Next Article in Journal
Ceftazidime–Avibactam Improves Outcomes in High-Risk Neutropenic Patients with Klebsiella pneumoniae Carbapenemase-Producing Enterobacterales Bacteremia
Previous Article in Journal
The Networked Interaction between Probiotics and Intestine in Health and Disease: A Promising Success Story
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Diverse Small Circular DNA Viruses Identified in an American Wigeon Fecal Sample

1
Biodesign Center for Fundamental and Applied Microbiomics, Center for Evolution and Medicine, School of Life Sciences, Arizona State University, Tempe, AZ 85042, USA
2
Structural Biology Research Unit, Department of Integrative, Biomedical Sciences, University of Cape Town, Observatory, Cape Town 7925, South Africa
*
Authors to whom correspondence should be addressed.
Microorganisms 2024, 12(1), 196; https://doi.org/10.3390/microorganisms12010196
Submission received: 24 December 2023 / Revised: 13 January 2024 / Accepted: 16 January 2024 / Published: 18 January 2024
(This article belongs to the Section Virology)

Abstract

American wigeons (Mareca americana) are waterfowls that are widely distributed throughout North America. Research of viruses associated with American wigeons has been limited to orthomyxoviruses, coronaviruses, and circoviruses. To address this poor knowledge of viruses associated with American wigeons, we undertook a pilot study to identify small circular DNA viruses in a fecal sample collected in January 2021 in the city of Tempe, Arizona (USA). We identified 64 diverse circular DNA viral genomes using a viral metagenomic workflow biased towards circular DNA viruses. Of these, 45 belong to the phylum Cressdnaviricota based on their replication-associated protein sequence, with 3 from the Genomoviridae family and the remaining 42 which currently cannot be assigned to any established virus group. It is most likely that these 45 viruses infect various organisms that are associated with their diet or environment. The remaining 19 virus genomes are part of the Microviridae family and likely associated with the gut enterobacteria of American wigeons.

1. Introduction

American wigeons (Mareca americana) are a widely distributed species of migratory waterfowl in North America [1]. Mareca americana is one of three species of wigeons, the other two being M. penelope and M. sibilatrix in the family Anatidae. American wigeons in the Pacific flyway overwinter in the southwest of North America, which includes the states of Arizona, California, and parts of Mexico. During the late spring/summer months, they migrate to parts of Canada and Alaska [2,3]. American wigeons feed in shallow bodies of freshwater (e.g., ponds, lakes, and marshes), and their diet primarily consists of plants and some insects [4]. American wigeons generally inhabit the same environments as other dabbling ducks, such as northern shovelers (Spatula clypeata), mallards (Anas platyrhynchos), green-winged teal (Anas carolinensis), northern pintails (Anas acuta), and gadwalls (Mareca strepera).
A significant amount of virology research has been undertaken on various waterfowl focusing on viruses in families Adenoviridae, Astroviridae, Circoviridae, Coronaviridae, Flaviviridae, Herpesviridae, Orthomyxoviridae, Paramyxoviridae, Parvoviridae, Picornaviridae and Spinareoviridae. However, within the context of American wigeons, most of the work has focused on orthomyxoviruses [5,6,7], coronaviruses [8], and circoviruses [9].
The Cressdnaviricota phylum is a recently established group of circular replication-encoding single-stranded (CRESS) DNA viruses [10]. Cressdnaviruses have relatively small genomes that contain at least two open reading frames (ORFs) that encode a conserved replication-associated protein (Rep) and a capsid protein (CP) [10]. Cressdnavirus families include Amesuviridae, Bacilladnaviridae, Circoviridae, Genomoviridae, Geminiviridae, Nanoviridae, Naryaviridae, Nenyaviridae, Metaxyviridae, Redondoviridae, Smacoviridae, and Vilyaviridae [10,11,12]. A significant number of cressdnaviruses have been identified via viral metagenomic studies [13,14,15,16,17,18,19,20,21,22].
The family Genomoviridae is divided into 10 genera based on the phylogeny of their Rep amino acid, i.e., Gemycircularvirus, Gemyduguivirus, Gemygorvirus, Gemykibivirus, Gemykolovirus, Gemykrogvirus, Gemykronzavirus, Gemytondvirus, Gemytripvirus, and Gemyvongvirus [23,24]. Genomoviruses have conserved regions in their Rep protein sequences that include the rolling circle replication (RCR) motifs, the gemini-like replication sequence (GRS), and Superfamily 3 (SF3) helicase motifs [25]. Although most genomoviruses have been found in various animal, plant, fungi, and environmental samples [24], there are confirmed hosts for two genomoviruses, i.e., Sclerotinia sclerotiorum [26] and Fusarium graminearum [27]. Genomoviruses are classified at a species level based on genome-wide pairwise identities.
Microviruses are single-stranded DNA bacteriophages from the Phixviricota phylum with circular genome ranging from ~3 to 6 kb [28,29,30]. Microviruses have been previously identified in various samples across the globe [31]. Microviruses encode four structural proteins: major capsid protein F, major spike protein G, DNA pilot protein H, and DNA-binding protein J [32]. The Microviridae family is split into two subfamilies, Gokushovirinae and Bullavirinae. There are three genera (Alphatrevirus, Gequatrovirus, and Sinsheimervirus) in the Bullavirinae subfamily and four genera (Bdellomicrovirus, Chlamydiamicrovirus, Enterogokushovirus, and Spiromicrovirus) in the Gokushovirinae subfamily [29].
Given the limited information on viruses associated with American wigeons, we undertook a pilot metagenomic study to identify circular DNA viruses in a fecal sample collected in Tempe, Arizona (USA). We identified 3 genomoviruses, 42 unclassified cressdnaviruses, and 19 microviruses.

2. Materials and Methods

2.1. Fecal Sampling and High-Throughput Sequencing

An American wigeon fecal sample was collected on 13 January 2021 at Kiwanis Park, Tempe, Arizona, USA. The sample was collected using a sterile tongue depressor following a visual observation of an American wigeon defecating and then placed into a 2 mL tube. It was stored in a −20 °C freezer until processing. The fecal sample (1 g) was homogenized in 2 mL of SM buffer. The homogenate was centrifuged at 10,000× g for 10 min, and the supernatant was sequentially filtered through 0.45 µm and 0.2 µm syringe filters. In total, 200 µL of this filtrate was used to extract viral DNA using the High Pure Viral Nucleic Acid Kit (Roche, USA) following the manufacturer’s instructions. Circular DNA in the viral DNA extract was amplified using rolling circle amplification (RCA) with the Templiphi 100 amplification kit (GE Healthcare, USA). The RCA products were used to generate Illumina sequencing libraries using the DNA TrueSeq Nano kit, and they were sequenced on an Illumina Hiseq4000 sequencer (Illumina, USA) at Psomagen Inc. (USA).

2.2. Sequence Assembly and Identification of Viral Contigs

The pair-end reads (2 × 150 nts) were trimmed using Trimmomatic v0.39 [33]. The resulting paired-end reads were then de novo assembled using MEGAHIT v1.2.9 [34], and contigs > 1000 nts in length were screened using BLASTx [35] against a viral RefSeq protein sequence database (release 207) for viral-like sequences. All contigs with terminal redundancy were determined to represent circular genomes. All circular genomes that appeared to be eukaryote-infecting viruses were annotated using ORFfinder (ncbi.nlm.nih.gov/orffinder/, accessed on 1 October 2023) coupled with manual checks. Prokaryote-infecting circular DNA viruses were annotated using VIBRANT [36].
Since multiple studies have identified some cressdnaviruses as reagent/kit contaminants [20,37,38,39,40], to identify any reagent-associated viruses or those misidentified as a result of barcode-hopping artifacts, we mapped all the reads from all the samples processed at the same time/run on the same lane to the virus genomes identified here using BBMap [41].

2.3. Analyses of Cressdnaviruses

A dataset was constructed of Rep sequences from representative (species-level) classified cressdnaviruses (Bacillidnaviridae, Circoviridae, Geminiviridae, Genomoviridae, Metaxyviridae, Nanoviridae, Naryaviridae, Nenyaviridae, Redondoviridae, Smacoviridae, and Vilyaviridae), alphasatellites, all CRESS Groups 1–6 [42,43], and all unclassified cressdnaviruses. This dataset, together with Reps of the cressdnaviruses from this study, was used to determine putative family-level grouping with a sequence similarity network (SSN) using EFI-EST [44] with a similarity score of 60. This threshold allows for putative family-level clustering for cressdnaviruses [13,17,19,45,46,47,48]. The SSN of the resulting Rep amino acid sequences was visualized in Cytoscape v3.8.2 [49] with an organic layout visualization option.
We extracted Rep protein sequences from the representative Rep sequence dataset used for SSN analysis that cluster with those from this study, as well as those from the established viral cressdnavirus families and CRESS Groups 1–6. These were collectively aligned with MAFFT v7.113 [50], and the resulting alignment was trimmed using TrimAL with a gap threshold of 0.2 [51]. A maximum likelihood phylogenetic tree was constructed using IQTree v2.1.3 [52] with a Q.pfam + F + G4 substitution model identified as the best-fit model and with approximate likelihood ratio test (aLRT) branch support [53] inferred from the trimmed alignment. The maximum likelihood phylogenetic tree was visualized with iTOL v6 [54].
The Rep amino acid sequences form the Genomoviridae family and unclassified cressdnavirus clusters (CRESSV2, CRESSV6, and Clusters A–Q) were individually aligned using MAFFT v7.113 AUTO mode [50] with appropriate outgroups based on the large Rep phylogenetic tree. Cluster-level alignments were used to determine the best-fit amino acid substitution model using ProtTest3 [55], and maximum likelihood trees were inferred with these models and PhyML3 [56]. In the resulting trees, branches with <0.80 aLRT branch support [53] were collapsed in TreeGraph2 [57]. All pairwise identities were determined using SDTv1.2 [58].

2.4. Analyses of Microviruses

Major capsid protein (MCP) sequences were extracted from the genome sequences of microviruses and assembled into a dataset that contained 3641 known MCP sequences. The MCP sequences were translated and aligned with those from the study using the MAFFT v7.113 AUTO mode [50]. The resulting alignments were trimmed using TrimAl v1.2 with the gappyout option [51]. The trimmed alignment was used to infer a maximum likelihood phylogenetic tree IQTree v2.1.3 using the best-fit model [52] and visualized with iTOL v6 [59].

3. Results and Discussion

3.1. Identification of Viral Genomes

The de novo assemblies resulted in 3538 contigs with a size range of 200–66,203 nts. Of these, 1228 were >1000 nts. Of these, 672 were identified to be viral-like based on BLASTx analysis representing viruses in phyla Cressdnaviricota (n = 82), Hofneiviricota (n = 10), Nucleocytoviricota (n = 45), Phixviricota (n = 24) and Uroviricota (n = 511). Of all of these, 64 contigs with similarities to viruses in Cressdnaviricota (n = 45) and Phixviricota (n = 19) were identified to have terminal redundancies and thus determined as ones representing complete circular genomes. No raw reads mapping to these contigs were found in any of the other sample libraries processed at the same time in the lab and run on the same flow cell based on our mapping analysis using BBMap [41].
For this study, we focus on the complete genomes (Figure 1). Three of the 45 cressdnaviruses are part of the family Genomoviridae and the rest cluster (based on the Rep sequence similarity network) with sequences of unclassified cressdnaviruses. Collectively, the Reps of these cressdnaviruses are part of 1 classified cluster (genomoviruses) and 19 unclassified clusters (CRESSV2, CRESSV6, clusters A–Q), and 10 are singletons (Figure 2). The 19 phixviruses are part of the family Microviridae.
A summary of the BLASTn [35] analysis of the genomes identified here is provided in Table 1. With the exception of three viruses, i.e., wigfec virus K19_469 (OP549795), wigfec virus K19_561 (OP549839) and wigfec virus K19_141 (OP549803) which share >70% pairwise identity with >80% genome coverage, all others are relatively diverse.

3.2. Genomoviruses

The genomoviruses identified in this study range in size from 2200 to 2375 nts and encode a CP and a Rep in an ambisense orientation [24]. The three genomoviruses identified in this study belong to three different genera with wigfec virus K19_435 (OP549796) in Gemykibivirus, wigfec virus K19_469 (OP549795) in Gemyduguivirus and wigfec virus K19_482 (OP549794) in Gemycircularvirus (Figure 3). The conserved rolling circle replication motif (RCR), geminivirus Rep-like sequences (GRS), and Superfamily 3 (SF3) helicase motifs are present in all the Reps of wigfec genomoviruses (Table 2).
Wigfec virus K19_469 (OP549795) is most similar to Genomoviridae sp. D2_1183 (MW678959), isolated from dust particles in Arizona [60], which is not classified at a species level sharing 98% genome-wide nucleotide pairwise identity and 100% Rep amino acid identity (Table 3). Given this virus was also detected in Arizona, it may be that it infects a commonly detected fungus in Arizona. Wigfec virus K19_435 (OP549796) is most similar to Cybaeus spider-associated circular virus 2 BC_I1644B_C3 (MH545507) [61] which belongs to species Gemykibivirus cybusi1, sharing 51% genome-wide nucleotide pairwise identity. Its Rep shares 60% amino acid identity and clusters with other members of species Gemykibivirus cynas1 and Gemykibivirus raski1 (Figure 3). Wigfec virus K19_482 (OP549794) is most similar to gemycircularvirus gemy-ch-rat1 (KR912221), identified from a rat [62], which is part of species Gemycircularvirus ratas1, sharing 51% genome-wide nucleotide pairwise identity and 38% Rep amino acid identity (Table 3).
Wigfec virus K19_435, wigfec virus K19_482, and wigfec virus K19_469 with Genomoviridae sp. D2_1183 represent three new species based on the previously established 78% genome-wide pairwise identity species demarcation threshold for genomoviruses [23]. All the three genomoviruses identified here are likely fungal-infecting viruses based on what is known of two of the fungal hosts (Sclerotinia sclerotiorum and Fusarium graminearum) [26,27], specific genomviruses in species Gemycircularvirus sclero1 and Gemytripvirus fugra1 [24].

3.3. Unclassified Cressdnaviruses

Forty-two cressdnaviruses (size range 1665–3789 nts) could not be assigned to any established cressdnavirus family (Figure 1 and Figure 2). Based on SSN analysis, the Reps of 10 cressdnaviruses are singletons, and 32 cluster with other known Reps within 19 unique clusters (Figure 2). This highlights the diversity of these cressdnaviruses within a single fecal sample. Rep amino acid phylogenetic analysis for each cluster with >2 sequences is undertaken. In the Reps of all these 42 cressdnaviruses, we identify the conserved RCR and SF3 helicase motifs (Table 2). Additionally, in the Reps of wigfec virus K19_467 (OP549797), wigfec virus K19_484 (OP549821), wigfec virus K19_494 (OP549823), and wigfec virus K19_493 (OP549851), which are all part of Cluster J, and wigfec virus K19_486 (OP549822) which is part of Cluster K, we identified a GRS domain (Table 2). The GRS domain in the Rep of wigfec virus K19_486 appears to have a five-residue insertion (DGTVY) (Table 2).
CRESSV1-6 have previously been described as unique family level groupings [43]. Five of the viruses identified in this study (wigfec virus K19_426 (OP549818), wigfec virus K19_588 (OP549828), wigfec virus K19_292 (OP549833), wigfec virus K19_555 (OP549837) and wigfec virus K19_645 (OP549843) are part of CRESSV2 (Figure 4), and they share ~32–40% amino acid identity and <57% amino acid identity with the Reps of all other viruses in cluster CRESSV2 and are distributed throughout the CRESSV2 Rep phylogeny (Figure 4).
The Reps of wigfec virus K19_426, wigfec virus K19_588, wigfec virus K19_292, wigfec virus K19_555, and wigfec virus K19_645 are most similar to those of Diporeia sp. associated circular virus LM3487 (KC248416) [63], Antarctic circular DNA molecule COCH21_V_94 (MN328284) [64], uncultured virus CG261 (KY487930) [65], sewage-associated circular DNA and virus-20 NZ-BS3900-2012 (KM821755) [66], and Cressdnaviricota sp. ctdb97 (MH510276) [20], sharing 46%, 57%, 46%, 53%, and 56% amino acid identity, respectively (Table 3). Wigfec virus K19_450 (OP549820) is part of CRESSV6 (Figure 5). The Rep of wigfec virus K19_450 (OP549820) shares a pairwise amino acid identity of 49.4% with that of Circovirus-like DCCV-2 (KT149395) identified from a freshwater lake in China and phylogenetically forms a clade with it, as well (Figure 5, Table 3).
The Rep of wigfec virus K19_668 (OP549845) is part of Cluster A and shares 51% amino acid identity and clustering with Arizlama virus isolate AZLM_1011(MW697465), which was detected in a lake sample from Arizona (Figure 5). The Reps of wigfec virus K19_562 (OP549827) and wigfec virus K19_691 (OP549846) cluster and that of uncultured virus CG267 (KY487936) [65] share < 44% amino acid identity (Figure 5, Table 3). The Rep of wigfec virus K19_571 (OP549840) clusters with the Reps of five viruses in Cluster C share ~46–64% amino acid identity, and it is most closely related to that of Virus sp. isolate D12_1244 (MW678878) [60]. The Reps of wigfec virus K19_593 (OP549841), wigfec virus K19_558 (OP549838), and wigfec virus K19_432 (OP549819) are part of Clusters D, E, and F, respectively (Figure 6 and Figure 7). Their Reps share the highest similarity of 45%, 72%, and 51% amino acid identity with Reps of Cressdnaviricota sp. ctcd610 (MH649031) [20], Sewage-associated circular DNA virus-17 (KM821752) and Avon-Heathcote Estuary-associated circular virus 26 NZ-2311TU-2012 (KM874359) [14], respectively (Table 3).
In Cluster G, the genome of wigfec virus K19_561 (OP549839) shares ~90% similarity with the genome of Chicken circovirus 4 CCV-4 (MN428454) identified in the stomach of a red junglefowl (Gallus gallus), from southeast Asia [67] (Table 3). Their Reps share 98.6% amino acid identity. This virus is the only unclassified cressdnavirus that has high similarity to a previously identified virus. Furthermore, the Rep of wigfec virus K19_521 (OP549825) shares ~63% with chicken circovirus 2 CCV-2 (MN420497), also from red junglefowl [67] (Table 3). The Rep of wigfec virus K19_525 (OP549836) clusters with the Reps of wigfec virus K19_561 and Chicken circovirus 4 CCV-4, sharing ~59% amino acid identity (Figure 8). Given that several of these circovirus-like genomes have been detected in two bird species, it may be that this is an avian virus or infects an organism that is commonly associated with avian species.
The Rep of wigfec virus K19_623 (OP549831) in Cluster G shares 54% amino acid identity with the Rep of Cressdnaviricota sp. ctcd828 (MH649233) from seabass tissue [20]. Wigfec virus K19_227 (OP549817) and wigfec virus K19_658 (OP549832) are part of Cluster H (Figure 9), and their Reps share ~48% amino acid identity and ~49 and 53% amino acid identity with Cressdnaviricota sp. ctbb593 (MH648954) from seabass tissue and Cressdnaviricota sp. ctca156 (MH616996) from abalone tissue [20] (Table 3). The Rep of wigfec virus K19_545 (OP549826) in Cluster I shares ~43% amino acid identity with the Rep of Crucivirus-124 BS_313 (MT263552) from a water sample in New Zealand [15] (Figure 9, Table 3).
The Reps of wigfec virus K19_467 (OP549797), wigfec virus K19_484 (OP549821), wigfec virus K19_494 (OP549823), and wigfec virus K19_493 (OP549851) are part of Cluster J, sharing 32–54% amino acid identity and 46, 53, 65 and 37% amino acid identities with the Reps of Genomoviridae sp. 6434_400 (MT309859), Ancient caribou feces-associated virus (KJ938716) [68], Sewage-associated circular DNA virus-36 NZ-BS3974-2012 (KM821748) [66], and Genomoviridae sp. 6538_332 (MT309820), respectively (Table 3). Wigfec virus K19_486 (OP549822), a member of Cluster K, encodes a Rep that shares 47% amino acid identity with that of Genomoviridae sp. 6538_302 (MT309829) from wastewater. The Reps of the members in Clusters J and K all have a GRS domain (Table 2), and, although some are named “Genomoviridae”, they belong to an outgroup most closely related to genomoviruses and geminiviruses (Figure 2).
The Reps of wigfec virus K19_511 (OP549824) and uncultured virus clone CG104 (KY487775) [65] share 41% amino acid pairwise identity in Cluster L (Figure 10), and that of wigfec virus K19_346 (OP549834) shares 47% with that of Crucivirus-243 SR3_42497 (MT263577) [15] in Cluster M (Table 3). Cluster N is made of two Rep sequences, i.e., wigfec virus K19_600 (OP549842) and Virus sp. isolate D6_821 (MW678874) [60], sharing ~47% amino acid identity. In Cluster O, the Rep of wigfec virus K19_654 (OP549844) shares ~49 and 59% amino acid identity with the Reps of chifec virus UA13_133 (OM523004) [46] from a Mexican free tailed bat and Cressdnaviricota sp. ctcj370 (MH617003) from minnow tissue [20] (Figure 10, Table 3). The Reps of wigfec virus K19_598 (OP549829) and wigfec virus K19_605 (OP549830) in Cluster P (Figure 10) share 46% amino acid identity amongst them and 46% and 86% with those of Capybara virus 8_cap1_36 (MK570170) [45] and Apis mellifera virus-5 BNH861 (MH973774) [16], respectively (Table 3). Wigfec virus K19_385 (OP549835) is part of Cluster Q, and its Rep shares 52% amino acid identity with the Rep of uncultured virus CG135 (KY487806) [65] (Table 3).
The 10 singletons, wigfec virus K19_221 (OP549847), wigfec virus K19_259 (OP549848), wigfec virus K19_327 (OP549849), wigfec virus K19_443 (OP549850), wigfec virus K19_526 (OP549852), wigfec virus K19_576 (OP549853), wigfec virus K19_615 (OP549854), wigfec virus K19_448 (OP549855), wigfec virus K19_454 (OP549856), and wigfec virus K19_513 (OP549857), share 26–41% Rep amino acid identity with the best hits based on BLASTp analysis (Table 3).

3.4. Microviruses

We identified 19 microviruses that range in size from 4182 to 6389 nts. All of the 19 microviruses encode a major capsid protein (MCP) and a replication initiator protein. The MCP phylogeny reveals that those from this study are broadly distributed across several clades, with eight in the subfamily of Gokushovirinae, three in proposed putative sub-family clade Alpavirinae, and four in the Pichovirinae (Figure 1 and Figure 11) [69]. Four of the identified microviruses fall outside of these (Figure 1 and Figure 11). The MCPs of these viruses in general share 38–77% highest amino acid identity with those of microviruses identified from various environments (Table 4). These microviruses likely infect the gut enterobacteria of the American wigeon, and they all represent new species based on the 95% species threshold used for bacteriophage, as these genomes share < 88% genome-wide identity with all other microvirus genomes in GenBank.

4. Conclusions

American wigeons play a vital ecological role in wetland ecosystems across North America. These birds travel hundreds of kilometers during their migration seasons and can provide insight into viral diversity due to their interactions across different habitats. We identified 42 unclassified cressdnavirus, 3 genomovirus, and 19 microvirus genomes through our non-invasive fecal sampling approach from one sample. The unclassified cressdnaviruses identified from this study are diverse. The three members of the Genomoviridae family are part of three different genera: Gemykibivirus, Gemyduguivirus, and Gemycircularvirus. These genomoviruses most likely infect fungi associated with American wigeons; however, in general, little is known about their host range. In total, 10 cressdnaviruses are singletons, and 32 cluster into 20 family-level groups. In addition, 3 cressdnaviruses, wigfec virus K19_521, wigfec virus K19_467, and wigfec virus K19_561, are most similar to genomes detected from avian samples, and wigfec virus K19_469 is most similar to a Gemyduguivirus from airborne dust particles; however, the rest are diverse viruses. In general, all these 42 unclassified cressdnaviruses each likely represent at least 40 new species of viruses, as they share < 80% genome-wide identity with other virus genomes in GenBank. The 19 microviruses we identified most likely infect the gut microbiota of the American wigeon and these all represent 19 new species. This pilot study highlights the diverse viral community within just a single fecal sample of an American wigeon. Although we cannot determine whether any of the eukaryote-infecting viruses we identified in this study infect the American wigeon, they expand our knowledge on diversity of ssDNA viruses, and with more studies, we will be able to start understanding the ecology of these viruses.

Author Contributions

Conceptualization, A.K., S.K. and A.V.; methodology, D.O., A.K., J.M.C., S.K. and A.V.; software, D.O., A.K., S.K. and A.V.; validation, D.O., A.K., S.K. and A.V.; formal analysis, D.O., A.K., S.K. and A.V.; investigation, D.O., A.K., J.M.C., S.K. and A.V.; resources, A.V.; data curation, A.V.; writing—original draft preparation, D.O., S.K. and A.V.; writing—review and editing, D.O., A.K., J.M.C., S.K. and A.V.; visualization, D.O., S.K. and A.V.; supervision, S.K. and A.V.; project administration, S.K. and A.V.; funding acquisition, A.V. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Data Availability Statement

Short read data are available at NCBI SRA under BioProject: PRJNA880751; BioSample: SAMN30871507; Sequence Read Archive: SRR21617928 and all viral genome sequences have been deposited in GenBank under accession numbers OP549794–OP549857.

Acknowledgments

D.O. is supported by a Presidential Graduate Fellowship from Arizona State University (USA).

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Johnsgard, P.A.; Johnsgard, P.A. Waterfowl of North America; Indiana University Press: Bloomington, Indiana, 1975; p. 575. [Google Scholar]
  2. Johnson, D.H.; Grier, J.W. Determinants of Breeding Distributions of Ducks. Wildl. Monogr. 1988, 100, 3–37. [Google Scholar]
  3. de Sobrino, C.N.; Feldheim, C.F.; Arnold, T.W. Distribution and derivation of dabbling duck harvests in the Pacific Flyway. Calif. Fish Game 2017, 103, 118–137. [Google Scholar]
  4. Dessborn, L.; Brochet, A.L.; Elmberg, J.; Legagneux, P.; Gauthier-Clerc, M.; Guillemain, M. Geographical and temporal patterns in the diet of pintail Anas acuta, wigeon Anas penelope, mallard Anas platyrhynchos and teal Anas crecca in the Western Palearctic. Eur. J. Wildl. Res. 2011, 57, 1119–1129. [Google Scholar] [CrossRef] [Scilit]
  5. Ip, H.S.; Torchetti, M.K.; Crespo, R.; Kohrs, P.; DeBruyn, P.; Mansfield, K.G.; Baszler, T.; Badcoe, L.; Bodenstein, B.; Shearn-Bochsler, V.; et al. Novel Eurasian highly pathogenic avian influenza A H5 viruses in wild birds, Washington, USA, 2014. Emerg. Infect. Dis. 2015, 21, 886–890. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Bevins, S.N.; Dusek, R.J.; White, C.L.; Gidlewski, T.; Bodenstein, B.; Mansfield, K.G.; DeBruyn, P.; Kraege, D.; Rowan, E.; Gillin, C.; et al. Widespread detection of highly pathogenic H5 influenza viruses in wild birds from the Pacific Flyway of the United States. Sci. Rep. 2016, 6, 28980. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Hopken, M.W.; Piaggio, A.J.; Pabilonia, K.L.; Pierce, J.; Anderson, T.; Abdo, Z. Predicting whole genome sequencing success for archived avian influenza virus (Orthomyxoviridae) samples using real-time and droplet PCRs. J. Virol. Methods 2020, 276, 113777. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Chu, D.K.; Leung, C.Y.; Gilbert, M.; Joyner, P.H.; Ng, E.M.; Tse, T.M.; Guan, Y.; Peiris, J.S.; Poon, L.L. Avian coronavirus in wild aquatic birds. J. Virol. 2011, 85, 12815–12820. [Google Scholar] [CrossRef] [Scilit]
  9. Khalifeh, A.; Custer, J.M.; Kraberger, S.; Varsani, A. Novel viruses belonging to the family Circoviridae identified in wild American wigeon samples. Arch. Virol. 2021, 166, 3437–3441. [Google Scholar] [CrossRef] [Scilit]
  10. Krupovic, M.; Varsani, A.; Kazlauskas, D.; Breitbart, M.; Delwart, E.; Rosario, K.; Yutin, N.; Wolf, Y.I.; Harrach, B.; Zerbini, F.M.; et al. Cressdnaviricota: A Virus Phylum Unifying Seven Families of Rep-Encoding Viruses with Single-Stranded, Circular DNA Genomes. J. Virol. 2020, 94, 10–1128. [Google Scholar] [CrossRef] [Scilit]
  11. Krupovic, M.; Varsani, A. Naryaviridae, Nenyaviridae, and Vilyaviridae: Three new families of single-stranded DNA viruses in the phylum Cressdnaviricota. Arch. Virol. 2022, 167, 2907–2921. [Google Scholar] [CrossRef] [Scilit]
  12. Walker, P.J.; Siddell, S.G.; Lefkowitz, E.J.; Mushegian, A.R.; Adriaenssens, E.M.; Alfenas-Zerbini, P.; Dempsey, D.M.; Dutilh, B.E.; Garcia, M.L.; Curtis Hendrickson, R.; et al. Recent changes to virus taxonomy ratified by the International Committee on Taxonomy of Viruses (2022). Arch. Virol. 2022, 167, 2429–2440. [Google Scholar] [CrossRef] [Scilit]
  13. Custer, J.M.; White, R.; Taylor, H.; Schmidlin, K.; Fontenele, R.S.; Stainton, D.; Kraberger, S.; Briskie, J.V.; Varsani, A. Diverse single-stranded DNA viruses identified in New Zealand (Aotearoa) South Island robin (Petroica australis) fecal samples. Virology 2022, 565, 38–51. [Google Scholar] [CrossRef] [Scilit]
  14. Dayaram, A.; Goldstien, S.; Arguello-Astorga, G.R.; Zawar-Reza, P.; Gomez, C.; Harding, J.S.; Varsani, A. Diverse small circular DNA viruses circulating amongst estuarine molluscs. Infect. Genet. Evol. 2015, 31, 284–295. [Google Scholar] [CrossRef] [Scilit]
  15. de la Higuera, I.; Kasun, G.W.; Torrance, E.L.; Pratt, A.A.; Maluenda, A.; Colombet, J.; Bisseux, M.; Ravet, V.; Dayaram, A.; Stainton, D.; et al. Unveiling Crucivirus Diversity by Mining Metagenomic Data. mBio 2020, 11, e01410-20. [Google Scholar] [CrossRef] [Scilit]
  16. Kraberger, S.; Cook, C.N.; Schmidlin, K.; Fontenele, R.S.; Bautista, J.; Smith, B.; Varsani, A. Diverse single-stranded DNA viruses associated with honey bees (Apis mellifera). Infect. Genet. Evol. 2019, 71, 179–188. [Google Scholar] [CrossRef] [Scilit]
  17. Lund, M.C.; Larsen, B.B.; Rowsey, D.M.; Otto, H.W.; Gryseels, S.; Kraberger, S.; Custer, J.M.; Steger, L.; Yule, K.M.; Harris, R.E.; et al. Using archived and biocollection samples towards deciphering the DNA virus diversity associated with rodent species in the families cricetidae and heteromyidae. Virology 2023, 585, 42–60. [Google Scholar] [CrossRef] [Scilit]
  18. Nayfach, S.; Paez-Espino, D.; Call, L.; Low, S.J.; Sberro, H.; Ivanova, N.N.; Proal, A.D.; Fischbach, M.A.; Bhatt, A.S.; Hugenholtz, P.; et al. Metagenomic compendium of 189,680 DNA viruses from the human gut microbiome. Nat. Microbiol. 2021, 6, 960–970. [Google Scholar] [CrossRef] [Scilit]
  19. Orton, J.P.; Morales, M.; Fontenele, R.S.; Schmidlin, K.; Kraberger, S.; Leavitt, D.J.; Webster, T.H.; Wilson, M.A.; Kusumi, K.; Dolby, G.A.; et al. Virus Discovery in Desert Tortoise Fecal Samples: Novel Circular Single-Stranded DNA Viruses. Viruses 2020, 12, 143. [Google Scholar] [CrossRef] [Scilit]
  20. Tisza, M.J.; Pastrana, D.V.; Welch, N.L.; Stewart, B.; Peretti, A.; Starrett, G.J.; Pang, Y.S.; Krishnamurthy, S.R.; Pesavento, P.A.; McDermott, D.H.; et al. Discovery of several thousand highly diverse circular DNA viruses. Elife 2020, 9, e51971. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. Kinsella, C.M.; Bart, A.; Deijs, M.; Broekhuizen, P.; Kaczorowska, J.; Jebbink, M.F.; van Gool, T.; Cotten, M.; van der Hoek, L. Entamoeba and Giardia parasites implicated as hosts of CRESS viruses. Nat. Commun. 2020, 11, 4620. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Kinsella, C.M.; van der Hoek, L. Vertebrate-tropism of a cressdnavirus lineage implicated by poxvirus gene capture. Proc. Natl. Acad. Sci. USA 2023, 120, e2303844120. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Varsani, A.; Krupovic, M. Sequence-based taxonomic framework for the classification of uncultured single-stranded DNA viruses of the family Genomoviridae. Virus Evol. 2017, 3, vew037. [Google Scholar] [CrossRef] [Scilit]
  24. Varsani, A.; Krupovic, M. Family Genomoviridae: 2021 taxonomy update. Arch. Virol. 2021, 166, 2911–2926. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Rosario, K.; Duffy, S.; Breitbart, M. A field guide to eukaryotic circular single-stranded DNA viruses: Insights gained from metagenomics. Arch. Virol. 2012, 157, 1851–1871. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Yu, X.; Li, B.; Fu, Y.; Jiang, D.; Ghabrial, S.A.; Li, G.; Peng, Y.; Xie, J.; Cheng, J.; Huang, J.; et al. A geminivirus-related DNA mycovirus that confers hypovirulence to a plant pathogenic fungus. Proc. Natl. Acad. Sci. USA 2010, 107, 8387–8392. [Google Scholar] [CrossRef] [Scilit]
  27. Li, P.; Wang, S.; Zhang, L.; Qiu, D.; Zhou, X.; Guo, L. A tripartite ssDNA mycovirus from a plant pathogenic fungus is infectious as cloned DNA and purified virions. Sci. Adv. 2020, 6, eaay9634. [Google Scholar] [CrossRef] [Scilit]
  28. Breitbart, M.; Fane, B.A. Microviridae. eLS 2021, 2, 1–14. [Google Scholar] [CrossRef] [Scilit]
  29. Cherwa, J.E.; Fane, B.A. Microviridae: Microviruses and Gokushoviruses. In eLS; John Wiley & Sons, Ltd.: Chichester, UK, 2011. [Google Scholar] [CrossRef] [Scilit]
  30. Olo Ndela, E.; Roux, S.; Henke, C.; Sczyrba, A.; Sime Ngando, T.; Varsani, A.; Enault, F. Reekeekee- and roodoodooviruses, two different Microviridae clades constituted by the smallest DNA phages. Virus Evol. 2023, 9, veac123. [Google Scholar] [CrossRef] [Scilit]
  31. Kirchberger, P.C.; Martinez, Z.A.; Ochman, H. Organizing the Global Diversity of Microviruses. mBio 2022, 13, e00588-22. [Google Scholar] [CrossRef] [Scilit]
  32. Krupovic, M.; Forterre, P. Microviridae goes temperate: Microvirus-related proviruses reside in the genomes of Bacteroidetes. PLoS ONE 2011, 6, e19893. [Google Scholar] [CrossRef] [Scilit]
  33. Bolger, A.M.; Lohse, M.; Usadel, B. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 2014, 30, 2114–2120. [Google Scholar] [CrossRef] [Scilit]
  34. Li, D.; Luo, R.; Liu, C.M.; Leung, C.M.; Ting, H.F.; Sadakane, K.; Yamashita, H.; Lam, T.W. MEGAHIT v1.0: A fast and scalable metagenome assembler driven by advanced methodologies and community practices. Methods 2016, 102, 3–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef] [PubMed]
  36. Kieft, K.; Zhou, Z.; Anantharaman, K. VIBRANT: Automated recovery, annotation and curation of microbial viruses, and evaluation of viral community function from genomic sequences. Microbiome 2020, 8, 90. [Google Scholar] [CrossRef] [Scilit]
  37. Asplund, M.; Kjartansdottir, K.R.; Mollerup, S.; Vinner, L.; Fridholm, H.; Herrera, J.A.R.; Friis-Nielsen, J.; Hansen, T.A.; Jensen, R.H.; Nielsen, I.B.; et al. Contaminating viral sequences in high-throughput sequencing viromics: A linkage study of 700 sequencing libraries. Clin. Microbiol. Infect. 2019, 25, 1277–1285. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Holmes, E.C. Reagent contamination in viromics: All that glitters is not gold. Clin. Microbiol. Infect. 2019, 25, 1167–1168. [Google Scholar] [CrossRef] [Scilit]
  39. Naccache, S.N.; Greninger, A.L.; Lee, D.; Coffey, L.L.; Phan, T.; Rein-Weston, A.; Aronsohn, A.; Hackett, J., Jr.; Delwart, E.L.; Chiu, C.Y. The perils of pathogen discovery: Origin of a novel parvovirus-like hybrid genome traced to nucleic acid extraction spin columns. J. Virol. 2013, 87, 11966–11977. [Google Scholar] [CrossRef] [Scilit]
  40. Porter, A.F.; Cobbin, J.; Li, C.; Eden, J.-S.; Holmes, E.C. Metagenomic identification of viral sequences in laboratory reagents. Viruses 2021, 13, 2122. [Google Scholar] [CrossRef] [Scilit]
  41. Bushnell, B. BBMap: A Fast, Accurate, Splice-Aware Aligner; Lawrence Berkeley National Lab. (LBNL): Berkeley, CA, USA, 2014. [Google Scholar]
  42. Kazlauskas, D.; Varsani, A.; Koonin, E.V.; Krupovic, M. Multiple origins of prokaryotic and eukaryotic single-stranded DNA viruses from bacterial and archaeal plasmids. Nat. Commun. 2019, 10, 3425. [Google Scholar] [CrossRef] [Scilit]
  43. Kazlauskas, D.; Varsani, A.; Krupovic, M. Pervasive Chimerism in the Replication-Associated Proteins of Uncultured Single-Stranded DNA Viruses. Viruses 2018, 10, 187. [Google Scholar] [CrossRef] [Scilit]
  44. Zallot, R.; Oberg, N.; Gerlt, J.A. The EFI Web Resource for Genomic Enzymology Tools: Leveraging Protein, Genome, and Metagenome Databases to Discover Novel Enzymes and Metabolic Pathways. Biochemistry 2019, 58, 4169–4182. [Google Scholar] [CrossRef] [Scilit]
  45. Fontenele, R.S.; Lacorte, C.; Lamas, N.S.; Schmidlin, K.; Varsani, A.; Ribeiro, S.G. Single Stranded DNA Viruses Associated with Capybara Faeces Sampled in Brazil. Viruses 2019, 11, 710. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Harding, C.; Larsen, B.B.; Otto, H.W.; Potticary, A.L.; Kraberger, K.; Custer, J.M.; Suazo, C.; Upham, N.S.; Worobey, M.; van Doorslaer, K.; et al. Diverse DNA virus genomes identified in fecal samples of Mexican free-tailed bats (Tadarida brasiliensis) captured in Chiricahua Mountains of southeast Arizona (USA). Virology 2022, 580, 8–111. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Kraberger, S.; Schmidlin, K.; Fontenele, R.S.; Walters, M.; Varsani, A. Unravelling the Single-Stranded DNA Virome of the New Zealand Blackfly. Viruses 2019, 11, 532. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Levy, H.; Fontenele, R.S.; Harding, C.; Suazo, C.; Kraberger, S.; Schmidlin, K.; Djurhuus, A.; Black, C.E.; Hart, T.; Smith, A.L.; et al. Identification and Distribution of Novel Cressdnaviruses and Circular molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula. Viruses 2020, 12, 1029. [Google Scholar] [CrossRef] [Scilit]
  49. Shannon, P.; Markiel, A.; Ozier, O.; Baliga, N.S.; Wang, J.T.; Ramage, D.; Amin, N.; Schwikowski, B.; Ideker, T. Cytoscape: A software environment for integrated models of biomolecular interaction networks. Genome Res. 2003, 13, 2498–2504. [Google Scholar] [CrossRef] [Scilit]
  50. Katoh, K.; Standley, D.M. MAFFT multiple sequence alignment software version 7: Improvements in performance and usability. Mol. Biol. Evol. 2013, 30, 772–780. [Google Scholar] [CrossRef] [Scilit]
  51. Capella-Gutierrez, S.; Silla-Martinez, J.M.; Gabaldon, T. trimAl: A tool for automated alignment trimming in large-scale phylogenetic analyses. Bioinformatics 2009, 25, 1972–1973. [Google Scholar] [CrossRef] [Scilit]
  52. Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [Scilit]
  53. Anisimova, M.; Gascuel, O. Approximate likelihood-ratio test for branches: A fast, accurate, and powerful alternative. Syst. Biol. 2006, 55, 539–552. [Google Scholar] [CrossRef] [Scilit]
  54. Letunic, I.; Bork, P. Interactive Tree Of Life (iTOL) v5: An online tool for phylogenetic tree display and annotation. Nucleic Acids Res. 2021, 49, W293–W296. [Google Scholar] [CrossRef] [Scilit]
  55. Darriba, D.; Taboada, G.L.; Doallo, R.; Posada, D. ProtTest 3: Fast selection of best-fit models of protein evolution. Bioinformatics 2011, 27, 1164–1165. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Guindon, S.; Dufayard, J.F.; Lefort, V.; Anisimova, M.; Hordijk, W.; Gascuel, O. New algorithms and methods to estimate maximum-likelihood phylogenies: Assessing the performance of PhyML 3.0. Syst. Biol. 2010, 59, 307–321. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Stover, B.C.; Muller, K.F. TreeGraph 2: Combining and visualizing evidence from different phylogenetic analyses. BMC Bioinform. 2010, 11, 7. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Muhire, B.M.; Varsani, A.; Martin, D.P. SDT: A virus classification tool based on pairwise sequence alignment and identity calculation. PLoS ONE 2014, 9, e108277. [Google Scholar] [CrossRef] [Scilit]
  59. Letunic, I.; Bork, P. Interactive Tree Of Life (iTOL) v4: Recent updates and new developments. Nucleic Acids Res. 2019, 47, W256–W259. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Finn, D.R.; Maldonado, J.; de Martini, F.; Yu, J.; Penton, C.R.; Fontenele, R.S.; Schmidlin, K.; Kraberger, S.; Varsani, A.; Gile, G.H.; et al. Agricultural practices drive biological loads, seasonal patterns and potential pathogens in the aerobiome of a mixed-land-use dryland. Sci. Total Environ. 2021, 798, 149239. [Google Scholar] [CrossRef] [Scilit]
  61. Rosario, K.; Mettel, K.A.; Benner, B.E.; Johnson, R.; Scott, C.; Yusseff-Vanegas, S.Z.; Baker, C.C.M.; Cassill, D.L.; Storer, C.; Varsani, A.; et al. Virus discovery in all three major lineages of terrestrial arthropods highlights the diversity of single-stranded DNA viruses associated with invertebrates. PeerJ 2018, 6, e5761. [Google Scholar] [CrossRef] [Scilit]
  62. Li, W.; Gu, Y.; Shen, Q.; Yang, S.; Wang, X.; Wan, Y.; Zhang, W. A novel gemycircularvirus from experimental rats. Virus Genes 2015, 51, 302–305. [Google Scholar] [CrossRef] [Scilit]
  63. Hewson, I.; Eaglesham, J.B.; Höök, T.O.; LaBarre, B.A.; Sepúlveda, M.S.; Thompson, P.D.; Watkins, J.M.; Rudstam, L.G. Investigation of viruses in Diporeia spp. from the Laurentian Great Lakes and Owasco Lake as potential stressors of declining populations. J. Great Lakes Res. 2013, 39, 499–506. [Google Scholar] [CrossRef] [Scilit]
  64. Sommers, P.; Fontenele, R.S.; Kringen, T.; Kraberger, S.; Porazinska, D.L.; Darcy, J.L.; Schmidt, S.K.; Varsani, A. Single-Stranded DNA Viruses in Antarctic Cryoconite Holes. Viruses 2019, 11, 1022. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Pearson, V.M.; Caudle, S.B.; Rokyta, D.R. Viral recombination blurs taxonomic lines: Examination of single-stranded DNA viruses in a wastewater treatment plant. PeerJ 2016, 4, e2585. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. Kraberger, S.; Argüello-Astorga, G.R.; Greenfield, L.G.; Galilee, C.; Law, D.; Martin, D.P.; Varsani, A. Characterisation of a diverse range of circular replication-associated protein encoding DNA viruses recovered from a sewage treatment oxidation pond. Infect. Genet. Evol. 2015, 31, 73–86. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Li, G.; Yuan, S.; Yan, T.; Shan, H.; Cheng, Z. Identification and characterization of chicken circovirus from commercial broiler chickens in China. Transbound. Emerg. Dis. 2020, 67, 6–10. [Google Scholar] [CrossRef] [Scilit]
  68. Ng, T.F.; Chen, L.F.; Zhou, Y.; Shapiro, B.; Stiller, M.; Heintzman, P.D.; Varsani, A.; Kondov, N.O.; Wong, W.; Deng, X.; et al. Preservation of viral genomes in 700-y-old caribou feces from a subarctic ice patch. Proc. Natl. Acad. Sci. USA 2014, 111, 16842–16847. [Google Scholar] [CrossRef] [Scilit]
  69. Roux, S.; Krupovic, M.; Poulet, A.; Debroas, D.; Enault, F. Evolution and diversity of the Microviridae viral family through a collection of 81 new complete genomes assembled from virome reads. PLoS ONE 2012, 7, e40418. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Summary of the genomes of cressdnaviruses (A) and microviruses (B) identified from the American wigeon fecal sample. Circular genomes are shown in a linear representation.
Figure 1. Summary of the genomes of cressdnaviruses (A) and microviruses (B) identified from the American wigeon fecal sample. Circular genomes are shown in a linear representation.
Microorganisms 12 00196 g001
Figure 2. The Rep amino acid maximum likelihood phylogenetic tree inferred with IQTree2 (Minh et al., 2020) [52] with Q.pfam + F + G4 substitution model identified as the best-fit model for the viruses in the Cressdnaviricota phylum. The family-level clustering for unclassified CRESS groups was determined by sequence similarity networks (SSN) of the amino acid sequences of the cressdnavirus Rep with a sequence similarity score of 60 using EFI-EST [44] and visualized with Cytoscape v3.8.2 [49]. The Reps identified from this study are shown in blue and are grouped into the Genomoviridae family, 20 family-level clusters (CRESSV2, CRESSV6, A–Q), and 10 singletons.
Figure 2. The Rep amino acid maximum likelihood phylogenetic tree inferred with IQTree2 (Minh et al., 2020) [52] with Q.pfam + F + G4 substitution model identified as the best-fit model for the viruses in the Cressdnaviricota phylum. The family-level clustering for unclassified CRESS groups was determined by sequence similarity networks (SSN) of the amino acid sequences of the cressdnavirus Rep with a sequence similarity score of 60 using EFI-EST [44] and visualized with Cytoscape v3.8.2 [49]. The Reps identified from this study are shown in blue and are grouped into the Genomoviridae family, 20 family-level clusters (CRESSV2, CRESSV6, A–Q), and 10 singletons.
Microorganisms 12 00196 g002
Figure 3. Maximum likelihood phylogenetic relationship of the Rep protein sequences of representative sequences (species-level) of viruses in genera Gemyduguivirus, Gemykibivirus, and Gemycircularvirus. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] and rooted with Rep sequences of geminiviruses with LG + G + I as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font, and for gemycircularviruses, a zoomed-in section of phylogeny is shown.
Figure 3. Maximum likelihood phylogenetic relationship of the Rep protein sequences of representative sequences (species-level) of viruses in genera Gemyduguivirus, Gemykibivirus, and Gemycircularvirus. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] and rooted with Rep sequences of geminiviruses with LG + G + I as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font, and for gemycircularviruses, a zoomed-in section of phylogeny is shown.
Microorganisms 12 00196 g003
Figure 4. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in clusters CRESSV2. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with VT + I + G as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the CRESSV5 cluster. Sections of phylogeny are zoomed in to show the details in relation to the Reps from this study of the viruses that are part of the CRESSV2 cluster. All sequences from this study are highlighted in blue font.
Figure 4. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in clusters CRESSV2. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with VT + I + G as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the CRESSV5 cluster. Sections of phylogeny are zoomed in to show the details in relation to the Reps from this study of the viruses that are part of the CRESSV2 cluster. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g004
Figure 5. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters CRESSV6 (rooted with redondovirus Rep sequences) and Clusters A, B, and C (rooted with CRESSV5 Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with LG + I + G for the CRESSV2 cluster and LG + I + G + F for Clusters A, B, and C as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Figure 5. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters CRESSV6 (rooted with redondovirus Rep sequences) and Clusters A, B, and C (rooted with CRESSV5 Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with LG + I + G for the CRESSV2 cluster and LG + I + G + F for Clusters A, B, and C as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g005
Figure 6. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters D and E (both rooted with CRESSV5 Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with LG + I + G + F for Cluster D cluster and RtRev + I + G + F for Cluster E as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Figure 6. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters D and E (both rooted with CRESSV5 Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with LG + I + G + F for Cluster D cluster and RtRev + I + G + F for Cluster E as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g006
Figure 7. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Cluster F. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with LG + I + G as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the redondoviruses. The sequence from this study is highlighted in blue font.
Figure 7. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Cluster F. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with LG + I + G as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the redondoviruses. The sequence from this study is highlighted in blue font.
Microorganisms 12 00196 g007
Figure 8. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Cluster G. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with RtRev + I + G + F as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the redondoviruses. All sequences from this study are highlighted in blue font.
Figure 8. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Cluster G. The maximum likelihood phylogenetic tree was inferred using PhyML 3 [56] with RtRev + I + G + F as best-fit model determined using ProtTest 3 [55] and rooted with Rep sequences from the redondoviruses. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g008
Figure 9. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters H, I, and J (all rooted with redondovirus Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with RtRev + I + G + F for Cluster H, VT + I + G + F for Cluster I, and LG + I + G + F for Cluster J as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Figure 9. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters H, I, and J (all rooted with redondovirus Rep sequences). The maximum likelihood phylogenetic trees of each cluster were inferred using PhyML 3 [56] with RtRev + I + G + F for Cluster H, VT + I + G + F for Cluster I, and LG + I + G + F for Cluster J as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g009
Figure 10. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters K, L, M, N, O, P, and Q. The maximum likelihood phylogenetic trees of each cluster with Reps of geminiviruses for Cluster K, CRESSV6 for Clusters L and M, and redondoviruses for Clusters O, P, and Q, and rooting sequences were inferred using PhyML 3 [56] with LG + I + G + F (Cluster K), LG + I + G (Clusters M and N), and RtRev + I + G + F (Clusters O, P, and Q) as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Figure 10. Maximum likelihood phylogenetic relationship of the Rep protein sequences of unclassified cressdnaviruses in Clusters K, L, M, N, O, P, and Q. The maximum likelihood phylogenetic trees of each cluster with Reps of geminiviruses for Cluster K, CRESSV6 for Clusters L and M, and redondoviruses for Clusters O, P, and Q, and rooting sequences were inferred using PhyML 3 [56] with LG + I + G + F (Cluster K), LG + I + G (Clusters M and N), and RtRev + I + G + F (Clusters O, P, and Q) as best-fit models determined using ProtTest 3 [55]. All sequences from this study are highlighted in blue font.
Microorganisms 12 00196 g010
Figure 11. Maximum likelihood cladogram of the major capsid protein (MCP) sequences from members of the Microviridae family inferred using IQTree2 with LG + F + G4 (Minh et al., 2020) [52] determined as the best-fit amino acid substitution model. Branches are shown with branch support > 0.8 aLRT. Sub-families Bullavirinae, Gokushovirinae, putative families Alpavirinae, Parabacteroides, and Pichovirinae are shown in different-colored clades.
Figure 11. Maximum likelihood cladogram of the major capsid protein (MCP) sequences from members of the Microviridae family inferred using IQTree2 with LG + F + G4 (Minh et al., 2020) [52] determined as the best-fit amino acid substitution model. Branches are shown with branch support > 0.8 aLRT. Sub-families Bullavirinae, Gokushovirinae, putative families Alpavirinae, Parabacteroides, and Pichovirinae are shown in different-colored clades.
Microorganisms 12 00196 g011
Table 1. Summary of the BLASTn analysis of the virus genomes identified in this study showing top hits with genome coverage, e-value, and percentage identity. Those with—indicate they had no BLASTn hit.
Table 1. Summary of the BLASTn analysis of the virus genomes identified in this study showing top hits with genome coverage, e-value, and percentage identity. Those with—indicate they had no BLASTn hit.
Top BLASTn Hit
ClusterAccessionVirusHit CoverageE Value% IdentityHit Accession
GenomovirusOP549794Genomoviridae sp. D1_73438%1 × 10−8375.51%MW678940
GenomovirusOP549795Genomoviridae sp. D2_1183100%097.94%MW678959
GenomovirusOP549796Plant-associated genomovirus 2 GnOP3_BA76427%6 × 10−4473.26%MH939416
CRESSV2OP549818Circoviridae sp. CN13_L19_111922%1 × 10−2065.49%MT208232
CRESSV2OP549828Cressdnaviricota sp. Miresoil virus 17012%2 × 10−4277.54%OM154655
CRESSV2OP549833Circoviridae sp. CN13_L15_254413%2 × 10−3869.90%MT203404
CRESSV2OP549837Circoviridae sp. CN13_L18_5545%2 × 10−1779.49%MT207945
CRESSV2OP549843Circoviridae sp. CN13_L03_57245%2 × 10−13875.24%MT201433
CRESSV6OP549820CRESS virus sp. ctWTK55864%7 × 10−8865.79%MW202429
AOP549845Banfec virus 6 V16_S08b15%1 × 10−3773.98%OQ599930
BOP549827Cressdnaviricota sp. Miresoil virus 4075%4 × 10−0874.55%OM154420
BOP549846Cressdnaviricota sp Miresoil virus 47614%2 × 10−2973.53%OM154360
COP549840Virus sp. D12_124453%1 × 10−4565.68%MW678878
DOP549841Cressdnaviricota sp. ctje11114%2 × 10−1768.53%MH616648
EOP549838Sewage-associated circular DNA virus-17 NZ-BS4236-201237%5 × 10−12073.39%KM821752
FOP549819Avon-Heathcote Estuary-associated circular virus 3 NZ-3887G-20128%1 × 10−1571.35%KM874297
GOP549825Chicken circovirus 2 CCV-237%7 × 10−8169.69%MN420497
GOP549831Chicken circovirus 4 CCV-438%1 × 10−3868.44%MN428454
GOP549836Chicken circovirus 4 CCV-430%4 × 10−4667.50%MN428454
GOP549839Chicken circovirus 4 CCV-4100%090.87%MN428454
HOP549817Crucivirus-93 GP1_930019%3 × 10−1967.64%MT263542
HOP549832Cruciviridae sp. CRUV-29-F31%7 × 10−2967.35%KX388508
IOP549826Cressdnaviricota sp. Miresoil virus 4075%4 × 10−0874.55%OM154420
JOP549797Capybara virus 5_cap1_46010%8 × 10−1769.80%MK570167
JOP549821Egret CRESS-DNA virus egret0349%9 × 10−9968.37%MT797255
JOP549823Sewage-associated circular DNA virus-36 NZ-BS3974-201248%9 × 10−15672.43%KM821748
JOP549851Trichosanthes kirilowii geminiviridae pt111-gem-56%9 × 10−1072.79%MN823663
KOP549822Gopherus-associated circular DNA virus 3 Tor32714%2 × 10−1868.63%MK858257
LOP549824-----
MOP549834Circoviridae sp. CN55_L18_36724%6 × 10−3366.39%MT207798
NOP549842Cressdnaviricota sp. Miresoil virus 41845%4 × 10−9069.28%OM154411
OOP549844Capybara virus 15_cap1_29410%7 × 10−1069.66%MK570177
POP549829Cressdnaviricota sp. Miresoil virus 17012%2 × 10−4277.54%OM154655
POP549830Apis mellifera virus-5 BNH86154%079.92%MH973774
QOP549835Uncultured virus clone CG13533%2 × 10−4466.06%KY487806
SingletonOP549847Crucivirus sp. Crucivirus-391 001074_virusbaton7%1 × 10−1768.86%MT478484
SingletonOP549848-----
SingletonOP549849Circoviridae sp. CN3_L17_5541%0.00492.31%MT206222
SingletonOP549850Cressdnaviricota sp. Miresoil virus 55716%9 × 10−2368.20%OM154279
SingletonOP549852-----
SingletonOP549853-----
SingletonOP549854-----
SingletonOP549855Cressdnaviricota sp. Miresoil virus 3868%0.03968.02%OM154441
SingletonOP549856Cressdnaviricota sp. Miresoil virus 3883%0.03975.32%OM154439
SingletonOP549857-----
MicrovirusOP549798Tortoise microvirus 72_SP_4144%1 × 10−11572.38%MK765625
MicrovirusOP549799Microviridae sp. ctdg53415%1 × 10−3867.76%MH616940
MicrovirusOP549800Microviridae sp. ctdg53420%6 × 10−6169.09%MH616940
MicrovirusOP549801Microviridae sp. ctci54954%7 × 10−16271.14%MH617187
MicrovirusOP549802Apis mellifera-associated microvirus 29 INH_SP_23513%1 × 10−3868.86%MH992203
MicrovirusOP549803Microviridae sp. CN7_L19_25581%070.73%MT208143
MicrovirusOP549804Microviridae sp. Dog0634%3 × 10−17269.41%MG883726
MicrovirusOP549805Arizlama microvirus AZLM_32952%6 × 10−13674.36%MW697640
MicrovirusOP549806Microviridae sp. ctba7133%5 × 10−6869.33%MH616766
MicrovirusOP549807Arizlama microvirus AZLM_38031%7 × 10−10472.45%MW697604
MicrovirusOP549808Microvirus sp. 6433_7431%1 × 10−10672.40%MT310103
MicrovirusOP549809Arizlama microvirus AZLM_27435%4 × 10−17069.40%MW697684
MicrovirusOP549810Microviridae sp. SD_MC_2412%2 × 10−3367.44%MH572460
MicrovirusOP549811Microvirus sp. BS1_38565%3 × 10−14669.91%MT309971
MicrovirusOP549812Robinz microvirus RP_383%1 × 10−1173.91%MZ364230
MicrovirusOP549813Microviridae sp. ctbi78025%6 × 10−9870.78%MH622931
MicrovirusOP549814Microvirus sp. BS1_38562%5 × 10−12472.73%MT309971
MicrovirusOP549815Tortoise microvirus 93_SP_13120%9 × 10−4566.97%MK765646
MicrovirusOP549816Tortoise microvirus 93_SP_13122%7 × 10−4066.06%MK765646
Table 2. Summary of the RCR and SF3 helicase motifs identified in the Reps of the cressdnaviruses from this study.
Table 2. Summary of the RCR and SF3 helicase motifs identified in the Reps of the cressdnaviruses from this study.
ClusterAccessionMotif IMotif IIMotif IIIGRS DomainWalker AWalker BMotif C
GenomovirusOP549794LLTYAQIHLHVKAYDYAIKDVFDVGGYHPNIERVGGESQLGKTLWARAIFDDIWLAN
GenomovirusOP549795LLTYAQTHYHAKMFDYATKRAFDVDGYHPNILRGIGPTRTGKTSWARAVFDDIWCNN
GenomovirusOP549796LVTYAQTHLHVKGWEYATKHIFDVDGYHPNVVPGYGPTRLGKTVWARAVFDDMWLSN
CRESSV2OP549818VFTWNNEHLQGQAHTYCKK GPSGTGKSHFISIWLDDVVTSN
CRESSV2OP549828CFTINNPHLQGQNHKYCTK GETGSGKSKSVRVCIDDFVTSQ
CRESSV2OP549833CFTLNGKHLQCQNRRYCIK GNTGAGKSYLARILLDDFVTSN
CRESSV2OP549837VFTLNNPHLQGQAKAYCQK GDPKAGKSEGARIIIEDMVTSN
CRESSV2OP549843TFTINTPHFQGQNYDYCSK GPPRTGKSHKARVLIDELVTSN
CRESSV6OP549820ALTYSNDHFHAAWLTYIKK GESGIGKTNWAKIIFDDVFTAN
AOP549845FLTINNPHIQGACIIYCTK GPAGCRKTRTAVIIIDDFITCE
BOP549827IYTLNNPHLQGDAANYCMK GPTGVGKTRSVVTLFDDYITCP
BOP549846TFTLNNPHLQGAAINYCMK GETGAGKTRYVFALLDDFITAP
COP549840VFTINNPHLQGQAIIYCEK GPTGSGKSRYAWAIIDDFVTCP
DOP549841VVTFWCHHWQASNAKYCSK GSTGRGKSHRTFVIINEFVNSS
EOP549838CFTLNNPHLQGSNREYCSK GLPGVGKSRRAHVIIDDFVTSN
FOP549819ILTIPVHHWQIAADKYVHK GGSGLGKTRRAWVIIDEFITSN
GOP549825AFTLNNPHLQGDSCYYCVK SRGGAGKSYFARIIIIDIIFAN
GOP549831CFTLNNPHLQGDNDAYCGG TEGNVGKSAFTKLIIWDMIFSN
GOP549836CFTLNNPHLQGINLKYCSK SIGNIGKSAFIKCIMFDIIFAN
GOP549839IMVLNNPHLQGQNDIYCSK RPGHFGKSQFVKCVMFDICFAN
HOP549817DFTIWALHYQGGEPFYVLK PEGASGKSTLRNLYVLDLVFTN
HOP549832DFTIKELHYQGDNNFYVMK TQGNNGKSTLKALYILDIVFMN
IOP549826LLTYGKEHMHVNAKNYLAK PVGGSGKTQFAKGLIFNLVFAN
JOP549797FLTYSQFHLHGRVLHYTQKRLFDVGIYHPNIGALRGASRTGKTTWARIILDDIHLCN
JOP549821FLTYSQIHYHVRCRHYLRKDIFDFGGCHAIQPIKNGPTRLGKTDWARLVIDDFWLCN
JOP549823FLTYSQIHFHVNRRHYIRKNIFDCAGYHPNILPIRGPTECGKSVWARLVLDDMWICN
JOP549851LLTYAQQHFHCNCWEYCTKRAFDIGQNHPNIKRVGGPTRTGKTIWARLIMDDFYICN
KOP549822FLTYSRFHLHGKTLNYIYKRFLDITGP[DGTVY]HPKLEPVKGPTKTGKSAWARVVFDDIILCN
LOP549824FLTYPQLHLHVAVMRYCTK GPTNSGKTALAKIIYDEAFTSN
MOP549834AYTDFQKHIQGQNFVYCSK GPTNIGKTQFAIIVFDDMFTYN
NOP549842FLTYSQFHLHCKCLAYVIK GESGVGKSTIATVVIEDIITSN
OOP549844FLTYPQHHIHANVIKYCTK TKPNLGKTFLFGVVLDEYVLSN
POP549829FLTYAQPHMHVAIKKYCMK GPSNTGKSFWLRLWADEYICSN
POP549830LLTYPQPHIHARSHKYCQK GPSNSGKSYWLTLFSDEYIVSN
QOP549835FITFPQQHLHIAAIAYITK GVANVGKTTIISAYIDEFILSN
SOP549847KFTPQKLHYQCALQAYSMK PSGQVGKTWFGNCYIIDLVFAN
SOP549848CFTLNNPHVQGQARDYCCK GNTGTGKSTYARVVLDEFAISN
SOP549849CFTLNNHHLQGQARDYCRK GPTGCGKTSTAYVLIDDFITTN
SOP549850LFTLWLRHFQSQNIDYCTK GSSGTGKTRFAYVLFDDYITSN
SOP549852FLTYQSPHRHVKCCFYMCK -YLVVSLVVAN
SOP549853AMTINNRHIHVGWIKYCMK -VNYEELLYFN
SOP549854WLTVNPFHLHADSGQYVFE --LYTL
SOP549855FLTYAQPHRHCNCAKYVLK GDTGSGKSKYARVLLEDVITSN
SOP549856VFTINYHHIQGEARDYALK GETGRGKTRRAAVLFDDFITSN
SOP549857CLTHYGEHQQAEARKYCMK GDTGTGKSHLAHMIINEFLTSP
Table 3. Summary of the pairwise identity of the Rep amino acid sequences of the cressdnaviruses identified in this study with their top hits. Percentage pairwise identity determined using SDT v1.2 [58].
Table 3. Summary of the pairwise identity of the Rep amino acid sequences of the cressdnaviruses identified in this study with their top hits. Percentage pairwise identity determined using SDT v1.2 [58].
Top Rep Hit
ClusterAccessionVirusRep % IdentityAccession
GenomovirusOP549794Gemycircularvirus gemy-ch-rat159.7KR912221
GenomovirusOP549796Cybaeus spider-associated circular virus 2 BC_I1644B_C360.3MH545507
GenomovirusOP549795Genomoviridae sp. D2_1183100MW678959
CRESSV2OP549818Diporeia sp.-associated circular virus LM348745.8KC248416
CRESSV2OP549837Sewage-associated circular DNA virus-20 NZ-BS3900-201248.4KM821755
CRESSV2OP549833Uncultured virus clone CG26148.2KY487930
CRESSV2OP549843Cressdnaviricota sp. ctdb9756.3MH510276
CRESSV2OP549828Antarctic circular DNA molecule COCH21_V_9457.2MN328284
CRESSV6OP549820Circovirus-like genome DCCV-247.0KT149395
AOP549845Arizlama virus AZLM_101151.3MW697465
BOP549827Uncultured virus clone CG26742.6KY487936
BOP549846Uncultured virus clone CG26744.0KY487936
COP549840Virus sp. D12_124463.8MW678878
DOP549841Cressdnaviricota sp. ctcd61045.4MH649031
EOP549838Sewage-associated circular DNA virus-17 SaCV-17_NZ-BS4236-201272.1KM821752
FOP549819Avon-Heathcote Estuary-associated circular virus 26 NZ-2311TU-201248.4KM874359
GOP549831Cressdnaviricota sp. ctcd82854.0MH649233
GOP549825Chicken circovirus 2 strain CCV-263.2MN420497
GOP549836Chicken circovirus 4 CCV-458.8MN428454
GOP549839Chicken circovirus 4 CCV-498.6MN428454
HOP549832Cressdnaviricota sp. ctca15653.3MH616996
HOP549817Cressdnaviricota sp. ctbb59348.4MH648954
IOP549826Crucivirus-124 BS_31342.6MT263552
JOP549821Ancient caribou feces associated virus53.3KJ938716
JOP549823Sewage-associated circular DNA virus-36 NZ-BS3974-201264.9KM821748
JOP549851Genomoviridae sp. 6538_33236.9MT309820
JOP549797Genomoviridae sp. 6434_40045.8MT309859
KOP549822Genomoviridae sp. 6538_30247.6MT309829
LOP549824Uncultured virus clone CG10440.9KY487775
MOP549834Crucivirus-243 SR3_4249747.4MT263577
NOP549842Virus sp. D6_82147.4MW678874
OOP549844Cressdnaviricota sp. ctcj37058.6MH617003
POP549830Apis mellifera virus-5 BNH86185.7MH973774
POP549829Capybara virus 8_cap1_3646.2MK570170
QOP549835Uncultured virus clone CG13552.0KY487806
SingletonOP549847McMurdo Ice Shelf pond-associated circular DNA virus-8 alg49-5735.4KJ547653
SingletonOP549848Red panda feces-associated circular DNA virus 7 Rpf101envir01-839.1MZ556225
SingletonOP549849Dipodfec virus UA04Rod_453741.4OM869597
SingletonOP549850False black widow spider-associated circular virus 1 BC_I1659B_H241.4MH545542
SingletonOP549852Sewage-associated circular DNA virus-13 NZ-BS4044-201234.6KJ547624
SingletonOP549853Cressdnaviricota sp. Miresoil virus 25126.4OM154576
SingletonOP549854Cressdnaviricota sp. ctcc23334.2MH617714
SingletonOP549855Cressdnaviricota sp. Miresoil virus 41833.9OM154411
SingletonOP549856Circovirus sp. panda38437.5MZ556112
SingletonOP549857Avon-Heathcote Estuary-associated circular virus 19 NZ-4942GA-201229.9KM874347
Table 4. Summary of the pairwise identity of the MCP amino acid sequences of the microviruses identified in this study with their top hits. Percentage pairwise identity determined using SDT v1.2 [58].
Table 4. Summary of the pairwise identity of the MCP amino acid sequences of the microviruses identified in this study with their top hits. Percentage pairwise identity determined using SDT v1.2 [58].
Top MCP Hit
Subfamily/CladeAccessionVirusMCP % IdentityAccession
UnclassifiedOP549798Tortoise microvirus 7265.4%MK765625
Alphavirinae-cladeOP549799Microviridae sp. ctcf58638.1%MH617122
Alphavirinae-cladeOP549800Microvirus sp. BS1_235,37.3%MT310011
Alphavirinae-cladeOP549801Microviridae sp. Flamingo0558.2%MG883728
GokushovirinaeOP549802Microviridae sp. ctcf65048.0%MH62292
GokushovirinaeOP549803Apis mellifera associated microvirus 28 INH_SP_21471.2%MH992195
UnclassifiedOP549804Microvirus sp. 1712115_73271.4%MT310269
GokushovirinaeOP549805Microvirus sp. 6433_5270.0%MT310113
Pichovirinae-cladeOP549806Microviridae sp. ctba7159.9%MH616766
UnclassifiedOP549807Apis mellifera associated microvirus 42 INH_SP_29267.4%MH992217
UnclassifiedOP549808Microvirus sp. 1712115_73271.9%MT310269
GokushovirinaeOP549809Arizlama microvirus AZLM_25972.3%MW697690
Pichovirinae-cladeOP549810Microviridae sp. SD_MC_5351.9%MH572461
GokushovirinaeOP549811Microviridae sp. ctsGZ29976.4%MW202558
GokushovirinaeOP549812Microviridae sp. ctgc09143.9%MH617728
GokushovirinaeOP549813Arizlama microvirus AZLM_32965.6%MW697640
GokushovirinaeOP549814Microvirus sp. BS1_38577.1%MT309971
Pichovirinae-cladeOP549815Microviridae sp. ctcf88056.40%MH617497
Pichovirinae-cladeOP549816Microviridae sp. ctcf88056.6%MH617497
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Olivo, D.; Khalifeh, A.; Custer, J.M.; Kraberger, S.; Varsani, A. Diverse Small Circular DNA Viruses Identified in an American Wigeon Fecal Sample. Microorganisms 2024, 12, 196. https://doi.org/10.3390/microorganisms12010196

AMA Style

Olivo D, Khalifeh A, Custer JM, Kraberger S, Varsani A. Diverse Small Circular DNA Viruses Identified in an American Wigeon Fecal Sample. Microorganisms. 2024; 12(1):196. https://doi.org/10.3390/microorganisms12010196

Chicago/Turabian Style

Olivo, Diego, Anthony Khalifeh, Joy M. Custer, Simona Kraberger, and Arvind Varsani. 2024. "Diverse Small Circular DNA Viruses Identified in an American Wigeon Fecal Sample" Microorganisms 12, no. 1: 196. https://doi.org/10.3390/microorganisms12010196

APA Style

Olivo, D., Khalifeh, A., Custer, J. M., Kraberger, S., & Varsani, A. (2024). Diverse Small Circular DNA Viruses Identified in an American Wigeon Fecal Sample. Microorganisms, 12(1), 196. https://doi.org/10.3390/microorganisms12010196

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop