2017, 114, 9–15. [Google Scholar] [CrossRef] [PubMed]
- Meloni, B.P.; Brookes, L.M.; Clark, V.W.; Cross, J.L.; Edwards, A.B.; Anderton, R.S.; Hopkins, R.M.; Hoffmann, K.; Knuckey, N.W. Poly-arginine and arginine-rich peptides are neuroprotective in stroke models. J. Cereb. Blood Flow Metab. 2015, 35, 993–1004. [Google Scholar] [CrossRef] [PubMed]
- Edwards, A.B.; Anderton, R.S.; Knuckey, N.W.; Meloni, B.P. Characterisation of neuroprotective efficacy of modified poly-arginine-9 (R9) peptides using a neuronal glutamic acid excitotoxicity model. Mol. Cell. Biochem. 2016, 426, 75–85. [Google Scholar] [CrossRef] [PubMed]
- Meloni, B.P.; Milani, D.; Cross, J.L.; Clark, V.W.; Edwards, A.B.; Anderton, R.S.; Blacker, D.J.; Knuckey, N.W. Assessment of the Neuroprotective Effects of Arginine-Rich Protamine Peptides, Poly-Arginine Peptides (R12-Cyclic, R22) and Arginine–Tryptophan-Containing Peptides Following In Vitro Excitotoxicity and/or Permanent Middle Cerebral Artery Occlusion in Rats. Neuromol. Med. 2017, 19, 271–285. [Google Scholar] [CrossRef] [PubMed]
- Novak, C.M.; Ozen, M.; Burd, I. Perinatal Brain Injury: Mechanisms, Prevention, and Outcomes. Clin. Perinatol. 2018, 45, 357–375. [Google Scholar] [CrossRef] [PubMed]
- Giussani, D.A. The fetal brain sparing response to hypoxia: Physiological mechanisms. J. Physiol. 2016, 594, 1215–1230. [Google Scholar] [CrossRef] [PubMed]
- Olney, J.W.; Price, M.T.; Samson, L.; Labruyere, J. The role of specific ions in glutamate neurotoxicity. Neurosci. Lett. 1986, 65, 65–71. [Google Scholar] [CrossRef]
- Choi, D.W. Excitotoxic cell death. J. Neurobiol. 1992, 23, 1261–1276. [Google Scholar] [CrossRef] [PubMed]
- Arai, A.; Vanderklish, P.; Kessler, M.; Lee, K.; Lynch, G. A brief period of hypoxia causes proteolysis of cytoskeletal proteins in hippocampal slices. Brain Res. 1991, 555, 276–280. [Google Scholar] [CrossRef]
- Zhang, J.; Dawson, V.; Dawson, T.; Snyder, S. Nitric oxide activation of poly(ADP-ribose) synthetase in neurotoxicity. Science 1994, 263, 687–689. [Google Scholar] [CrossRef] [PubMed]
- Stout, A.K.; Raphael, H.M.; Kanterewicz, B.I.; Klann, E.; Reynolds, I.J. Glutamate-induced neuron death requires mitochondrial calcium uptake. Nat. Neurosci. 1998, 1, 366–373. [Google Scholar] [CrossRef] [PubMed]
- Castilho, R.F.; Ward, M.W.; Nicholls, D.G. Oxidative stress, mitochondrial function, and acute glutamate excitotoxicity in cultured cerebellar granule cells. J. Neurochem. 1999, 72, 1394–1401. [Google Scholar] [CrossRef] [PubMed]
- O’Hare, M.J.; Kushwaha, N.; Zhang, Y.; Aleyasin, H.; Callaghan, S.M.; Slack, R.S.; Albert, P.R.; Vincent, I.; Park, D.S. Differential roles of nuclear and cytoplasmic cyclin-dependent kinase 5 in apoptotic and excitotoxic neuronal death. J. Neurosci. 2005, 25, 8954–8966. [Google Scholar] [CrossRef] [PubMed]
- Ikonomidou, C.; Kaindl, A.M. Neuronal Death and Oxidative Stress in the Developing Brain. Antioxid. Redox Signal. 2011, 14, 1535–1550. [Google Scholar] [CrossRef] [PubMed]
- Favié, L.M.A.; Cox, A.R.; van den Hoogen, A.; Nijboer, C.H.A.; Peeters-Scholte, C.M.P.C.D.; van Bel, F.; Egberts, T.C.G.; Rademaker, C.M.A.; Groenendaal, F. Nitric Oxide Synthase Inhibition as a Neuroprotective Strategy Following Hypoxic–Ischemic Encephalopathy: Evidence From Animal Studies. Front. Neurol. 2018, 9, 258. [Google Scholar] [CrossRef] [PubMed]
- Rousset, C.I.; Baburamani, A.A.; Thornton, C.; Hagberg, H. Mitochondria and perinatal brain injury. J. Matern. Fetal Neonatal Med. 2012, 25 (Suppl. 1), 35–38. [Google Scholar] [CrossRef] [PubMed]
- Thornton, C.; Hagberg, H. Role of mitochondria in apoptotic and necroptotic cell death in the developing brain. Clin. Chim. Acta. 2015, 451 Pt A, 35–38. [Google Scholar] [CrossRef]
- Lu, Y.; Tucker, D.; Dong, Y.; Zhao, N.; Zhuo, X.; Zhang, Q. Role of Mitochondria in Neonatal Hypoxic-Ischemic Brain Injury. J. Neurosci. Rehabil. 2015, 2, 1–14. [Google Scholar] [PubMed]
- Wang, X.; Carlsson, Y.; Basso, E.; Zhu, C.; Rousset, C.I.; Rasola, A.; Johansson, B.R.; Blomgren, K.; Mallard, C.; Bernardi, P.; et al. Developmental Shift of Cyclophilin D Contribution to Hypoxic-Ischemic Brain Injury. J. Neurosci. 2009, 29, 2588–2596. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bernardi, P.; Krauskopf, A.; Basso, E.; Petronilli, V.; Blachly-Dyson, E.; Di Lisa, F.; Forte, M.A. The mitochondrial permeability transition from in vitro artifact to disease target. FEBS J. 2006, 273, 2077–2099. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Thornton, C.; Rousset, C.I.; Kichev, A.; Miyakuni, Y.; Vontell, R.; Baburamani, A.A.; Fleiss, B.; Gressens, P.; Hagberg, H. Molecular Mechanisms of Neonatal Brain Injury. Neurol. Res. Int. 2012, 2012, 1–16. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Blomgren, K.; Hagberg, H. Free radicals, mitochondria, and hypoxia–ischemia in the developing brain. Free Radic. Biol. Med. 2006, 40, 388–397. [Google Scholar] [CrossRef] [PubMed]
- Zhu, C.; Wang, X.; Deinum, J.; Huang, Z.; Gao, J.; Modjtahedi, N.; Neagu, M.R.; Nilsson, M.; Eriksson, P.S.; Hagberg, H.; et al. Cyclophilin A participates in the nuclear translocation of apoptosis-inducing factor in neurons after cerebral hypoxia-ischemia. J. Exp. Med. 2007, 204, 1741–1748. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hagberg, H.; Mallard, C.; Ferriero, D.M.; Vannucci, S.J.; Levison, S.W.; Vexler, Z.S.; Gressens, P. The role of inflammation in perinatal brain injury. Nat. Rev. Neurol. 2015, 11, 192–208. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Liu, F.; McCullough, L.D. Inflammatory responses in hypoxic ischemic encephalopathy. Acta Pharmacol. Sin. 2013, 34, 1121–1130. [Google Scholar] [CrossRef] [PubMed]
- Algra, S.O.; Groeneveld, K.M.; Schadenberg, A.W.; Haas, F.; Evens, F.C.; Meerding, J.; Koenderman, L.; Jansen, N.J.; Prakken, B.J. Cerebral ischemia initiates an immediate innate immune response in neonates during cardiac surgery. J. Neuroinflamm. 2013, 10, 796. [Google Scholar] [CrossRef] [PubMed]
- Kaur, C.; Sivakumar, V.; Yip, G.W.; Ling, E.A. Expression of syndecan-2 in the amoeboid microglial cells and its involvement in inflammation in the hypoxic developing brain. Glia 2009, 57, 336–349. [Google Scholar] [CrossRef] [PubMed]
- Ma, H.; Sinha, B.; Pandya, R.S.; Lin, N.; Popp, A.J.; Li, J.; Tao, J.; Wang, X. Therapeutic hypothermia as a neuroprotective strategy in neonatal hypoxic-ischemic brain injury and traumatic brain injury. Curr. Mol. Med. 2012, 12, 1282–1296. [Google Scholar] [CrossRef] [PubMed]
- Gluckman, P.D.; Wyatt, J.S.; Azzopardi, D.; Ballard, R.; Edwards, A.D.; Ferriero, D.M.; Polin, R.A.; Robertson, C.M.; Thoresen, M.; Whitelaw, A.; et al. Selective head cooling with mild systemic hypothermia after neonatal encephalopathy: Multicentre randomised trial. Lancet 2005, 365, 663–670. [Google Scholar] [CrossRef]
- Shankaran, S.; Laptook, A.R.; Ehrenkranz, R.A.; Tyson, J.E.; McDonald, S.A.; Donovan, E.F.; Fanaroff, A.A.; Poole, W.K.; Wright, L.L.; Higgins, R.D.; et al. Whole-body hypothermia for neonates with hypoxic-ischemic encephalopathy. N. Engl. J. Med. 2005, 353, 1574–1584. [Google Scholar] [CrossRef] [PubMed]
- Azzopardi, D.V.; Strohm, B.; Edwards, A.D.; Dyet, L.; Halliday, H.L.; Juszczak, E.; Kapellou, O.; Levene, M.; Marlow, N.; Porter, E.; et al. Moderate Hypothermia to Treat Perinatal Asphyxial Encephalopathy. N. Engl. J. Med. 2009, 361, 1349–1358. [Google Scholar] [CrossRef] [PubMed]
- Jacobs, S.E.; Morley, C.J.; Inder, T.E.; Stewart, M.J.; Smith, K.R.; McNamara, P.J.; Wright, I.M.; Kirpalani, H.M.; Darlow, B.A.; Doyle, L.W.; et al. Whole-Body Hypothermia for Term and Near-Term Newborns With Hypoxic-Ischemic Encephalopathy. Arch. Pediatr. Adolesc. Med. 2011, 165, 692–700. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jacobs, S.E.; Berg, M.; Hunt, R.; Tarnow-Mordi, W.O.; Inder, T.E.; Davis, P.G. Cooling for newborns with hypoxic ischaemic encephalopathy. Cochrane Database Syst. Rev. 2013. [Google Scholar] [CrossRef] [PubMed]
- Hall, N.J.; Eaton, S.; Peters, M.J.; Hiorns, M.P.; Alexander, N.; Azzopardi, D.V.; Pierro, A. Mild controlled hypothermia in preterm neonates with advanced necrotizing enterocolitis. Pediatrics 2010, 125, e300–e308. [Google Scholar] [CrossRef] [PubMed]
- Rao, R.; Trivedi, S.; Vesoulis, Z.; Liao, S.M.; Smyser, C.D.; Mathur, A.M. Safety and Short-Term Outcomes of Therapeutic Hypothermia in Preterm Neonates 34–35 Weeks Gestational Age with Hypoxic-Ischemic Encephalopathy. J. Pediatr. 2016. [Google Scholar] [CrossRef] [PubMed]
- Committee on Fetus and Newborn; Papile, L.A.; Baley, J.E.; Benitz, W.; Cummings, J.; Carlo, W.A.; Eichenwald, E.; Kumar, P.; Polin, R.A.; Tan, R.C. Hypothermia and neonatal encephalopathy. Pediatrics 2014, 133, 1146–1150. [Google Scholar] [PubMed]
- Fosgerau, K.; Hoffmann, T. Peptide therapeutics: Current status and future directions. Drug Discov. Today 2015, 20, 122–128. [Google Scholar] [CrossRef] [PubMed]
- Ferrer-Montiel, A.V.; Merino, J.M.; Blondelle, S.E.; Perez-Paya, E.; Houghten, R.A.; Montal, M. Selected peptides targeted to the NMDA receptor channel protect neurons from excitotoxic death. Nat. Biotechnol. 1998, 16, 286–291. [Google Scholar] [CrossRef] [PubMed]
- Xu, W.W.; Zhou, M.M.; Baudry, M. Neuroprotection by Cell Permeable TAT-mGluR1 Peptide in Ischemia: Synergy between Carrier and Cargo Sequences. Neuroscientist 2008, 14, 409–414. [Google Scholar] [CrossRef] [PubMed]
- Marshall, J.; Wong, K.Y.; Rupasinghe, C.N.; Tiwari, R.; Zhao, X.; Berberoglu, E.D.; Sinkler, C.; Liu, J.; Lee, I.; Parang, K.; et al. Inhibition of N-Methyl-d-aspartate-induced Retinal Neuronal Death by Polyarginine Peptides Is Linked to the Attenuation of Stress-induced Hyperpolarization of the Inner Mitochondrial Membrane Potential. J. Biol. Chem. 2015, 290, 22030–22048. [Google Scholar] [CrossRef] [PubMed]
- McQueen, J.; Ryan, T.J.; McKay, S.; Marwick, K.; Baxter, P.; Carpanini, S.M.; Wishart, T.M.; Gillingwater, T.H.; Manson, J.C.; Wylie, D.J.A.; et al. Pro-death NMDA receptor signaling is promoted by the GluN2B C-terminus independently of Dapk1. Elife 2017, 6, e17161. [Google Scholar] [CrossRef] [PubMed]
- Cook, D.R.; Gleichman, A.J.; Cross, S.A.; Doshi, S.; Ho, W.; Jordan-Sciutto, K.L.; Lynch, D.R.; Kolson, D.L. NMDA receptor modulation by the neuropeptide apelin: Implications for excitotoxic injury. J. Neurochem. 2011, 118, 1113–1123. [Google Scholar] [CrossRef] [PubMed]
- García-Caballero, A.; Gadotti, V.M.; Stemkowski, P.; Weiss, N.; Souza, I.A.; Hodgkinson, V.; Bladen, C.; Chen, L.; Hamid, J.; Pizzoccaro, A.; et al. The deubiquitinating enzyme USP5 modulates neuropathic and inflammatory pain by enhancing Cav3.2 channel activity. Neuron 2014, 83, 1144–1158. [Google Scholar] [CrossRef] [PubMed]
- Xie, J.Y.; Chew, L.A.; Yang, X.; Wang, Y.; Qu, C.; Wang, Y.; Federici, L.M.; Fitz, S.D.; Ripsch, M.S.; Due, M.R.; et al. Sustained relief of ongoing experimental neuropathic pain by a CRMP2 peptide aptamer with low abuse potential. Pain 2016, 157, 2124–2140. [Google Scholar] [CrossRef] [PubMed]
- Brustovetsky, T.; Pellman, J.J.; Yang, X.-F.F.; Khanna, R.; Brustovetsky, N. Collapsin response mediator protein 2 (CRMP2) interacts with N-methyl-D-aspartate (NMDA) receptor and Na+/Ca2+ exchanger and regulates their functional activity. J. Biol. Chem. 2014, 289, 7470–7482. [Google Scholar] [CrossRef] [PubMed]
- Sinai, L.; Duffy, S.; Roder, J.C. Src inhibition reduces NR2B surface expression and synaptic plasticity in the amygdala. Learn. Mem. 2010, 17, 364–371. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tu, W.; Xu, X.; Peng, L.; Zhong, X.; Zhang, W.; Soundarapandian, M.M.; Balel, C.; Wang, M.; Jia, N.; Zhang, W.; et al. DAPK1 interaction with NMDA receptor NR2B subunits mediates brain damage in stroke. Cell 2010, 140, 222–234. [Google Scholar] [CrossRef] [PubMed]
- Fan, J.; Cowan, C.M.; Zhang, L.Y.J.; Hayden, M.R.; Raymond, L.A. Interaction of postsynaptic density protein-95 with NMDA receptors influences excitotoxicity in the yeast artificial chromosome mouse model of Huntington’s disease. J. Neurosci. 2009, 29, 10928–10938. [Google Scholar] [CrossRef] [PubMed]
- Brittain, J.M.; Chen, L.; Wilson, S.M.; Brustovetsky, T.; Gao, X.; Ashpole, N.M.; Molosh, A.I.; You, H.; Hudmon, A.; Shekhar, A.; et al. Neuroprotection against traumatic brain injury by a peptide derived from the collapsin response mediator protein 2 (CRMP2). J. Biol. Chem. 2011, 286, 37778–37792. [Google Scholar] [CrossRef] [PubMed]
- Feldman, P.; Khanna, R. Challenging the catechism of therapeutics for chronic neuropathic pain: Targeting CaV2.2 interactions with CRMP2 peptides. Neurosci. Lett. 2013, 557 Pt A, 27–36. [Google Scholar] [CrossRef] [Green Version]
- François-Moutal, L.; Dustrude, E.T.; Wang, Y.; Brustovetsky, T.; Dorame, A.; Ju, W.; Moutal, A.; Perez-Miller, S.; Brustovetsky, N.; Gokhale, V.; et al. Inhibition of the Ubc9 E2 SUMO conjugating enzyme–CRMP2 interaction decreases NaV1.7 currents and reverses experimental neuropathic pain. Pain 2018, 1. [Google Scholar] [CrossRef] [PubMed]
- Birk, A.V.; Chao, W.M.; Liu, S.; Soong, Y.; Szeto, H.H. Disruption of cytochrome c heme coordination is responsible for mitochondrial injury during ischemia. Biochim. Biophys. Acta 2015, 1847, 1075–1084. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ferré, C.A.; Davezac, N.; Thouard, A.; Peyrin, J.M.; Belenguer, P.; Miguel, M.C.; Gonzalez-Dunia, D.; Szelechowski, M. Manipulation of the N-terminal sequence of the Borna disease virus X protein improves its mitochondrial targeting and neuroprotective potential. FASEB J. 2016, 30, 1523–1533. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rigobello, M.P.; Barzon, E.; Marin, O.; Bindoli, A. Effect of polycation peptides on mitochondrial permeability transition. Biochem. Biophys. Res. Commun. 1995, 217, 144–149. [Google Scholar] [CrossRef] [PubMed]
- Szelechowski, M.; Betourne, A.; Monnet, Y.; Ferre, C.A.; Thouard, A.; Foret, C.; Peyrin, J.M.; Hunot, S.; Gonzalez-Dunia, D. A viral peptide that targets mitochondria protects against neuronal degeneration in models of Parkinson’s disease. Nat. Commun. 2014, 5, 5181. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Szeto, H.H.; Liu, S.; Soong, Y.; Wu, D.; Darrah, S.F.; Cheng, F.Y.; Zhao, Z.; Ganger, M.; Tow, C.Y.; Seshan, S.V. Mitochondria-targeted peptide accelerates ATP recovery and reduces ischemic kidney injury. J. Am. Soc. Nephrol. 2011, 22, 1041–1052. [Google Scholar] [CrossRef] [PubMed]
- Zhao, K.; Zhao, G.M.; Wu, D.; Soong, Y.; Birk, A.V.; Schiller, P.W.; Szeto, H.H. Cell-permeable peptide antioxidants targeted to inner mitochondrial membrane inhibit mitochondrial swelling, oxidative cell death, and reperfusion injury. J. Biol. Chem. 2004, 279, 34682–34690. [Google Scholar] [CrossRef] [PubMed]
- Cerrato, C.P.; Pirisinu, M.; Vlachos, E.N.; Langel, Ü. Novel cell-penetrating peptide targeting mitochondria. FASEB J. 2015, 29, 4589–4599. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Anbanandam, A.; Albarado, D.C.; Tirziu, D.C.; Simons, M.; Veeraraghavan, S. Molecular basis for proline- and arginine-rich peptide inhibition of proteasome. J. Mol. Biol. 2008, 384, 219–227. [Google Scholar] [CrossRef] [PubMed]
- Gaczynska, M.; Osmulski, P.A.; Gao, Y.; Post, M.J.; Simons, M. Proline- and arginine-rich peptides constitute a novel class of allosteric inhibitors of proteasome activity. Biochemistry 2003, 42, 8663–8670. [Google Scholar] [CrossRef] [PubMed]
- Cameron, A.; Appel, J.; Houghten, R.A.; Lindberg, I. Polyarginines Are Potent Furin Inhibitors. J. Biol. Chem. 2000, 275, 36741–36749. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Fugere, M.; Appel, J.; Houghten, R.A.; Lindberg, I.; Day, R. Short polybasic peptide sequences are potent inhibitors of PC5/6 and PC7: Use of positional scanning-synthetic peptide combinatorial libraries as a tool for the optimization of inhibitory sequences. Mol. Pharmacol. 2007, 71, 323–332. [Google Scholar] [CrossRef] [PubMed]
- Kacprzak, M.M.; Peinado, J.R.; Than, M.E.; Appel, J.; Hanrich, S.; Lipkind, G.; Houghten, R.A.; Bode, W.; Lindberg, I. Inhibition of furin by polyarginine-containing peptides: Nanomolar inhibition by nona-D-arginine. J. Biol. Chem. 2004, 279, 36788–36794. [Google Scholar] [CrossRef] [PubMed]
- Tian, S.; Huang, Q.; Fang, Y.; Wu, J. FurinDB: A database of 20-residue furin cleavage site motifs, substrates and their associated drugs. Int. J. Mol. Sci. 2011, 12, 1060–1065. [Google Scholar] [CrossRef] [PubMed]
- Doeppner, T.R.; Kaltwasser, B.; Kuckelkorn, U.; Henkelein, P.; Bretschneider, E.; Kilic, E.; Hermann, D.M. Systemic Proteasome Inhibition Induces Sustained Post-stroke Neurological Recovery and Neuroprotection via Mechanisms Involving Reversal of Peripheral Immunosuppression and Preservation of Blood-Brain-Barrier Integrity. Mol. Neurobiol. 2016, 53, 6332–6341. [Google Scholar] [CrossRef] [PubMed]
- Wojcik, C.; di Napoli, M. Ubiquitin-proteasome system and proteasome inhibition: New strategies in stroke therapy. Stroke 2004, 35, 1506–1518. [Google Scholar] [CrossRef] [PubMed]
- Chen, W.; Hartman, R.; Ayer, R.; Maracantionio, S.; Kamper, J.; Tang, J.; Zhang, J.H. Matrix metalloproteinases inhibition provides neuroprotection against hypoxia-ischemia in the developing brain. J. Neurochem. 2009, 111, 726–736. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cunningham, L.A.; Wetzel, M.; Rosenberg, G.A. Multiple roles for MMPs and TIMPs in cerebral ischemia. Glia 2005, 50, 329–339. [Google Scholar] [CrossRef] [PubMed]
- Yang, Y.; Zhang, X.; Cui, H.; Zhang, C.; Zhu, C.; Li, L. Apelin-13 protects the brain against ischemia/reperfusion injury through activating PI3K/Akt and ERK1/2 signaling pathways. Neurosci. Lett. 2014, 568, 44–49. [Google Scholar] [CrossRef] [PubMed]
- Hilchie, A.L.; Wuerth, K.; Hancock, R.E.W. Immune modulation by multifaceted cationic host defense (antimicrobial) peptides. Nat. Chem. Biol. 2013, 9, 761–768. [Google Scholar] [CrossRef] [PubMed]
- Kellett, D.N. On the Anti-Inflammatory Activity of Protamine Sulphate and of Hexadimethrine Bromide, Inhibitors of Plasma Kinin Formation. Br. J. Pharmacol. Chemother. 1965, 24, 705–713. [Google Scholar] [CrossRef] [PubMed]
- Li, L.H.; Ju, T.C.; Hsieh, C.Y.; Dong, W.C.; Chen, W.T.; Hua, K.F.; Chen, W.J. A synthetic cationic antimicrobial peptide inhibits inflammatory response and the NLRP3 inflammasome by neutralizing LPS and ATP. PLoS ONE 2017, 12, e0182057. [Google Scholar] [CrossRef] [PubMed]
- Courderot-Masuyer, C.; Dalloz, F.; Maupoil, V.; Rochette, L. Antioxidant properties of aminoguanidine. Fundam. Clin. Pharmacol. 1999, 13, 535–540. [Google Scholar] [CrossRef] [PubMed]
- Yildiz, G.; Demiryürek, A.T.; Sahin-Erdemli, I.; Kanzik, I. Comparison of antioxidant activities of aminoguanidine, methylguanidine and guanidine by luminol-enhanced chemiluminescence. Br. J. Pharmacol. 1998, 124, 905–910. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lass, A.; Suessenbacher, A.; Wölkart, G.; Mayer, B.; Brunner, F. Functional and analytical evidence for scavenging of oxygen radicals by L-arginine. Mol. Pharmacol. 2002, 61, 1081–1088. [Google Scholar] [CrossRef] [PubMed]
- Mandal, S.M.; Bharti, R.; Porto, W.F.; Guari, S.S.; Mandal, M.; Franco, O.L.; Ghosh, A.K. Identification of multifunctional peptides from human milk. Peptides 2014, 56, 84–93. [Google Scholar] [CrossRef] [PubMed]
- Harari, O.A.; Liao, J.K. NF-κB and innate immunity in ischemic stroke. Ann. N. Y. Acad. Sci. 2010, 1207, 32–40. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- May, M.J.; Marienfeld, R.B.; Ghosh, S. Characterization of the Ikappa B-kinase NEMO binding domain. J. Biol. Chem. 2002, 277, 45992–46000. [Google Scholar] [CrossRef] [PubMed]
- Van den Tweel, E.R.; Kavelaars, A.; Lombardi, M.S.; Groenendaal, F.; May, M.; Heijnen, C.J.; van Bel, F. Selective inhibition of nuclear factor-kappaB activation after hypoxia/ischemia in neonatal rats is not neuroprotective. Pediatr. Res. 2006, 59, 232–236. [Google Scholar] [CrossRef] [PubMed]
- Nijboer, C.H.A.; Heijnen, C.J.; Groenendaal, F.; May, M.J.; van Bel, F.; Kavelaars, A. Strong neuroprotection by inhibition of NF-kappaB after neonatal hypoxia-ischemia involves apoptotic mechanisms but is independent of cytokines. Stroke 2008, 39, 2129–2137. [Google Scholar] [CrossRef] [PubMed]
- Nijboer, C.H.; Heijnen, C.J.; Groenendaal, F.; May, M.J.; van Bel, F.; Kavelaars, A. A dual role of the NF-kappaB pathway in neonatal hypoxic-ischemic brain damage. Stroke 2008, 39, 2578–2586. [Google Scholar] [CrossRef] [PubMed]
- Van der Kooij, M.A.; Nijboer, C.H.; Ohl, F.; Groenendaal, F.; Heijnen, C.J.; ven Bel, F.; Kavelaars, A. NF-kappaB inhibition after neonatal cerebral hypoxia-ischemia improves long-term motor and cognitive outcome in rats. Neurobiol. Dis. 2010, 38, 266–272. [Google Scholar] [CrossRef] [PubMed]
- Yang, D.; Syn, Y.Y.; Lin, X.; Baumann, J.M.; Dunn, R.S.; Lindquist, D.M.; Kaun, C.Y. Intranasal delivery of cell-penetrating anti-NF-κB peptides (Tat-NBD) alleviates infection-sensitized hypoxic-ischemic brain injury. Exp. Neurol. 2013, 247, 447–455. [Google Scholar] [CrossRef] [PubMed]
- Le Roy, D.; Di Padova, F.; Tees, R.; Lengacher, S.; Landmann, R.; Glauser, M.P.; Calandra, T.; Heumann, D. Monoclonal antibodies to murine lipopolysaccharide (LPS)-binding protein (LBP) protect mice from lethal endotoxemia by blocking either the binding of LPS to LBP or the presentation of LPS/LBP complexes to CD14. J. Immunol. 1999, 162, 7454–7460. [Google Scholar] [PubMed]
- Xu, W.; Wong, T.P.; Chery, N.; Gaertner, T.; Wang, Y.T.; Baudry, M. Calpain-Mediated mGluR1α Truncation: A Key Step in Excitotoxicity. Neuron 2007, 53, 399–412. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhou, M.; Xu, W.; Liao, G.; Bi, X.; Baudry, M. Neuroprotection against neonatal hypoxia/ischemia-induced cerebral cell death by prevention of calpain-mediated mGluR1alpha truncation. Exp. Neurol. 2009, 218, 75–82. [Google Scholar] [CrossRef] [PubMed]
- Borsello, T.; Croquelois, K.; Hornung, J.P.; Clarke, P.G. N-methyl-d-aspartate-triggered neuronal death in organotypic hippocampal cultures is endocytic, autophagic and mediated by the c-Jun N-terminal kinase pathway. Eur. J. Neurosci. 2003, 18, 473–485. [Google Scholar] [CrossRef] [PubMed]
- Gupta, S.; Barrett, T.; Whitmarch, A.J.; Cavanagh, J.; Sluss, H.K.; Derijard, B.; Davis, R.J. Selective interaction of JNK protein kinase isoforms with transcription factors. EMBO J. 1996, 15, 2760–2770. [Google Scholar] [PubMed]
- Wang, L.W.; Chang, Y.C.; Chen, S.J.; Tseng, C.H.; Tu, Y.F.; Liao, N.S.; Huang, C.C.; Ho, C.J. TNFR1-JNK signaling is the shared pathway of neuroinflammation and neurovascular damage after LPS-sensitized hypoxic-ischemic injury in the immature brain. J. Neuroinflamm. 2014, 11, 215. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ginet, V.; Puyal, J.; Magnin, G.; Clarke, P.G.H.; Truttmann, A.C. Limited role of the c-Jun N-terminal kinase pathway in a neonatal rat model of cerebral hypoxia-ischemia. J. Neurochem. 2009, 108, 552–562. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yang, D.D.; Kuan, C.Y.; Whitmarch, A.J.; Rincon, M.; Zheng, T.S.; Davis, R.J.; Rakic, P.; Flavell, R.A. Absence of excitotoxicity-induced apoptosis in the hippocampus of mice lacking the Jnk3 gene. Nature 1997, 389, 865–870. [Google Scholar] [CrossRef] [PubMed]
- Centeno, C.; Repici, M.; Chatton, J.Y.; Riederer, B.M.; Bonny, C.; Nicod, P.; Price, M.; Clarke, P.G.; Papa, S.; Franzoso, G.; Borsello, T. Role of the JNK pathway in NMDA-mediated excitotoxicity of cortical neurons. Cell Death Differ. 2007, 14, 240–253. [Google Scholar] [CrossRef] [PubMed]
- Nijboer, C.H.; van der Kooij, M.A.; van Bel, F.; Ohl, F.; Heijnen, C.J.; Kavelaars, A. Inhibition of the JNK/AP-1 pathway reduces neuronal death and improves behavioral outcome after neonatal hypoxic-ischemic brain injury. Brain. Behav. Immun. 2010, 24, 812–821. [Google Scholar] [CrossRef] [PubMed]
- Nijboer, C.H.; Bonestroo, H.J.C.; Zijlstra, J.; Kavelaars, A.; Heijnen, C.J. Mitochondrial JNK phosphorylation as a novel therapeutic target to inhibit neuroinflammation and apoptosis after neonatal ischemic brain damage. Neurobiol. Dis. 2013, 54, 432–444. [Google Scholar] [CrossRef] [PubMed]
- Shimizu, S.; Konishi, A.; Kodama, T.; Tsujimoto, Y. BH4 domain of antiapoptotic Bcl-2 family members closes voltage-dependent anion channel and inhibits apoptotic mitochondrial changes and cell death. Proc. Natl. Acad. Sci. USA 2000, 97, 3100–3105. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rong, Y.P.; Bultynck, G.; Aromolaran, A.S.; Zhong, F.; Parys, J.B.; De Smedt, H.; Mignery, G.A.; Roderick, H.L.; Bootman, M.D.; Distelhorst, C.W. The BH4 domain of Bcl-2 inhibits ER calcium release and apoptosis by binding the regulatory and coupling domain of the IP3 receptor. Proc. Natl. Acad. Sci. USA 2009, 106, 14397–14402. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Donnini, S.; Solito, R.; Monti, M.; Balduini, W.; Carloni, S.; Cimino, M.; Bampton, E.T.; Pinon, L.G.; Nicotera, P.; Thorpe, P.E.; Ziche, M. Prevention of ischemic brain injury by treatment with the membrane penetrating apoptosis inhibitor, TAT-BH4. Cell Cycle 2009, 8, 1271–1278. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Denhardt, D.T.; Guo, X. Osteopontin: A protein with diverse functions. FASEB J. 1993, 7, 1475–1482. [Google Scholar] [CrossRef] [PubMed]
- Schroeter, M.; Zickler, P.; Denhardt, D.T.; Hartung, H.-P.; Jander, S. Increased thalamic neurodegeneration following ischaemic cortical stroke in osteopontin-deficient mice. Brain 2006, 129, 1426–1437. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Doyle, K.P.; Yang, T.; Lessov, N.S.; Ciesielski, T.M.; Stevens, S.L.; Simon, R.P.; King, J.S.; Stenzel-Poore, M.P. Nasal administration of osteopontin peptide mimetics confers neuroprotection in stroke. J. Cereb. Blood Flow Metab. 2008, 28, 1235–1248. [Google Scholar] [CrossRef] [PubMed]
- Meller, R.; Stevens, S.L.; Minami, M.; Cameron, J.A.; King, S.; Rosenzweif, H.; Doyle, K.; Lessov, N.S.; Simon, R.P.; Stenzel-Poore, M.P. Neuroprotection by osteopontin in stroke. J. Cereb. Blood Flow Metab. 2005, 25, 217–225. [Google Scholar] [CrossRef] [PubMed]
- Jin, Y.; Kim, I.Y.; Kim, I.D.; Lee, H.K.; Park, J.Y.; Han, P.L.; Kim, K.K.; Choi, H.; Lee, J.K. Biodegradable gelatin microspheres enhance the neuroprotective potency of osteopontin via quick and sustained release in the post-ischemic brain. Acta Biomater. 2014, 10, 3126–3135. [Google Scholar] [CrossRef] [PubMed]
- Wu, B.; Ma, Q.; Suzuki, H.; Chen, C.; Liu, W.; Tang, J.; Zhang, J. Recombinant Osteopontin Attenuates Brain Injury after Intracerebral Hemorrhage in Mice. Neurocrit. Care 2011, 14, 109–117. [Google Scholar] [CrossRef] [PubMed]
- Jin, Y.C.; Lee, H.; Kim, S.W.; Kim, I.D.; Lee, H.K.; Lee, Y.; Han, P.L.; Lee, J.K. Intranasal Delivery of RGD Motif-Containing Osteopontin Icosamer Confers Neuroprotection in the Postischemic Brain via αvβ3 Integrin Binding. Mol. Neurobiol. 2016, 53, 5652–5663. [Google Scholar] [CrossRef] [PubMed]
- Das, R.; Mahabeleshwar, G.H.; Kundu, G.C. Osteopontin Stimulates Cell Motility and Nuclear Factor κB-mediated Secretion of Urokinase Type Plasminogen Activator through Phosphatidylinositol 3-Kinase/Akt Signaling Pathways in Breast Cancer Cells. J. Biol. Chem. 2003, 278, 28593–28606. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gary, D.S.; Milhavet, O.; Camandola, S.; Mattson, M.P. Essential role for integrin linked kinase in Akt-mediated integrin survival signaling in hippocampal neurons. J. Neurochem. 2003, 84, 878–890. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hwang, S.M.; Lopez, C.A.; Heck, D.E.; Gardner, C.R.; Laskin, D.L.; Laskin, J.D.; Denhardt, D.T. Osteopontin inhibits induction of nitric oxide synthase gene expression by inflammatory mediators in mouse kidney epithelial cells. J. Biol. Chem. 1994, 269, 711–715. [Google Scholar] [PubMed]
- Rollo, E.E.; Laskin, D.L.; Denhardt, D.T. Osteopontin inhibits nitric oxide production and cytotoxicity by activated RAW264.7 macrophages. J. Leukoc. Biol. 1996, 60, 397–404. [Google Scholar] [CrossRef] [PubMed]
- Chen, W.; Ma, Q.; Suzuki, H.; Hartman, R.; Tang, J.; Zhang, J.H. Osteopontin reduced hypoxia-ischemia neonatal brain injury by suppression of apoptosis in a rat pup model. Stroke 2011, 42, 764–769. [Google Scholar] [CrossRef] [PubMed]
- Albertsson, A.M.; Zhang, X.; Leavenworth, J.; Bi, D.; Nair, S.; Qiao, L.; Hagberg, H.; Mallard, C.; Cantor, H.; Wang, X. The effect of osteopontin and osteopontin-derived peptides on preterm brain injury. J. Neuroinflamm. 2014, 11, 197. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bonestroo, H.J.C.C.; Nijboer, C.H.; van Velthoven, C.T.J.J.; van Bel, F.; Heijnen, C.J. The Neonatal Brain Is Not Protected by Osteopontin Peptide Treatment after Hypoxia-Ischemia. Dev. Neurosci. 2015, 37, 142–152. [Google Scholar] [CrossRef] [PubMed]
- Zheng, Y.L.; Amin, N.D.; Hu, Y.F.; Rudrabhatla, P.; Shukla, V.; Kanungo, J.; Kesavapany, S.; Grant, P.; Albers, W.; Pant, H.C. A 24-Residue Peptide (p5), Derived from p35, the Cdk5 Neuronal Activator, Specifically Inhibits Cdk5-p25 Hyperactivity and Tau Hyperphosphorylation. J. Biol. Chem. 2010, 285, 34202–34212. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Su, S.C.; Tsai, L.-H. Cyclin-Dependent Kinases in Brain Development and Disease. Annu. Rev. Cell Dev. Biol. 2011, 27, 465–491. [Google Scholar] [CrossRef] [PubMed]
- Fischer, A.; Sananbenesi, F.; Pang, P.T.; Lu, B.; Tsai, L.-H. Opposing Roles of Transient and Prolonged Expression of p25 in Synaptic Plasticity and Hippocampus-Dependent Memory. Neuron 2005, 48, 825–838. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ji, Y.B.; Zhuang, P.P.; Ji, Z.; Wu, Y.M.; Gu, Y.; Gao, X.Y.; Pan, S.Y.; Hu, Y.F. TFP5 peptide, derived from CDK5-activating cofactor p35, provides neuroprotection in early-stage of adult ischemic stroke. Sci. Rep. 2017, 7, 40013. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shukla, V.; Zheng, Y.L.; Mishra, S.K.; Amin, N.D.; Steiner, J.; Grant, P.; Kesavapany, S.; Pant, H.C. A truncated peptide from p35, a Cdk5 activator, prevents Alzheimer’s disease phenotypes in model mice. FASEB J. 2013, 27, 174–186. [Google Scholar] [CrossRef] [PubMed]
- Binukumar, B.K.; Shukla, V.; Amin, N.D.; Grant, P.; Bhaskar, M.; Skuntz, S.; Steiner, J.; Pant, H.C. Peptide TFP5/TP5 derived from Cdk5 activator P35 provides neuroprotection in the MPTP model of Parkinson’s disease. Mol. Biol. Cell 2015, 26, 4478–4491. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tan, X.; Chen, Y.; Li, J.; Li, X.; Miao, Z.; Xin, N.; Zhu, J.; Ge, W.; Feng, Y.; Xu, X. The inhibition of Cdk5 activity after hypoxia/ischemia injury reduces infarct size and promotes functional recovery in neonatal rats. Neuroscience 2015, 290, 552–560. [Google Scholar] [CrossRef] [PubMed]
- Soriano, F.X.; Martel, M.A.; Papadia, S.; Vaslin, A.; Baxter, P.; Rickman, C.; Forder, J.; Tymianski, M.; Duncan, R.; Aarts, M.; et al. Specific targeting of pro-death NMDA receptor signals with differing reliance on the NR2B PDZ ligand. J. Neurosci. 2008, 28, 10696–10710. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, L.L.; Ginet, V.; Liu, X.; Vergun, O.; Tuittila, M.; Mathieu, M.; Bonny, C.; Puyal, J.; Truttmann, A.C.; Courtney, M.J. The nNOS-p38MAPK Pathway Is Mediated by NOS1AP during Neuronal Death. J. Neurosci. 2013, 33, 8185–8201. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ballarin, B.; Tymianski, M. Discovery and development of NA-1 for the treatment of acute ischemic stroke. Acta Pharmacol. Sin. 2018, 39, 661–668. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xu, B.; Xiao, A.J.; Chen, W.; Turlova, E.; Liu, R.; Barszcyk, A.; Sun, C.L.F.; Liu, L.; Tymianski, M.; Feng, Z.P.; et al. Neuroprotective Effects of a PSD-95 Inhibitor in Neonatal Hypoxic-Ischemic Brain Injury. Mol. Neurobiol. 2016, 53, 5962–5970. [Google Scholar] [CrossRef] [PubMed]
- Aono, M.; Bennett, E.R.; Kim, K.S.; Lynch, J.R.; Myers, J.; Pearlstein, R.D.; Warner, D.S.; Laskowitz, D.T. Protective effect of apolipoprotein E-mimetic peptides on N-methyl-D-aspartate excitotoxicity in primary rat neuronal-glial cell cultures. Neuroscience 2003, 116, 437–445. [Google Scholar] [CrossRef]
- Laskowitz, D.T.; Thekdi, A.D.; Thekdi, S.D.; Han, S.K.; Myers, J.K.; Pizzo, S.V.; Bennett, E.R. Downregulation of Microglial Activation by Apolipoprotein E and ApoE-Mimetic Peptides. Exp. Neurol. 2001, 167, 74–85. [Google Scholar] [CrossRef] [PubMed]
- Lynch, J.R.; Tang, W.; Wang, H.; Vitek, M.P.; Bennett, E.R.; Sullivan, P.M.; Warner, D.S.; Laskowitz, D.T. APOE Genotype and an ApoE-mimetic Peptide Modify the Systemic and Central Nervous System Inflammatory Response. J. Biol. Chem. 2003, 278, 48529–48533. [Google Scholar] [CrossRef] [PubMed]
- McAdoo, J.D.; Warner, D.S.; Goldberg, R.N.; Vitek, M.P.; Pearlstein, R.; Laskowitz, D.T. Intrathecal administration of a novel apoE-derived therapeutic peptide improves outcome following perinatal hypoxic-ischemic injury. Neurosci. Lett. 2005, 381, 305–308. [Google Scholar] [CrossRef] [PubMed]
- Misra, U.K.; Adlakha, C.L.; Gawdi, G.; McMillian, M.K.; Pizzo, S.V.; Laskowitz, D.T. Apolipoprotein E and mimetic peptide initiate a calcium-dependent signaling response in macrophages. J. Leukoc. Biol. 2001, 70, 677–683. [Google Scholar] [PubMed]
- Krysko, D.V.; Leybaert, L.; Vandenabeele, P.; D’Herde, K. Gap junctions and the propagation of cell survival and cell death signals. Apoptosis 2005, 10, 459–469. [Google Scholar] [CrossRef] [PubMed]
- Kondo, R.P.; Wang, S.-Y.; John, S.A.; Weiss, J.N.; Goldhaber, J.I. Metabolic Inhibition Activates a Non-selective Current Through Connexin Hemichannels in Isolated Ventricular Myocytes. J. Mol. Cell. Cardiol. 2000, 32, 1859–1872. [Google Scholar] [CrossRef] [PubMed]
- Decrock, E.; De Vuyst, E.; Vinken, M.; Van Moorhem, M.; Vranckx, K.; Wang, N.; Van Laeken, L.; De Brock, M.; D’Herde, K.; Lai, C.P.; et al. Connexin 43 hemichannels contribute to the propagation of apoptotic cell death in a rat C6 glioma cell model. Cell Death Differ. 2009, 16, 151–163. [Google Scholar] [CrossRef] [PubMed]
- Orellana, J.A.; Hernandez, D.E.; Ezan, P.; Velarde, V.; Bennett, M.V.; Giaume, C.; Saez, J.C. Hypoxia in high glucose followed by reoxygenation in normal glucose reduces the viability of cortical astrocytes through increased permeability of connexin 43 hemichannels. Glia 2010, 58, 329–343. [Google Scholar] [CrossRef] [PubMed]
- Ye, Z.-C.; Wyeth, M.S.; Baltan-Tekkok, S.; Ransom, B.R. Functional hemichannels in astrocytes: A novel mechanism of glutamate release. J. Neurosci. 2003, 23, 3588–3596. [Google Scholar] [CrossRef] [PubMed]
- Frantseva, M.V.; Kokarovtseva, L.; Naus, C.G.; Carlen, P.L.; MacFabe, D.; Velazquez, J.L.P. Specific gap junctions enhance the neuronal vulnerability to brain traumatic injury. J. Neurosci. 2002, 22, 644–653. [Google Scholar] [CrossRef] [PubMed]
- Frantseva, M.V.; Kokarovtseva, L.; Velazquez, J.L.P. Ischemia-Induced Brain Damage Depends on Specific Gap-Junctional Coupling. J. Cereb. Blood Flow Metab. 2002, 22, 453–462. [Google Scholar] [CrossRef] [PubMed]
- O’Carroll, S.J.; Alkadhi, M.; Nicholson, L.F.B.; Green, C.R. Connexin43 Mimetic Peptides Reduce Swelling, Astrogliosis, and Neuronal Cell Death after Spinal Cord Injury. Cell Commun. Adhes. 2008, 15, 27–42. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Davidson, J.O.; Green, C.R.; Nicholson, L.F.; O’Carroll, S.J.; Fraser, M.; Bennet, L.; Gunn, A.J. Connexin hemichannel blockade improves outcomes in a model of fetal ischemia. Ann. Neurol. 2012, 71, 121–132. [Google Scholar] [CrossRef] [PubMed]
- Davidson, J.O.; Green, C.R.; Nicholson, L.F.B.; Bennet, L.; Gunn, A.J. Connexin hemichannel blockade is neuroprotective after, but not during, global cerebral ischemia in near-term fetal sheep. Exp. Neurol. 2013, 248, 301–308. [Google Scholar] [CrossRef] [PubMed]
- Davidson, J.O.; Green, C.R.; Nicholson, L.F.B.; Bennet, L.; Gunn, A.J. Deleterious Effects of High Dose Connexin 43 Mimetic Peptide Infusion After Cerebral Ischaemia in Near-Term Fetal Sheep. Int. J. Mol. Sci. 2012, 13, 6303–6319. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Davidson, J.O.; Drury, P.P.; Green, C.R.; Nicholson, L.F.; Bennet, L.; Gunn, A.J. Connexin hemichannel blockade is neuroprotective after asphyxia in preterm fetal sheep. PLoS ONE 2014, 9, e96558. [Google Scholar] [CrossRef] [PubMed]
- Davidson, J.O.; Rout, A.L.; Wassink, G.; Yuill, C.A.; Zhang, F.G.; Green, C.R.; Benent, L.; Gunn, A.J. Non-Additive Effects of Delayed Connexin Hemichannel Blockade and Hypothermia after Cerebral Ischemia in Near-Term Fetal Sheep. J. Cereb. Blood Flow Metab. 2015, 35, 2052–2061. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, X.; Zhao, H.; Tan, X.; Kostrzewa, R.M.; Du, G.; Chen, Y.; Zhu, J.; Miao, Z.; Yu, H.; Kong, J.; et al. Inhibition of connexin43 improves functional recovery after ischemic brain injury in neonatal rats. Glia 2015, 63, 1553–1567. [Google Scholar] [CrossRef] [PubMed]
- Choe, W.; Albright, A.; Sulcove, J.; Jaffer, S.; Hesselgesser, J.; Lavi, E.; Crino, P.; Kolson, D.L. Functional expression of the seven-transmembrane HIV-1 co-receptor APJ in neural cells. J. Neurovirol. 2000, 6 (Suppl. 1), S61–S69. [Google Scholar] [PubMed]
- O’Carroll, A.-M.; Selby, T.L.; Palkovits, M.; Lolait, S.J. Distribution of mRNA encoding B78/apj, the rat homologue of the human APJ receptor, and its endogenous ligand apelin in brain and peripheral tissues. Biochim. Biophys. Acta Gene Struct. Expr. 2000, 1492, 72–80. [Google Scholar] [CrossRef]
- Zeng, X.J.; Yu, S.P.; Zhang, L.; Wei, L. Neuroprotective effect of the endogenous neural peptide apelin in cultured mouse cortical neurons. Exp. Cell Res. 2010, 316, 1773–1783. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cheng, B.; Chen, J.; Bai, B.; Xin, Q. Neuroprotection of apelin and its signaling pathway. Peptides 2012, 37, 171–173. [Google Scholar] [CrossRef] [PubMed]
- Ishimaru, Y.; Sumino, A.; Kajioka, D.; Shibagaki, F.; Yamamuro, A.; Yoshioka, Y.; Maeda, S. Apelin protects against NMDA-induced retinal neuronal death via an APJ receptor by activating Akt and ERK1/2, and suppressing TNF-α expression in mice. J. Pharmacol. Sci. 2017, 133, 34–41. [Google Scholar] [CrossRef] [PubMed]
- Gu, Q.; Zhai, L.; Feng, X.; Chen, J.; Miao, Z.; Ren, L.; Qian, X.; Yu, J.; Li, Y.; Xu, X.; et al. Apelin-36, a potent peptide, protects against ischemic brain injury by activating the PI3K/Akt pathway. Neurochem. Int. 2013, 63, 535–540. [Google Scholar] [CrossRef] [PubMed]
- Nijnik, A.; Madera, L.; Ma, S.; Waldbrook, M.; Elliott, M.R.; Easton, D.M.; Mayer, M.L.; Mullaly, S.C.; Kindrachuk, J.; Jenssen, H.; et al. Synthetic Cationic Peptide IDR-1002 Provides Protection against Bacterial Infections through Chemokine Induction and Enhanced Leukocyte Recruitment. J. Immunol. 2010, 184, 2539–2550. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wuerth, K.C.; Falsafi, R.; Hancock, R.E.W. Synthetic host defense peptide IDR-1002 reduces inflammation in Pseudomonas aeruginosa lung infection. PLoS ONE 2017, 12, e0187565. [Google Scholar] [CrossRef] [PubMed]
- Bolouri, H.; Savman, K.; Wang, W.; Thomas, A.; Maurer, N.; Dullaghan, E.; Fjell, C.D.; Ek, C.J.; Hagberg, H.; Hancock, R.E.; et al. Innate defense regulator peptide 1018 protects against perinatal brain injury. Ann. Neurol. 2014, 75, 395–410. [Google Scholar] [CrossRef] [PubMed]
- Bao, J.; Sato, K.; Li, M.; Gao, Y.; Abid, R.; Aird, W.; Simons, M.; Post, M.J. PR-39 and PR-11 peptides inhibit ischemia-reperfusion injury by blocking proteasome-mediated IκBα degradation. Am. J. Physiol. Circ. Physiol. 2001, 281, H2612–H2618. [Google Scholar] [CrossRef] [PubMed]
- Kloss, A.; Henklein, P.; Siele, D.; Schmolke, M.; Apcher, S.; Kuehn, L.; Sheppard, P.W.; Dahlmann, B. The cell-penetrating peptide octa-arginine is a potent inhibitor of proteasome activities. Eur. J. Pharm. Biopharm. 2009, 72, 219–225. [Google Scholar] [CrossRef] [PubMed]
- Zhou, N.; Fang, J.; Acheampong, E.; Mukhtar, M.; Pomerantz, R.J. Binding of ALX40-4C to APJ, a CNS-based receptor, inhibits its utilization as a co-receptor by HIV-1. Virology 2003, 312, 196–203. [Google Scholar] [CrossRef]
- le Gonidec, S.; Chaves-Almagro, C.; Bai, Y.; Kang, H.J.; Smith, A.; Wangecg, E.; Huang, X.P.; Prats, H.; Knibiehler, B.; Roth, B.L.; et al. Protamine is an antagonist of apelin receptor, and its activity is reversed by heparin. FASEB J. 2017, 31, 2507–2519. [Google Scholar] [CrossRef] [PubMed]
- Masri, B.; Morin, N.; Pedebernade, L.; Knibiehler, B.; Audigier, Y. The apelin receptor is coupled to Gi1 or Gi2 protein and is differentially desensitized by apelin fragments. J. Biol. Chem. 2006, 281, 18317–18326. [Google Scholar] [CrossRef] [PubMed]
- Sharifov, O.F.; Nayyar, G.; Ternovoy, V.V.; Mishra, V.K.; Litovsky, S.H.; Palgunachari, M.N.; Gerber, D.W.; Anantharamaiah, G.M.; Gupta, H. Cationic peptide mR18L with lipid lowering properties inhibits LPS-induced systemic and liver inflammation in rats. Biochem. Biophys. Res. Commun. 2013, 436, 705–710. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yoo, S.A.; Bae, D.G.; Ryoo, J.W.; Kim, H.R.; Park, G.S.; Cho, C.S.; Chae, C.B.; Kim, W.U. Arginine-rich anti-vascular endothelial growth factor (anti-VEGF) hexapeptide inhibits collagen-induced arthritis and VEGF-stimulated productions of TNF-alpha and IL-6 by human monocytes. J. Immunol. 2005, 174, 5846–5855. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.Y.; Suh, J.S.; Kim, J.M.; Kim, J.H.; Park, H.J.; Park, Y.J.; Chung, C.P. Identification of a cell-penetrating peptide domain from human beta-defensin 3 and characterization of its anti-inflammatory activity. Int. J. Nanomed. 2015, 10, 5423–5434. [Google Scholar]
Peptide/Protein Name; Net Charge a | Proposed Target b | Peptide Sequence c | Injury Model d | Route & Time before/after HI Agent Administered e | Dose | NP f | Study |
---|---|---|---|---|---|---|---|
TAT-NBD; +6 | NFκB | TAT-TALDWSWLQTE | P7 (W): CCAO/8% O2; 120 min | IP: 0 & 3 h, or 0, 3, 6, 9 or 12 h | 6917 nmol/kg | Yes, up to 6 h | [105] |
IP: 0 & 3 h, or 0, 9 & 12 h, or 18 & 21 h | 6817 nmol/kg | Yes, only for 0 & 3 h | [106] | ||||
IP: 0 & 3 h | 6818 nmol.kg | Yes | [107] | ||||
P7 (W): CCAO/10% O2; 90 min + LPS 4 or 72 h before hypoxia | IN; 10 min | 477 nmol/kg | Yes, only for LPS | [108] | |||
TAT-mGluR1; +3 | Calpain | TAT-VIKPLTKSYQGSGK | P7 (SD): CCAO/8% O2; 150 min | IP: −1 h | 58,590 nmol/kg | Yes | [111] |
D-JNKI-1; +4 | JIP | tdqsrpvqpflnlttprkpr-NH2 | P7 (SD): CCAO/8% O2; 120 min | IP, −0.5, 3, 5, 8, 12 and 20 h | 76 nmol/kg | No | [115] |
JNKI-1-TATL; +12 | TAT-PPRPKRPTTLNLFPQVPRSQDT-NH2 | P7 (W): CCAO/8% O2; 120 min | IP: 0 and 3 h, or 3 h or 6 h | 2446 nmol/kg | Yes, except 6 h | [118] | |
JNKI-1-TATD; +12 SabKIM1 +7 | tdqsrpvqpflnlttprkpr-pp-tat-NH2 lpsvfgdvgapsrlpevsls-pp-tat | P7 (W): CCAO/8% O2; 120 min | IP: 0, 3 or 6 h, or 0 & 3 h IP: 0 h | 2616 nmol/kg 2777 or 5555 nmol/kg | Yes except 0 & 3 h Yes | [119] | |
JNKI-1-TATD; +12 | tdqsrpvqpflnlttprkpr-pp-tat-NH2 | P7 (SD): ECA/CCAO/8% O2; 150 min | IP: 0 min | 1000 nmol/kg | No | [22] | |
TAT-BH4; +2.1 | Apoptosis | TAT-RTGYDNREIVMKYIHYKLSQRGYEW | P7 (SD♂): CCAO/8% O2; 150 min | ICV: −0.5 h | 5 µL/20 ng | Yes | [122] |
T-OPN OPN134–153; 0 OPN154–198; −4.9 | αvβ3 integrin receptor | Thrombin cleaved OPN IVPTVDVPNGRGDSLAYR SKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSM | P5 (C57B6/6J): CCAO/10% O2; 70 min | IN: −70 min IN or ICV: −70 min ICV: −70 min | 1.2 µg IN: 30 µg/ICV: 0.2 µg 0.5 µg | No | [135] |
TAT-OPN; +8 | TAT-IVPTVDVPNGRGDSLAYGLR | P9 (C57BL/6N): CCAO/10% O2; 50 min | IN: 0 h or 0 & 3 h, or 0, 3 h, 1, 2 & 3 d IP: 0 h, or 5, 7, 9, 11, 13, 15 d, or 0, 1, 3, 5, 7, 9, 11, 13, 15 d ICV: 1 h | 350 or 2100 ng 2746 nmol/kg 100 ng | No | [136] | |
P5-TAT; +8.9 | P35 | KEAFWDRCLSVINLMSSKMLQINA-TAT | P7 (SD): CCAO/8% O2; 150 min | IP: −1 h IP: 24 h | 0.23, 2.3, 5.76, or 11.5 nmol/kg 11.5 nmol/kg | Yes, except 0.23 nmol/kg | [143] |
D-TAT-GESV; +7 | NOS | ygrkkrrqrrr-GESV | P7 (SD♂); CCAO/8% O2; 120 min | ICV: −120 min | 100 ng/animal | Yes | [145] |
TAT-NR2B9c; +7 | PSD-95 | TAT-KLSSIESDV | P7 (CD1): CCAO/7.5%; 60 min | IP: −110 or −20 min | 3000 nmol/kg | Yes | [147] |
R18; +18 R18D; +18 | Multiple | RRRRRRRRRRRRRRRRRR rrrrrrrrrrrrrrrrrr | P7 (SD): ECA/CCAO/8% O2; 150 min | IP: 0 h | 30, 100, 300 or 1000 nmol/kg | Yes | [22] |
R18D; +18 | rrrrrrrrrrrrrrrrrr | IP: +0.5 h IP: +1 h IP: +1.5 h | 10, 30, 100, 300 or 1000 nmol/kg 30 or 300 nmol/kg 30 or 300 nmol/kg | Yes, except 100 nmol/kg Yes, except 300 nmol/kg No | [21] | ||
COG133; 5.1 | LDLR | Ac-TEELRVRLASHLRKLRKRLL-NH2 | P7 (W): CCAO/8% O2; 150 min | ICV: −0 h | 40, 200, 300, 400, or 2000 nmol/kg | Yes, except 300 nmol/kg | [151] |
Peptide 5; +1 | Cx43 astrocytic hemichannel | VDKFLSRPTEKT | GD128 (Romney/Suffolk sheep): bilateral tCCAO; 30 min | ICV: 1.5 h | 50,000 nmol/kg/h for 1 h ± 50,000 nmol/kg/24 h for 24 h | Yes | [161] |
ICV: −1 h or 0 h | 50,000 nmol/kg/h: 1 h + 50,000 nmol/kg/24 h for 24 h | Yes, except −1 h | [162] | ||||
ICV: 0 h | 50,000 nmol/kg/h: 1 h + 50,000 nmol/kg/24 h for 24 h 50,000 nmol/kg/h for 25 h | Yes, except high continuous dose | [163] | ||||
ICV: 3 h ± Hypothermia: 32 °C for 72 h; 3 h after tCCAO | 50,000 nmol/kg/h for 1 h + 50,000 nmol/kg/24 h for 24 h | Yes, no additive effect | [165] | ||||
GD103 (Romney/Suffolk sheep): bilateral tCCAO for 25 min | ICV: 1.5 h | 50,000 nmol/kg/h for 1 h + 50,000 nmol/kg/24 h for 24 h | Yes | [164] | |||
Gap 26; +1 Gap 27; +1 | VCYDKSFPISHVR SRPTEKTIFII | P7 (SD): CCAO/8% O2; 150 min | IP: −1 h IP: daily for 1 to 7 d IP: −1 h | 0.64, 3.22, 6.44, 16.1, or 32.2 nmol/kg 32.2 nmol/kg 16.1 nmol/kg | Yes, except 0.64 and 3.22 nmol/kg Yes | [166] | |
Apelin-36; +10.1 | Apelin receptor | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | P7 (SD): CCAO8% O2; 150 min | IP: −1 h | 240 nmol/kg | Yes | [172] |
IDR-1018; +5 | Immune modulation | VRLIVAVRIWRR-NH2 | P9 (C57BL/6J): CCAO/10% O2; 20 min + LPS 14 h before hypoxia | IP: −4 h or 3 h | 5208 nmol/kg | Yes | [175] |
© 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Edwards, A.B.; Anderton, R.S.; Knuckey, N.W.; Meloni, B.P. Perinatal Hypoxic-Ischemic Encephalopathy and Neuroprotective Peptide Therapies: A Case for Cationic Arginine-Rich Peptides (CARPs). Brain Sci. 2018, 8, 147. https://doi.org/10.3390/brainsci8080147
Edwards AB, Anderton RS, Knuckey NW, Meloni BP. Perinatal Hypoxic-Ischemic Encephalopathy and Neuroprotective Peptide Therapies: A Case for Cationic Arginine-Rich Peptides (CARPs). Brain Sciences. 2018; 8(8):147. https://doi.org/10.3390/brainsci8080147
Chicago/Turabian StyleEdwards, Adam B., Ryan S. Anderton, Neville W. Knuckey, and Bruno P. Meloni. 2018. "Perinatal Hypoxic-Ischemic Encephalopathy and Neuroprotective Peptide Therapies: A Case for Cationic Arginine-Rich Peptides (CARPs)" Brain Sciences 8, no. 8: 147. https://doi.org/10.3390/brainsci8080147
APA StyleEdwards, A. B., Anderton, R. S., Knuckey, N. W., & Meloni, B. P. (2018). Perinatal Hypoxic-Ischemic Encephalopathy and Neuroprotective Peptide Therapies: A Case for Cationic Arginine-Rich Peptides (CARPs). Brain Sciences, 8(8), 147. https://doi.org/10.3390/brainsci8080147