New Insight into Antimicrobial Compounds from Food and Marine-Sourced Carnobacterium Species through Phenotype and Genome Analyses
Abstract
1. Introduction
2. Materials and Methods
2.1. Carnobacterium spp. Public Genome Dataset
2.2. EBP3019, SF668, and MIP2551 Genome Sequencing and Automatic Annotation
2.3. BGC Prediction
2.4. Carnobacterium spp. Strains, Growth Conditions, and Identification
2.5. Spot-on Lawn Assays
2.6. Hydrogen Peroxide Quantification
2.7. Peptidic Activity of Cell-Free Supernatants (CFSs)
2.8. Nucleotide Sequence Accession Number
3. Results
3.1. BGC content comparison in Carnobacterium species
3.1.1. Carnobacterium spp. genome dataset
3.1.2. Diversity of Antimicrobial BGCs
3.2. Antimicrobial Activities of Carnobacterium spp. Isolated from Seafood Products
3.2.1. Inhibition profiles of Carnobacterium spp. strains
3.2.2. Involvement of H2O2 Inhibition
3.2.3. Comparison of CFSs Activities
3.3. MIP2551, EBP3019, and SF668 Genome Specificities
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Kathiresan, K.; Thiruneelakandan, G. Prospects of lactic acid bacteria of marine origin. Indian J. Biotechnol. 2008, 7, 170–177. [Google Scholar]
- Lindgren, S.E.; Dobrogosz, W.J. Antagonistic activities of lactic acid bacteria in food and feed fermentations. FEMS Microbiol. Rev. 1990, 7, 149–163. [Google Scholar] [CrossRef] [PubMed]
- Piard, J.C.; Desmazeaud, M. Inhibiting factors produced by lactic acid bacteria. 1. Oxygen metabolites and catabolism end-products. Le Lait 1991, 71, 525–541. [Google Scholar] [CrossRef]
- Vuyst, L.D.; Leroy, F. Bacteriocins from Lactic Acid Bacteria: Production, Purification, and Food Applications. J. Mol. Microbiol. Biotechnol. 2007, 13, 194–199. [Google Scholar] [CrossRef] [PubMed]
- Zacharof, M.P.; Lovitt, R.W. Bacteriocins Produced by Lactic Acid Bacteria a Review Article. APCBEE Procedia 2012, 2, 50–56. [Google Scholar] [CrossRef]
- Perez, R.H.; Zendo, T.; Sonomoto, K. Circular and Leaderless Bacteriocins: Biosynthesis, Mode of Action, Applications, and Prospects. Front. Microbiol. 2018, 9, 2085. [Google Scholar] [CrossRef]
- Mohr, K.I.; Volz, C.; Jansen, R.; Wray, V.; Hoffmann, J.; Bernecker, S.; Wink, J.; Gerth, K.; Stadler, M.; Müller, R. Pinensins: The First Antifungal Lantibiotics. Angew. Chem. Int. Ed. 2015, 54, 11254–11258. [Google Scholar] [CrossRef]
- Dykes, G.A. Bacteriocins: Ecological and evolutionary significance. Trends Ecol. Evol. 1995, 10, 186–189. [Google Scholar] [CrossRef]
- Riley, M.A.; Wertz, J.E. Bacteriocins: Evolution, Ecology, and Application. Annu. Rev. Microbiol. 2002, 56, 117–137. [Google Scholar] [CrossRef]
- Klaenhammer, T.R. Genetics of bacteriocins produced by lactic acid bacteria. FEMS Microbiol. Rev. 1993, 12, 39–85. [Google Scholar] [CrossRef]
- Cotter, P.D.; Ross, R.P.; Hill, C. Bacteriocins—A viable alternative to antibiotics? Nat. Rev. Microbiol. 2013, 11, 95–105. [Google Scholar] [CrossRef] [PubMed]
- Heng, N.C.K.; Tagg, J.R. What’s in a name? Class distinction for bacteriocins. Nat. Rev. Microbiol. 2006, 4, 160. [Google Scholar] [CrossRef]
- Arnison, P.G.; Bibb, M.J.; Bierbaum, G.; Bowers, A.A.; Bugni, T.S.; Bulaj, G.; Camarero, J.A.; Campopiano, D.J.; Challis, G.L.; Clardy, J.; et al. Ribosomally synthesized and post-translationally modified peptide natural products: Overview and recommendations for a universal nomenclature. Nat. Prod. Rep. 2013, 30, 108–160. [Google Scholar] [CrossRef] [PubMed]
- Golomb, B.L.; Yu, A.O.; Coates, L.C.; Marco, M.L. The Lactococcus lactis KF147 nonribosomal peptide synthetase/polyketide synthase system confers resistance to oxidative stress during growth on plant leaf tissue lysate. Microbiology Open 2018, 7, e00531. [Google Scholar] [CrossRef]
- Lin, X.B.; Lohans, C.T.; Duar, R.; Zheng, J.; Vederas, J.C.; Walter, J.; Gänzle, M. Genetic determinants of reutericyclin biosynthesis in Lactobacillus reuteri. Appl. Environ. Microbiol. 2015, 81, 2032–2041. [Google Scholar] [CrossRef]
- Luo, Y.; Cobb, R.E.; Zhao, H. Recent Advances in Natural Product Discovery. Curr. Opin. Biotechnol. 2014, 30, 230–237. [Google Scholar] [CrossRef]
- Medema, M.H.; Fischbach, M.A. Computational approaches to natural product discovery. Nat. Chem. Biol. 2015, 11, 639–648. [Google Scholar] [CrossRef]
- Ziemert, N.; Alanjary, M.; Weber, T. The evolution of genome mining in microbes—A review. Nat. Prod. Rep. 2016, 33, 988–1005. [Google Scholar] [CrossRef]
- Passerini, D.; Beltramo, C.; Coddeville, M.; Quentin, Y.; Ritzenthaler, P.; Daveran-Mingot, M.-L.; Bourgeois, P.L. Genes but Not Genomes Reveal Bacterial Domestication of Lactococcus Lactis. PLoS ONE 2010, 5, e15306. [Google Scholar] [CrossRef]
- Iskandar, C.F.; Borges, F.; Taminiau, B.; Daube, G.; Zagorec, M.; Remenant, B.; Leisner, J.J.; Hansen, M.A.; Sørensen, S.J.; Mangavel, C.; et al. Comparative Genomic Analysis Reveals Ecological Differentiation in the Genus Carnobacterium. Front. Microbiol. 2017, 8. [Google Scholar] [CrossRef]
- Almeida, E.L.; Carrillo Rincón, A.F.; Jackson, S.A.; Dobson, A.D.W. Comparative Genomics of Marine Sponge-Derived Streptomyces spp. Isolates SM17 and SM18 With Their Closest Terrestrial Relatives Provides Novel Insights Into Environmental Niche Adaptations and Secondary Metabolite Biosynthesis Potential. Front. Microbiol. 2019, 10, 1713. [Google Scholar] [CrossRef]
- Blunt, J.W.; Carroll, A.R.; Copp, B.R.; Davis, R.A.; Keyzers, R.A.; Prinsep, M.R. Marine natural products. Nat. Prod. Rep. 2018, 35, 8–53. [Google Scholar] [CrossRef] [PubMed]
- Andryukov, B.G.; Mikhaylov, V.V.; Besednova, N.N.; Zaporozhets, T.S.; Bynina, M.P.; Matosova, E.V. The Bacteriocinogenic Potential of Marine Microorganisms. Russ. J. Mar. Biol. 2018, 44, 433–441. [Google Scholar] [CrossRef]
- Leisner, J.J.; Laursen, B.G.; Prévost, H.; Drider, D.; Dalgaard, P. Carnobacterium: Positive and negative effects in the environment and in foods. FEMS Microbiol. Rev. 2007, 31, 592–613. [Google Scholar] [CrossRef] [PubMed]
- Brillet, A.; Pilet, M.-F.; Prevost, H.; Bouttefroy, A.; Leroi, F. Biodiversity of Listeria monocytogenes sensitivity to bacteriocin-producing Carnobacterium strains and application in sterile cold-smoked salmon. J. Appl. Microbiol. 2004, 97, 1029–1037. [Google Scholar] [CrossRef]
- Hammi, I.; Delalande, F.; Belkhou, R.; Marchioni, E.; Cianferani, S.; Ennahar, S. Maltaricin CPN, a new class IIa bacteriocin produced by Carnobacterium maltaromaticum CPN isolated from mould-ripened cheese. J. Appl. Microbiol. 2016, 121, 1268–1274. [Google Scholar] [CrossRef]
- Wiernasz, N.; Cornet, J.; Cardinal, M.; Pilet, M.-F.; Passerini, D.; Leroi, F. Lactic Acid Bacteria Selection for Biopreservation as a Part of Hurdle Technology Approach Applied on Seafood. Front. Mar. Sci. 2017, 4. [Google Scholar] [CrossRef]
- Jöborn, A.; Dorsch, M.; Olsson, J.C.; Westerdahl, A.; Kjelleberg, S. Carnobacterium inhibens sp. nov., isolated from the intestine of Atlantic salmon (Salmo salar). Int. J. Syst. Evol. Microbiol. 1999, 49, 1891–1898. [Google Scholar] [CrossRef]
- Rafiq, M.; Hayat, M.; Anesio, A.M.; Jamil, S.U.U.; Hassan, N.; Shah, A.A.; Hasan, F. Recovery of metallo-tolerant and antibiotic resistant psychrophilic bacteria from Siachen glacier, Pakistan. PLoS ONE 2017, 12. [Google Scholar] [CrossRef]
- Remenant, B.; Borges, F.; Cailliez-Grimal, C.; Revol-Junelles, A.-M.; Marché, L.; Lajus, A.; Médigue, C.; Pilet, M.-F.; Prévost, H.; Zagorec, M. Draft Genome Sequence of Carnobacterium divergens V41, a Bacteriocin-Producing Strain. Genome Announc. 2016, 4, e01109-16. [Google Scholar] [CrossRef]
- Edgar, R.C. MUSCLE: Multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef] [PubMed]
- Tamura, K.; Stecher, G.; Peterson, D.; Filipski, A.; Kumar, S. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Mol. Biol. Evol. 2013, 30, 2725–2729. [Google Scholar] [CrossRef] [PubMed]
- Yoon, S.-H.; Ha, S.-M.; Lim, J.; Kwon, S.; Chun, J. A large-scale evaluation of algorithms to calculate average nucleotide identity. Antonie Van Leeuwenhoek 2017, 110, 1281–1286. [Google Scholar] [CrossRef] [PubMed]
- Bankevich, A.; Nurk, S.; Antipov, D.; Gurevich, A.A.; Dvorkin, M.; Kulikov, A.S.; Lesin, V.M.; Nikolenko, S.I.; Pham, S.; Prjibelski, A.D.; et al. SPAdes: A New Genome Assembly Algorithm and Its Applications to Single-Cell Sequencing. J. Comput. Biol. 2012, 19, 455–477. [Google Scholar] [CrossRef] [PubMed]
- Vallenet, D.; Belda, E.; Calteau, A.; Cruveiller, S.; Engelen, S.; Lajus, A.; Le Fèvre, F.; Longin, C.; Mornico, D.; Roche, D.; et al. MicroScope--an integrated microbial resource for the curation and comparative analysis of genomic and metabolic data. Nucleic Acids Res. 2013, 41, D636–D647. [Google Scholar] [CrossRef]
- Aziz, R.K.; Bartels, D.; Best, A.A.; DeJongh, M.; Disz, T.; Edwards, R.A.; Formsma, K.; Gerdes, S.; Glass, E.M.; Kubal, M.; et al. The RAST Server: Rapid Annotations using Subsystems Technology. BMC Genomics 2008, 9, 75. [Google Scholar] [CrossRef]
- Taniai, H.; Iida, K.; Seki, M.; Saito, M.; Shiota, S.; Nakayama, H.; Yoshida, S. Concerted Action of Lactate Oxidase and Pyruvate Oxidase in Aerobic Growth of Streptococcus pneumoniae: Role of Lactate as an Energy Source. J. Bacteriol. 2008, 190, 3572–3579. [Google Scholar] [CrossRef]
- 3Streitenberger, S.A.; López-Mas, J.A.; Sánchez-Ferrer, A.; García-Carmona, F. Highly efficient Aerococcus viridans L -α-glycerophosphate oxidase production in the presence of H2O2-decomposing agent: Purification and kinetic characterization. Appl. Microbiol. Biotechnol. 2001, 57, 329–333. [Google Scholar] [CrossRef]
- Blin, K.; Wolf, T.; Chevrette, M.G.; Lu, X.; Schwalen, C.J.; Kautsar, S.A.; Suarez Duran, H.G.; de Los Santos, E.L.C.; Kim, H.U.; Nave, M.; et al. antiSMASH 4.0-improvements in chemistry prediction and gene cluster boundary identification. Nucleic Acids Res. 2017, 45, W36–W41. [Google Scholar] [CrossRef]
- van Heel, A.J.; de Jong, A.; Song, C.; Viel, J.H.; Kok, J.; Kuipers, O.P. BAGEL4: A user-friendly web server to thoroughly mine RiPPs and bacteriocins. Nucleic Acids Res. 2018, 46, W278–W281. [Google Scholar] [CrossRef]
- Carver, T.; Harris, S.R.; Berriman, M.; Parkhill, J.; McQuillan, J.A. Artemis: An integrated platform for visualization and analysis of high-throughput sequence-based experimental data. Bioinformatics 2012, 28, 464–469. [Google Scholar] [CrossRef] [PubMed]
- Gabrielsen, C.; Brede, D.A.; Nes, I.F.; Diep, D.B. Circular Bacteriocins: Biosynthesis and Mode of Action. Appl. Environ. Microbiol. 2014, 80, 6854–6862. [Google Scholar] [CrossRef] [PubMed]
- Peri, S.; Steen, H.; Pandey, A. GPMAW—A software tool for analyzing proteins and peptides. Trends Biochem. Sci. 2001, 26, 687–689. [Google Scholar] [CrossRef]
- Nielsen, H.; Tsirigos, K.D.; Brunak, S.; von Heijne, G. A Brief History of Protein Sorting Prediction. Protein J. 2019, 38, 200–216. [Google Scholar] [CrossRef]
- Navarro-Muñoz, J.C.; Selem-Mojica, N.; Mullowney, M.W.; Kautsar, S.A.; Tryon, J.H.; Parkinson, E.I.; De Los Santos, E.L.C.; Yeong, M.; Cruz-Morales, P.; Abubucker, S.; et al. A computational framework to explore large-scale biosynthetic diversity. Nat. Chem. Biol. 2019, 16, 60–68. [Google Scholar] [CrossRef]
- Matamoros, S.; Pilet, M.F.; Gigout, F.; Prévost, H.; Leroi, F. Selection and evaluation of seafood-borne psychrotrophic lactic acid bacteria as inhibitors of pathogenic and spoilage bacteria. Food Microbiol. 2009, 26, 638–644. [Google Scholar] [CrossRef] [PubMed]
- Fall, P.A.; Leroi, F.; Chevalier, F.; Guérin, C.; Pilet, M.-F. Protective Effect of a Non-Bacteriocinogenic Lactococcus piscium CNCM I-4031 Strain Against Listeria monocytogenes in Sterilized Tropical Cooked Peeled Shrimp. J. Aquat. Food Prod. Technol. 2010, 19, 84–92. [Google Scholar] [CrossRef]
- Metivier, A.; Pilet, M.-F.; Dousset, X.; Sorokine, O.; Anglade, P.; Zagorec, M.; Piard, J.-C.; Marlon, D.; Cenatiempo, Y.; Fremaux, C. Divercin V41, a new bacteriocin with two disulphide bonds produced by Carnobacterium divergens V41: Primary structure and genomic organization. Microbiology 1998, 144, 2837–2844. [Google Scholar] [CrossRef]
- Wang, K.C.; Ohnuma, S. Isoprenyl diphosphate synthases. Biochim. Biophys. Acta BBA - Mol. Cell Biol. Lipids 2000, 1529, 33–48. [Google Scholar] [CrossRef]
- Tsuchiya, T.; Takaichi, S.; Misawa, N.; Maoka, T.; Miyashita, H.; Mimuro, M. The cyanobacterium Gloeobacter violaceus PCC 7421 uses bacterial-type phytoene desaturase in carotenoid biosynthesis. FEBS Lett. 2005, 579, 2125–2129. [Google Scholar] [CrossRef]
- Gao, P.; Davies, J.; Kao, R. Dehydrosqualene Desaturase as a Novel Target for Anti-Virulence Therapy against Staphylococcus aureus. mBio 2017, 8, e01224-17. [Google Scholar] [CrossRef] [PubMed]
- Challis, G.L.; Naismith, J.H. Structural aspects of non-ribosomal peptide biosynthesis. Curr. Opin. Struct. Biol. 2004, 14, 748–756. [Google Scholar] [CrossRef] [PubMed]
- Copp, J.N.; Neilan, B.A. The Phosphopantetheinyl Transferase Superfamily: Phylogenetic Analysis and Functional Implications in Cyanobacteria. Appl. Environ. Microbiol. 2006, 72, 2298–2305. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Tulini, F.L.; Lohans, C.T.; Bordon, K.C.F.; Zheng, J.; Arantes, E.C.; Vederas, J.C.; De Martinis, E.C.P. Purification and characterization of antimicrobial peptides from fish isolate Carnobacterium maltaromaticum C2: Carnobacteriocin X and carnolysins A1 and A2. Int. J. Food Microbiol. 2014, 173, 81–88. [Google Scholar] [CrossRef] [PubMed]
- Martin-Visscher, L.A.; van Belkum, M.J.; Garneau-Tsodikova, S.; Whittal, R.M.; Zheng, J.; McMullen, L.M.; Vederas, J.C. Isolation and characterization of carnocyclin a, a novel circular bacteriocin produced by Carnobacterium maltaromaticum UAL307. Appl. Environ. Microbiol. 2008, 74, 4756–4763. [Google Scholar] [CrossRef] [PubMed]
- Quadri, L.E.; Sailer, M.; Roy, K.L.; Vederas, J.C.; Stiles, M.E. Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B. J. Biol. Chem. 1994, 269, 12204–12211. [Google Scholar]
- Jack, R.W.; Wan, J.; Gordon, J.; Harmark, K.; Davidson, B.E.; Hillier, A.J.; Wettenhall, R.E.; Hickey, M.W.; Coventry, M.J. Characterization of the chemical and antimicrobial properties of piscicolin 126, a bacteriocin produced by Carnobacterium piscicola JG126. Appl. Environ. Microbiol. 1996, 62, 2897–2903. [Google Scholar] [CrossRef]
- Acedo, J.Z.; Towle, K.M.; Lohans, C.T.; Miskolzie, M.; McKay, R.T.; Doerksen, T.A.; Vederas, J.C.; Martin-Visscher, L.A. Identification and three-dimensional structure of carnobacteriocin XY, a class IIb bacteriocin produced by Carnobacteria. FEBS Lett. 2017, 591, 1349–1359. [Google Scholar] [CrossRef]
- Worobo, R.W.; Van Belkum, M.J.; Sailer, M.; Roy, K.L.; Vederas, J.C.; Stiles, M.E. A signal peptide secretion-dependent bacteriocin from Carnobacterium divergens. J. Bacteriol. 1995, 177, 3143–3149. [Google Scholar] [CrossRef]
- Sánchez, J.; Diep, D.B.; Herranz, C.; Nes, I.F.; Cintas, L.M.; Hernández, P.E. Amino acid and nucleotide sequence, adjacent genes, and heterologous expression of hiracin JM79, a sec-dependent bacteriocin produced by Enterococcus hirae DCH5, isolated from Mallard ducks (Anas platyrhynchos). FEMS Microbiol. Lett. 2007, 270, 227–236. [Google Scholar] [CrossRef]
- Cui, Y.; Zhang, C.; Wang, Y.; Shi, J.; Zhang, L.; Ding, Z.; Qu, X.; Cui, H. Class IIa Bacteriocins: Diversity and New Developments. Int. J. Mol. Sci. 2012, 13, 16668–16707. [Google Scholar] [CrossRef] [PubMed]
- Snauwaert, I.; Hoste, B.; De Bruyne, K.; Peeters, K.; De Vuyst, L.; Willems, A.; Vandamme, P. Carnobacterium iners sp. nov., a psychrophilic, lactic acid-producing bacterium from the littoral zone of an Antarctic pond. Int. J. Syst. Evol. Microbiol. 2013, 63, 1370–1375. [Google Scholar] [CrossRef] [PubMed]
- Zhu, S.; Lin, D.; Xiong, S.; Wang, X.; Xue, Z.; Dong, B.; Shen, X.; Ma, X.; Chen, J.; Yang, J. Carnobacterium antarcticum sp. nov., a psychrotolerant, alkaliphilic bacterium isolated from sandy soil in Antarctica. Int. J. Syst. Evol. Microbiol. 2018, 68, 1672–1677. [Google Scholar] [CrossRef] [PubMed]
- Bhugaloo-Vial, P.; Dousset, X.; Metivier, A.; Sorokine, O.; Anglade, P.; Boyaval, P.; Marion, D. Purification and amino acid sequences of piscicocins V1a and V1b, two class IIa bacteriocins secreted by Carnobacterium piscicola V1 that display significantly different levels of specific inhibitory activity. Appl. Environ. Microbiol. 1996, 62, 4410–4416. [Google Scholar] [CrossRef] [PubMed]
- Miescher, S.; Stierli, M.P.; Teuber, M.; Meile, L. Propionicin SM1, a Bacteriocin from Propionibacterium jensenii DF1: Isolation and Characterization of the Protein and its Gene. Syst. Appl. Microbiol. 2000, 23, 174–184. [Google Scholar] [CrossRef]
- Dagan, T. Phylogenomic networks. Trends Microbiol. 2011, 19, 483–491. [Google Scholar] [CrossRef]
- Chan, J.Z.-M.; Halachev, M.R.; Loman, N.J.; Constantinidou, C.; Pallen, M.J. Defining bacterial species in the genomic era: Insights from the genus Acinetobacter. BMC Microbiol. 2012, 12, 302. [Google Scholar] [CrossRef]
- Wiernasz, N.; Leroi, F.; Chevalier, F.; Cornet, J.; Cardinal, M.; Rohloff, J.; Passerini, D.; Skırnisdóttir, S.; Pilet, M.-F. Salmon Gravlax Biopreservation With Lactic Acid Bacteria: A Polyphasic Approach to Assessing the Impact on Organoleptic Properties, Microbial Ecosystem and Volatilome Composition. Front. Microbiol. 2019, 10, 3103. [Google Scholar] [CrossRef]
- Brillet, A.; Pilet, M.-F.; Prevost, H.; Cardinal, M.; Leroi, F. Effect of inoculation of Carnobacterium divergens V41, a biopreservative strain against Listeria monocytogenes risk, on the microbiological, chemical and sensory quality of cold-smoked salmon. Int. J. Food Microbiol. 2005, 104, 309–324. [Google Scholar] [CrossRef]
- Spanu, C.; Piras, F.; Mocci, A.M.; Nieddu, G.; De Santis, E.P.L.; Scarano, C. Use of Carnobacterium spp protective culture in MAP packed Ricotta fresca cheese to control Pseudomonas spp. Food Microbiol. 2018, 74, 50–56. [Google Scholar] [CrossRef]
- Marmann, A.; Aly, A.; Lin, W.; Wang, B.; Proksch, P. Co-Cultivation—A Powerful Emerging Tool for Enhancing the Chemical Diversity of Microorganisms. Mar. Drugs 2014, 12, 1043–1065. [Google Scholar] [CrossRef] [PubMed]
- Bode, H.B.; Bethe, B.; Höfs, R.; Zeeck, A. Big effects from small changes: Possible ways to explore nature’s chemical diversity. ChemBioChem 2002, 3, 619–627. [Google Scholar] [CrossRef]
- Holley, R.A.; Guan, T.Y.; Peirson, M.; Yost, C.K. Carnobacterium viridans sp. nov., an alkaliphilic, facultative anaerobe isolated from refrigerated, vacuum-packed bologna sausage. Int. J. Syst. Evol. Microbiol. 2002, 52, 1881–1885. [Google Scholar] [CrossRef] [PubMed]








| Gene Name | Leader Peptide | Core Sequence | Blastp Prediction | Best Match | Identity | Similarity |
|---|---|---|---|---|---|---|
| Lan1A1 | - | MQTTTKSFVGQAFEELSIEEMEVLQGSGDVQPLSSPVSWIATALSAVLCFPGSVS | type 2 lantibiotic | Bacillus thuringiensis | 48% | 72% |
| Lan1A2 | - | MITNQFIGQAFEELSTEEMEVLQGAGEITPYSTIPCAAIISAVWATITKC | type 2 lantibiotic | Bacillus thuringiensis | 68% | 85% |
| Lan1A3 | - | MESKELHQFVGQAFEELSIESMEQLQGSSDISPRTTLPCLESAVVSYEIITMIFCKS | type 2 lantibiotic | Bacillus thuringiensis | 65% | 72% |
| Th1A1 | MEKELSTKDFDLEVELLDLDEVSA | IPETTASSGSTSCSASSTCGSTSCCGSC | thiazolyl-peptide | Enterococcus termitis | 100% | 100% |
| Th1A2 | MERELSVNETTTEDFDLEVELLDSDEVSA | IPETTASSGSTSCSASSTCGSTSCCGSC | thiazolyl-peptide | Enterococcus termitis | 100% | 100% |
| HT1 | MMNVRLTKNYKFYGAISLVLISITIGILFISTTPYIAGA | LGLSTGTATQVVSLISAYQTAAAIVSIVGALTGVGGITSGIVATVLFLLKKQGKAKAALW | circular bacteriocin | Streptococcus pseudopneumoniae | 67% | 80% |
| HT2 | - | MSDLIMEIASSMGISWGVASKVIDLVLAGSSAWAIVAAIVSGGGIIAIGAVAIKALIQSKLKQMGRAAVITW | circular bacteriocin | Paenibacillus larvae | 49% | 70% |
| HT3 | - | MIELTMELMNSMNIGRSTATHVIDLAVAGASAWAIVASIAAGGGIIAIGAVAVRTLIKSKLKKLGYTALVAW | circular bacteriocin | Paenibacillus larvae | 49% | 70% |
| UB1 | MVSGLGLLFSSINVEAATA | YPNGVYCNKTKCWVDWNKAQSEIGKIIVNGWVQSGPWS | duracin GL | Enterococcus durans | 82% | 86% |
| UB2 | MKKNLIKFATVFILVSGLGLLFSSINAEAATA | YPNGVYCNKTKCWVDWNKAQSEIGKIIVNGWIQNGPWS | duracin GL | Enterococcus durans | 79% | 89% |
| UB3 | - | MNGNGVSCTKTKCSVNWGQALTEGTKRWGDNLFGSVSG | hiracin-JM79 | Enterococcus faecalis | 79% | 80% |
| UB4 | MGKKILKGLIVSIFLLGIVLFIAPQEAEA | STYYGNGVSCTKKKCSVNWGQSWTEGVQRWGDHLFG | hiracin-JM79 | Enterococcus faecalis | 75% | 91% |
| UB5 | MIGEMKMKKNLLFFVVFVLSLSVTPMLASA | ESENKVDMLPDGTTFTFGVPFTTNEFSDDGSYETVTIVSEVTNNTSSSVNIGITPRRIDNGYYIGRAYWINRNGLLSVSIYPNKGASGWTKDRAWDELKRNFSHYANWKNETSLRKQFNCHARPIPPYTGKIPWNLEPSKAATNILTCN | propionicin SM1 | Propionibacterium jensenii DF1 | 34% | 49% |
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Begrem, S.; Ivaniuk, F.; Gigout-Chevalier, F.; Kolypczuk, L.; Bonnetot, S.; Leroi, F.; Grovel, O.; Delbarre-Ladrat, C.; Passerini, D. New Insight into Antimicrobial Compounds from Food and Marine-Sourced Carnobacterium Species through Phenotype and Genome Analyses. Microorganisms 2020, 8, 1093. https://doi.org/10.3390/microorganisms8071093
Begrem S, Ivaniuk F, Gigout-Chevalier F, Kolypczuk L, Bonnetot S, Leroi F, Grovel O, Delbarre-Ladrat C, Passerini D. New Insight into Antimicrobial Compounds from Food and Marine-Sourced Carnobacterium Species through Phenotype and Genome Analyses. Microorganisms. 2020; 8(7):1093. https://doi.org/10.3390/microorganisms8071093
Chicago/Turabian StyleBegrem, Simon, Flora Ivaniuk, Frédérique Gigout-Chevalier, Laetitia Kolypczuk, Sandrine Bonnetot, Françoise Leroi, Olivier Grovel, Christine Delbarre-Ladrat, and Delphine Passerini. 2020. "New Insight into Antimicrobial Compounds from Food and Marine-Sourced Carnobacterium Species through Phenotype and Genome Analyses" Microorganisms 8, no. 7: 1093. https://doi.org/10.3390/microorganisms8071093
APA StyleBegrem, S., Ivaniuk, F., Gigout-Chevalier, F., Kolypczuk, L., Bonnetot, S., Leroi, F., Grovel, O., Delbarre-Ladrat, C., & Passerini, D. (2020). New Insight into Antimicrobial Compounds from Food and Marine-Sourced Carnobacterium Species through Phenotype and Genome Analyses. Microorganisms, 8(7), 1093. https://doi.org/10.3390/microorganisms8071093

