Next Article in Journal
Paralytic and Amnesic Shellfish Toxins Impacts on Seabirds, Analyses and Management
Previous Article in Journal
Tentacle Morphological Variation Coincides with Differential Expression of Toxins in Sea Anemones
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Analysis of High Molecular Mass Compounds from the Spider Pamphobeteus verdolaga Venom Gland. A Transcriptomic and MS ID Approach

by
Sebastian Estrada-Gómez
1,2,*,
Leidy Johana Vargas-Muñoz
3,
Cesar Segura Latorre
1,4,
Monica Maria Saldarriaga-Cordoba
5 and
Claudia Marcela Arenas-Gómez
6,†
1
Grupo de Toxinología—Serpentario, Facultad de Ciencias Farmacéuticas y Alimentarias, Universidad de Antioquia UdeA, Carrera 53 No. 61-30, Medellín 050010, Colombia
2
Facultad de Ciencias Farmacéuticas y Alimentarias, Universidad de Antioquia UdeA, Calle 70 No. 52-21, Medellín 050010, Colombia
3
Facultad de Medicina, Universidad Cooperativa de Colombia, Calle 50 A No. 41-20, Medellín 050012, Colombia
4
Unidad de Espectrometría de Masas, Sede de Investigación Universitaria, Universidad de Antioquia UdeA, Carrera 53 No. 61-30, Medellín 050010, Colombia
5
Centro de Investigación en Recursos Naturales y Sustentabilidad, Universidad Bernardo O’Higgins, Avenida Viel 1497, Santiago 7750000, Chile
6
Grupo de Génetica, Regeneración y Cáncer, Universidad de Antioquia UdeA, Carrera 53 No. 61-30, Medellín 050010, Colombia
*
Author to whom correspondence should be addressed.
Current address: Vidarium, Nutrition, Health and Wellness Research Center, Nutresa Business Group, Calle 8 Sur No. 50-67, Medellín 050023, Colombia.
Toxins 2021, 13(7), 453; https://doi.org/10.3390/toxins13070453
Submission received: 21 April 2021 / Revised: 5 June 2021 / Accepted: 8 June 2021 / Published: 29 June 2021
(This article belongs to the Section Animal Venoms)

Abstract

:
Nowadays, spider venom research focuses on the neurotoxic activity of small peptides. In this study, we investigated high-molecular-mass compounds that have either enzymatic activity or housekeeping functions present in either the venom gland or venom of Pamphobeteus verdolaga. We used proteomic and transcriptomic-assisted approaches to recognize the proteins sequences related to high-molecular-mass compounds present in either venom gland or venom. We report the amino acid sequences (partial or complete) of 45 high-molecular-mass compounds detected by transcriptomics showing similarity to other proteins with either enzymatic activity (i.e., phospholipases A2, kunitz-type, hyaluronidases, and sphingomyelinase D) or housekeeping functions involved in the signaling process, glucanotransferase function, and beta-N-acetylglucosaminidase activity. MS/MS analysis showed fragments exhibiting a resemblance similarity with different sequences detected by transcriptomics corresponding to sphingomyelinase D, hyaluronidase, lycotoxins, cysteine-rich secretory proteins, and kunitz-type serine protease inhibitors, among others. Additionally, we report a probably new protein sequence corresponding to the lycotoxin family detected by transcriptomics. The phylogeny analysis suggested that P. verdolaga includes a basal protein that underwent a duplication event that gave origin to the lycotoxin proteins reported for Lycosa sp. This approach allows proposing an evolutionary relationship of high-molecular-mass proteins among P. verdolaga and other spider species.
Key Contribution: The description of the presence of high-molecular-mass compounds in the tarantula Pamphobeteus verdolaga by transcriptomic and MS ID approach.

Graphical Abstract

1. Introduction

Spider venom is a complex mixture of pharmacologically active peptides, proteins, and inorganic compounds. Most spider venom toxins can be classified into one of three groups, depending on their molecular mass i.e., low (<1 kDa), medium (1–10 kDa), and high (>10 kDa) [1]. To date, the vast majority of transcriptomic and proteomic analyses have focused on medium-molecular-mass peptides, since these compounds are the main ones responsible for the toxic effects produced by spider venoms (except in the Theridiidae family).
High-molecular-mass compounds (HMMC) are more commonly distributed among spider venoms than is described in the literature [1]. Most of the HMMC reported correspond to proteins with housekeeping activity, and venom proteins with enzymatic activities have been described in the Theraphosidae species Ornithoctonus huwena, Grammostola iheringi, Chilobrachys jingzhao, Haplopelma hainanum, and Haplopelma schmidti [2,3,4,5,6]. The transcriptomic analysis of these species´ venom glands showed different sequences clustered as kunitz-type toxins (KTTs), phospholipases, and zinc metalloproteinases, among others. The primary role of these compounds is the degradation of the extracellular matrix (collagenase, hyaluronidase, and proteases) and the underlying cell membrane [1].
Pamphobeteus verdolaga (Cifuentes, Perafán, and Estrada-Gomez 2016) is a recently described species endemic to Colombia that is native to the Andean region from the Aburrá Valley (Medellín) to the southwest region of Antioquia in the municipality of Jardin located at 2100 m above sea level (m.a.s.l) [7]. Taxonomically, the male P. verdolaga has a palpal bulb with broad embolus, poorly developed apical keel, prolateral inferior keel and prolateral accessory keel present but poorly developed, and retrolateral keel of similar length as the apical keel. Females are distinguished by the morphology of spermatheca with a wide base and very short oval seminal receptacles, which are curved toward the center [7]. A previous P. verdolaga venom report suggests the presence of peptides such as EF-hand proteins, jingzhaotoxins, theraphotoxins, hexatoxins, and inhibitory cysteine knots (ICK) peptides and uncommon proteins in the Theraphosidae family such as sphingomyelinases (sicaritoxin), barytoxins, hexatoxins, latroinsectotoxins, and linear (zadotoxins) peptides [8,9]. The last analysis of P. verdolaga venom indicated that this tarantula is an important source of active disulfide-rich peptides that potentially modulate voltage-gated calcium and sodium channels [10].
In this study, we conducted a more detailed transcriptomic and proteomic analysis focused on the description of HMMC in both the venom gland and venom itself. Our main goal is to describe the HMMC (with enzymatic activity or housekeeping functions) encoded by the venom gland-cells and to confirm their presence in the venom (secretion).

2. Results

2.1. Transcriptomic Findings

In the venom gland transcriptome of P. verdolaga, we identified 45 transcripts (with e-values > 1 × 10−5 and scores >50) coding for the putative protein ORFs previously reported, corresponding to phospholipases A2, phospholipases D, phospholipases B, kunitz-type serine protease inhibitors (KTSPI), hyaluronidases, lycotoxins toxins, CRISP proteins, hephaestin-like protein and venom metalloproteinase (see Table 1A–I, respectively). All translated sequences correspond to partial or full-length sequences, as shown in Section S1 on Supplementary File S1. Transcriptome abundance can be found on Supplementary File S2.
Sixteen contigs shared a significant resemblance with phospholipase A2 from Groups II, XV, and XIIA from various organisms, some of them corresponding to fragments (see Table 1A and Section S1 on Supplementary File S1). Sequences phospholipaseA2-8-pverdolaga, phospholipaseA2-9-pverdolaga, and phospholipaseA2-16-pverdolaga fulfill the parameters to be considered complete PLA2 sequences indicating possible complete sequences (see Figure 1A and Section S1 on Supplementary File S1). PhospholipaseA2-9-pverdolaga showed 14 Cys and was annotated by hmmr and cdd domain (NCBI) (Supplementary Files S1 and S3). Although most of the P. verdolaga phospholipases A2 matched phospholipases reported in the spider Stegodyphus mimosarum, six sequences matched phospoholipases from three different ants (Lasius niger, Harpegnathos saltator, and Cam0ponotus floridanus), one lizard (Anolis carolinensis), and one tick (Ixodes scapularis). Phospholipases matching the spider S. mimosarum showed a high degree of similarity, particularly in the sequence alignment of phospholipaseA2-3-pverdolaga (c15998) that matched a Group XV phospholipase A2 from S. mimosarum (UniProtKB—A0A087U096) with a >80% similarity (see Figure 1B). The phylogenetic analysis suggests multiple duplication events that led to the huge diversification of the phospholipase A2 in P. verdolaga and supports (branch support >50%) the high similarity of these sequences with proteins reported for different spider families, e.g., Theridiidae, Araneidae, and Sicariidae (Figure S1 on Supplementary File S1).
In addition, the analysis revealed the presence of four different contigs matching phospholipase D proteins (PLDs) reported in other spiders (Loxosceles sp., Sicarius sp., and Stegodyphus sp.) and mites (Metaseiulus occidentalis) (see Table 1B). At least two sequences, phospholipaseD-1-pverdolaga and phospholipaseD-2-pverdolaga, may correspond to the complete sequence conserving the cysteine residues necessary to form disulfide bridges characteristic in PLD isolated from Loxoceles (see Table 1B, Figure 1C,D, and Section S1 on Supplementary File S1). One of the MS/MS fragments (Fragment H) matched one of the PLD transcribed sequences detected (c14372_g1_i1) (see Table 2). Additionally, one more sequence showed relation to a phospholipase B reported in spider Parasteatoda tepidariorum (see Table 1C).
In the P. verdolaga venom gland transcriptome, we also found 13 contigs encoding members of the less common family of venom proteins known as kunitz-type serine protease inhibitors (KTSPI) (see Table 1D and Section S1 on Supplementary File S1). At least five sequences, kunitz-2-pverdolaga, kunitz-3-pverdolaga, kunitz-6-pverdolaga, kunitz-9-pverdolaga, and kunitz-13-pverdolaga, may correspond to the complete sequence conserving the cysteine residues necessary to form both disulfide bridges characteristics to kunitz toxins from Theraphosidaes. Out of all the described sequences, ten transcripts showed similarity to KTSPI reported in spiders, six of them matching different KTSPI from H. schmidti (Theraphosidae). Only three transcripts matched KTPSI from organisms that are not spiders (ant, tick, and mite). The match between the KTPSI and an external protein is presented in Figure 2, showing kunitz-13-pverdolaga from P. verdolaga aligned with a KTPSI from H. schmidti. The presence of this class of proteins in P. verdolaga venom was supported by the MS/MS identification of a peptide exhibiting 42.6% similarity with the amino acid sequence translated from contig 66767 (kunitz-9-pverdolaga) (see Table 2). Furthermore, the phylogenetic analysis suggested that the kunitz-type protein in P. verdolaga underwent multiple duplication events, diversifying this protein family in this species, indicating that sequences c41726 and c66767 are orthologous (branch supports > 50%) with Araneus ventricosus (see Figure S2 on Supplementary File S1).
Two additional translated sequences of hyaluronidase-like proteins were detected and one of the contigs disclosed shows a sequence similarity of ~94% to hyaluronidase J9XYC6 from B. vagans (Theraphosidae) (see Figure 3) and had high transcriptional support (see Table 1E and Section S1 on Supplementary File S1).
One MS/MS fragment matching the hyaluronidase sequence of hyaluronidase-2-pverdolaga (c51925) was detected with a similarity of 100% (see Table 2 below). Hyaluronidase-2-pverdolaga sequence contains two characteristic domains present in other hyaluronidases, the EGF-like domain, comprised of Cys332, Cys343, Cys337, Cys371, Cys373, and Cys383, and the catalytic domain comprised of Cys17, Cys183, Cys196, and Cys307 (see Figure 4, Supplementary Files S1 and S3).
Additionally, three translated sequences showed similarity to lycotoxins from Lycosa singoriensis and S. minmosarum, as well as to lycotoxins-like isoforms from different organisms, i.e., flies (see Table 1F and Section S1 on Supplementary File S1). The characteristic cysteine ICK motif is maintained in all sequences, potentially forming 4–5 disulfide bridges (see Figure 5). The phylogenetic analysis of the main members of the lycotoxin protein family reported in Uniprot suggested that P. verdolaga includes a basal protein (c28990) of the lycotoxin protein family, which underwent a duplication event that led to the origin of the lycotoxin ortholog protein from Lycosa sp. (see Figure S4 on Supplementary File S1). Additionally, P. verdolaga has two proteins closely related (c3316 and c13977) to the lycotoxin U20 of Lycosa singoriensis (Uniprot B6DD61). One of the MS/MS fragments, showing 100% similarity with the lycotoxin U16-lycotoxin-Ls1a, is highly similar to the contig c40556 (see Section S1 on Supplementary File S1).
Furthermore, we identified three more transcripts similar to the toxin family of cysteine-rich secretory proteins (CRISPs) showing high similarity (up to 95% similarity) with other CRISPs reported on Grammostola rosea (Theraphosidae) (see Table 1G). One transcript was identified by MS/MS (see Table 2) and had high transcriptional support with a TPM of 18191.29.
Finally, we found two more sequences that have the multicopper oxidase domine present (PF07732) (see Table 1H) and one more similar to the zinc metalloproteases that would be an important modulator of the hemostatic system [7] (see Table 1I). Based on phylogenetic analysis, P. verdolaga metalloproteinase is related to A. ventricosus (branch support 44%) (see Figure S3 on Supplementary File S1).
In addition to the previously detected HMMC, different proteins with catalytic activity, such as hydrolase, lipases, oxidoreductases, and peptidase, were identified by gene ontology terms using the Panther database (Supplementary File S1).

2.2. MS Findings

P. verdolaga crude venom fractionation by reverse-phase (rp-HPLC) yielded 35 fractions, distributed in two main regions, in accordance with the previous description of P. verdolaga venom (see Figure 6).
After the local search of similarity analysis, using the FASTA program (fastm36) and the transcriptomic information as the database, 81 MS/MS fragments showed similarities to different HMMC. From this group, 10 fragments had similarities with proteins enhancing enzymatic activities including hyaluronidase, lycotoxin, cysteine-rich secretory protein (CRISP), phospholipase D, and kunitz-type (see Table 2 and Section S1 on Supplementary File S1). The MS/MS approach allowed the identification of three fragments that are 100% similar to four contigs identified by transcriptomic analysis (see Table 2 and Section S1 on Supplementary File S1).
Table 2. Assignment of the rp-HPLC fractions from P. verdolaga venom, isolated as observed in Figure 6, matching high-molecular-mass compound protein families with enzymatic activities from venom gland transcriptomic database.
Table 2. Assignment of the rp-HPLC fractions from P. verdolaga venom, isolated as observed in Figure 6, matching high-molecular-mass compound protein families with enzymatic activities from venom gland transcriptomic database.
rp-HPLCPeptide SequenceSimilarityBest MatchProtein Family
6Y-GMDFVPLLKSYGILV-N100%c51925_g1_i1Hyaluronidase
6R-TIKDWYK-G80%c40556_g1_i1Lycotoxin
21–22K-SFPTVLTSSSMSFTK-K84.6%c9919_g1_i1CRISP
R-TGPQVKGEK-S77.8%c9919_g1_i1
K-DWYKEIK-D55.2%c9919_g1_i1
K-VATGKETQYSMPK-A100%c9919_g1_i1
7R-DSANGFINK-I73%c14372_g1_i1Phospholipases D
K-ESGYNDK-Y
6P-STYGGGLSVSSR-F42.6%c66767_g1_i1Kunitz-type
The local and non-redundant external database Basic Local Alignment Search Tool (BLASTP) was used to search for similarities in the MS/MS fragments and match HMMC with enzymatic functions (see Table 3). BLASTP showed high similarity with other proteins reported in spiders from different genera, matching the same protein family as those identified by the local search using the transcriptomic info. Only two fragments did not match any fragments previously reported in the Araneae order (see Table 3).
Seventy-one more fragments showed a similarity above 75% with proteins matching housekeeping and cellular process proteins such as actin, ubiquitin, protein phosphatase, and heat shock protein (see Table 4). Twenty-two of these MS/MS fractions showed a similarity of 100% with proteins such as actin and heat shock proteins (see Table 4 and Section S2 on Supplementary File S1). The complete sequences of all transcripts are presented in Section S2 on Supplementary File S1. Other HMMC were detected in the rp-HPLC fractions with a similarity below 75% (data not shown).

3. Discussion

Spider venoms are a rich source of molecules with a diverse range of antibacterial, antifungal, antiviral, antimalarial, and anticancer bioactivities [12,13,14]. In this study, we described a combined venom gland transcriptomic and proteomic analysis of the Colombian Tarantula P. verdolaga, which revealed the presence of a wide array of novel proteins, including phospholipase D, phospholipase B, phospholipase A2, lycotoxin-like, kunitz-type serine protease inhibitors, and hyaluronidases.
Transcriptomic analysis showed the venom gland expression of 16 different PLA2-coding-like transcripts. Although no MS/MS fragments of any of the PLA2 transcripts were detected, the presence of these toxins is supported by previous studies of the P. verdolaga venom, where an estimated a minimum hemolytic dose (MHeD) of 307.1 µg was previously detected [8]. Three sequences (phospholipaseA2-8-pverdolaga, phospholipaseA2-9-pverdolaga, and phospho-lipaseA2-16-pverdolaga) fulfilled some characteristics to be considered as complete PLA2 sequences, including sequence similitude, molecular weight, number of cysteines, and cysteine–cysteine assembling pattern to form the respective disulfide bridges. PhospholipaseA2-8-pverdolaga has a similar cysteine pattern to a PLA2 from S. mimosarum, although, only showed the possible formation of 5 disulfide bridge including the characteristic Cys11-Cys77 disulfide bridge of Group I PLA2 (Supplementary File S3) [15,16]. PhospholipaseA2-9-pverdolaga is a 16-cysteine residue Group XIIA PLA2 of 216 amino acid residues length (~23.5 KDa), containing a signal peptide, with a mature protein potentially forming eight disulfide bridges (between cysteines 1 and 8, 2 and 12, 3 and 4, 5 and 16, 6 and 13, 7 and 10, 9 and 11, and 14 and 15) similar to the cloned Group XIIA-1 PLA2, indicating that phospholipaseA2-9-pverdolaga may be part of this PLA2 family [17]. However, the position and distribution of the cysteine residues is distinct from this PLA2. PhospholipaseA2-16-pverdolaga’s 774 amino acid residue length (~85 KDa) is similar to the phospholipase A-2-activating protein from Ixodes scapularis, a 805 amino acid residue length (~87 KDa) with 25 cysteine residues. Mature phospholipaseA2-16-pverdolaga with 23 cysteine residues that can potentially form 11 disulfide bridges (between cysteines 1 and 4, 2 and 6, 3 and 7, 5 and 17, 9 and 14, 10 and 18, 11 and 12, 13 and 21, 15 and 22, 16 and 23, and 19 and 20) with a different cysteine pattern when compared with the phospholipase A-2-activating protein cysteine pattern from Ixodes scapularis. The phylogenetic analysis showed multiple duplication events undergone during the evolution of phospholipase A2 in P. verdolaga (see Figure S1). Functional analysis could help to identify whether these gene redundancies are proteins with different functions. However, duplication events have been reported in spider venom proteins, which may help the species to adapt to the environment (e.g., prey capture and defense) [18]. Other kinds of lipases corresponding to PLD proteins were detected, although these proteins are not commonly distributed or reported in the Theraphosidae family and instead have been widely studied in the Sicariidae family [19]. The presence of these lipase proteins has been reported in the venom and venom gland of H. hainanum (Theraphosidae), together with different PLA2 and PLB proteins fragments and coding transcripts [2]. PhospholipaseD-1-pverdolaga (358 amino acids length) and phospholipaseD-2-pverdolaga (275 amino acids length) have the same number of cysteines and disulfide bridges, but the pattern is different (between cysteines 1 and 2, 3 and 4, 3 and 1, 3 and 4, and 2 and 3) when compared to the respective similar PLD. Additionally, the phospholipaseD-1-pverdolaga amino acid sequence conserved the active site amino acid residues (H32, E52, D54, H68, and D112) required to bind Mg2+ indicating that phospholipaseD-1-pverdolaga may be a complete PLD sequence including the disulfide bridges and active sites [20,21]. In arachnids, the presence of phospholipases may be associated with their ability to destroy lipid membranes, allowing other venom components to spread across tissues. The physio-pathological activity of these kind of proteins is clinically relevant, because these are the ones responsible for said venom’s dermonecrotic and inflammatory effects, the latter impairing the kidney’s normal function [22]. However, envenomation that involves infant patients or causes acute renal failure may result in a life-threatening situation, even if the amount of venom injected is considerably low (1–6 mg) [8]. This clinical picture strongly suggests the hitherto unreported presence of these proteins in P. verdolaga venom.
KTSPI proteins are HMMCs that have mainly been described and biologically characterized in snakes and bees (including wasps), and they impair enzymatic activities by blocking ion channels, altering blood coagulation, and interfering with inflammatory processes [23,24,25,26,27]. The biological function of these proteins in the spider venoms comprises activity in trypsin or chymotrypsin inhibition, K+ channel blocking, plasmin inhibitor, and an elastase inhibitor [28]. Although KTSPI proteins have been identified in species of the Mygalomorphae families, i.e., the brush-foot trapdoor spider Trittame loki (Barychelidae) [3,29,30,31], nearly all the KTSPI were isolated and reported from the species H. hainanum and H. schmidti [2]. From H. hainanum, 16 sequences were clustered as belonging to the kunitz-type toxins venom family and showed a native kunitz-type architecture, according to their number of cysteine residues [2]. In the venom gland transcriptome of P. verdolaga, 13 different KTSPI sequences were found. Seven of these P. verdolaga KTSPIs showed resemblance (e-values > 1 × 10−10) to that of T. loki (Barychelidae), H. hainanum, and to other KTSPI proteins from other species (see Figure 2). The presence of this group of proteins was confirmed by proteomics of P. verdolaga venom. Sequences from kunitz-2-pverdolaga, kunitz-3-pverdolaga, kunitz-6-pverdolaga, kunitz-9-pverdolaga and kunitz-13-pverdolaga showed the same cysteine–cysteine pattern forming all three disulfide bridges between cysteines 1 and 6, 2 and 4, and 3 and 5, according to Zweckstetter et al. and the disulfide prediction [32].
Hyaluronidases are the most commonly reported enzyme in spider venoms, and these proteins embody other HMMCs found in P. verdolaga venom [1]. These extracellular matrix-degrading proteins denote hyaluronan and facilitates venom spreading across vertebrate’s tissues. However, hyaluronidase is unlikely to play a key role in predation of invertebrates, indicating that it might play a defensive role [1]. According to Arachnoserver (http://arachnoserver.org/mainMenu.html accessed on 29 August 2019), three separate hyaluronidases belonging to three different spider families (Ctenidae, Sicariidae and Theraphosidae) have been reported to date. We had the opportunity to find two different contigs encoding two separate hyaluronidases. The first (hyaluronidase-2-pverdolaga) showed 94% similarity to B. vagans hyaluronidase-1 (BvHyal—J9XYC6). The second was the hyaluronidase-2-pverdolaga, a 414-amino acid protein with 12 cysteines that can potentially form six disulfide bonds. This hyaluronidase from P. verdolaga has the well preserved cysteine scaffold described on hyaluronidase-1-Brachypelma vagans, with the cysteine residues essential for catalytic activity in the same position (Cys17, Cys183, Cys196, and Cys307), which are essential for the catalytic activity [11]. In addition, the EGF-like domain, comprised of Cys332, Cys343, Cys336, Cys371, Cys373, and Cys383, is also present in the hyaluronidase-2 from P. verdolaga with one difference on amino acid position 332, where an asparagine (N) takes the place of a cysteine (C), which is in the position 337 [11]. Cysteine residues Cys176 and Cys218 are also present, allowing the potential formation of a sixth disulfide bond [11]. These two residues have been proposed to have a role in reinforcing the stability of the catalytic site in Arachnida hyaluronidases [11]. The same cysteine residues on hyaluronidase-2-pverdolaga are highlighted in Figure 4. The presence of this group of proteins was confirmed by proteomics of P. verdolaga venom.
Additionally, transcriptomic analysis of P. verdolaga, revealed three medium-molecular-mass compoundeds corresponding to “lycotoxin-like” peptides previously reported in the Eresidae and Lycosidae families, both unrelated or alien to the Mygalomorphae suborder to which P. verdolaga is taxonomically assigned. Two sequences showed an ICK motif previously described in the Theridiidae Latrodectus tredecimguttatus [33]. One more contig (c40556) may correspond to a lycotoxin from P. verdolaga. Although this contig is not similar to any reported protein, one MS/MS fragment similar to c40556 showed similarity to U16-lycotoxin-Ls1a from Lycosa singoriensis, indicating that c40556 may be a new member (new sequence) of the lycotoxin family. In addition, the phylogenetic analysis (see Figure S4) suggests (branch supports > 50%) that this sequence could be related to the lycotoxin protein family. In the phylogenetic tree, one of the lycotoxin-like sequence in P. verdolaga was located with good branch support (100%) as a basal protein from the lycotoxin protein family, which could be supported with the divergence time among spider families, since Theraphosidae (P. verdolaga family) diverged from a common ancestor 200 MYA (million years ago), while the family of Lycosa diverged 57 MYA [34]. Lycotoxins are a wide group of peptides that function as insecticides and pore formers, increasing the membrane permeability and cell lysis widely reported in the Lycosa genera [35,36]. Other HMMCs found in P. verdolaga venom with clinical importance are those with the domain multicopper oxidase and the venom metalloproteinases, which can attack the hemostatic system of prey [7].
Combined transcriptomic and proteomic analysis showed the presence of different HMMCs with housekeeping or cellular process proteins in P. verdolaga venom. Those housekeeping HMMCs detected by transcriptomic and proteomic analysis (previously reported in spider venoms) correspond to proteins where their biological function in spiders has not been determined. There were important cytoskeleton and structure transcripts expressed in the venom gland of P. verdolaga, including PDZ and LIM domain proteins and actin proteins, which are the main proteic components involved in the formation of filaments of the cytoskeleton [37,38]. The presence of actin in the venom gland of spiders, as well as other organisms, is proposed to be a structural component that allows venom gland contractile activity; these proteins are considered as ubiquitous components of the cytoskeleton, as previously reported in Theraphosidae spiders C. jingzhao and Citharischius crawshayi [4,37,39,40]. The presence of this HMMC or nontoxic compounds, is still unknown, but Yuan et al. [4] proposed that these nontoxic compounds may play a synergic role on the toxins in the venom, have some kind of unknown role in the venoms, or house-keeping proteins are secreted during the secretion of toxins to keep toxin-producing cells and the venom gland functional [4]. They could also be a contaminant, as proposed by Duan et al. in the venom of Latrodectus tredecimguttatus [41]. Heat shock proteins are chaperonins proteins that are involved in the direct folding and assembly of cellular proteins, as previously reported in the transcriptome of the Theraphosidae spiders C. jingzhao. According to Chen et al., this protein may be important for the secretion of toxin and regenerative proteins [37,42]. Other proteins are involved in nucleic acid metabolic process, including histones and zinc finger proteins, as previously described by Borges et al. in the venom of a G. iheringi (Theraphosidae) [5]. Although proteins such as cytosolic purine 5′-nucleotidase, dystonin, intersectin, and other enzymes which correspond to different proteins were previously described in other arachnids from the Theraphosidae family, e.g., Grammostola rosea and Brachypelma smithi, their function remains unknown. Additionally, contigs c16774_g1_i2, c5016_g1_i1, and c34105_g1_i1 showed 98–99% similarity with polyubiquitins and ubiquitins reported in other organisms (Section S2 on Supplementary File S1). Ubiquitin is a small and highly conserved polypeptide of 76 amino acids reported in different organisms that is involved in proteins degradation [43] and (in mammals) in the posttranslational modifications of plasma membrane proteins and voltage-gated sodium channels (Nav) in a process called ubiquitylation [44]. Although the role of this protein in spider venoms is not clear (besides the role in silk glands and proteins degradation [43,45]), it may be involved in the Nav activation after envenomation, since P. verdolaga ubiquitin’s similarity and a conserved domain at the α-subunit C-terminal make Nav potential targets for the ubiquitins. The activation of these channels may play an important role during envenomation, facilitating the action of toxins and affecting Nav, which plays a synergic role, the later being previously reported in P. verdolaga [10].

4. Conclusions

Here, we present an update on the venom gland transcriptome and proteome from Pamphobeteus verdolaga. We report the amino acid sequences of different HMMCs with enzymatic activity or housekeeping functions present in their venom gland and venom, some of which are described for the first time in a species of the Theraphosidae family.

5. Materials and Methods

5.1. Spider Collection and Venom Extraction

Female P. verdolaga specimens were collected in the locality of La Estrella-Pueblo Viejo, Antioquia Province, Colombia. Venom from five specimens was obtained as previously described [8]. Identification was carried out according to the taxonomic description by Cifuentes et al. [7]. Venom extraction was conducted in accordance with: (a) the ethical principles in animal research adopted by the World Health Organization for the characterization of venoms [46,47]; and (b) the “Comité Institucional para el Cuidado y Uso de Animales” (CICUA). After each extraction, all animals were kept alive in captivity. Specimen collection was performed under National Agency for Ambient Licenses (ANLA according to the initials in Spanish) resolution 00908 2019 emitted to the University of Antioquia as a framework agreement.

5.2. Venom Fractionation

The venom profile of P. verdolaga was obtained using a combination of reverse-phase high-pressure liquid chromatography (rp-HPLC) and mass spectrometry (MS). First, 1 mg of crude venom was dissolved in 200 μL of solution A (0.1% trifluoroacetic acid in water) and centrifuged at 3500× g for 5 min at room temperature. Then, the supernatant was fractionated using a C18 rp-HPLC analytical column (250 × 4.6 mm RESTEK), balanced, and eluted initially at a flow rate of 1.0 mL/min isocratically using 5% of solution B (acetonitrile 99%) for 5 min, followed by a linear gradient of 5–15% B for 10 min, 15–45% B for 60 min, and 45–70% B for 12 min [48]. The chromatographic separation was monitored at 215 nm and fractions were collected manually, lyophilized, and stored at −20 °C until used.

5.3. Proteomic Analysis

LC-MS/MS

rp-HPLC fractions were run on a nano-Eksigent 425 HPLC system paired to a Triple-TOF 5600 plus (Sciex, Framingham, MA, USA) mass spectrometry system. The RP-HPLC system was run for 120 min at 300 nL/min over the cHiPLC nanoflex system. The trap column was a nano-cHiPLC (200 μm × 0.5 mm ChromXP C18-CL 3 μm 120 Å) and the analytical column, a nano-cHiPLC (75 μm × 15 cm ChromXP C18-CL 5 μm 120 Å). Elution was done with a gradient of 0.1% formic acid in water (A) and acetonitrile (B), of 5–35% B for 90 min, 35–80% B for 2 min, 80% B for 5 min, and 80–5% B for 20 min. The sample was sprayed to the Triple-TOF 5600 plus through a Nanospray III source equipped with an emission tip from New Objective.

5.4. Data Analysis

MS/MS spectra were interpreted manually or using a licensed version of ProteinLynx Global (Server version 2.5.2 software from Waters, Waters, Manchester, UK) or a free version of MASCOT (http://www.matrixscience.com, accessed on 29 August 2019). The ProteinLynx searches were made using tryptic digestion with 2 missed cleavages. The peptide tolerance was set to 10 ppm, while fragment tolerance and estimated calibration error were set to 0.05 and 0.005 Da, respectively. Carbamidomethyl cysteine and oxidation of methionine were fixed as well as variable modifications [49]. Triple-TOF MS/MS spectra acquired for 50 precursor ions at 250 ms/scan were analyzed using Mascot Daemon v.2.4.0 (Matrix Science, Boston, MA, USA) against different databases i.e., UniProt, NCBI or ArachnoServer [49,50,51]. The proteomic raw material can be found on the Supplementary Materials (see Section S3 on Supplementary File S1).

5.5. Transcriptomic Analysis

For the transcriptomic analysis, we used the DNA material isolated and amplificated from our previous report [10]. The transcriptomic analysis used to identify the HMMCs was performed similarly as carried out in our previous report with some modifications. Briefly, we used all contigs/singlets and translated them in six frames. Ortholog proteins were recovered using tBLASTX and tBLASTN programs (Sweet Version 2.28). Cleaving signals for each transcript were predicted using the stand-alone tool Spider|ProHMM (http://arachnoserver.org/peptides.html) (accessed on 29 August 2019), which uses a combination of SignalP v4.1 (http://www.cbs.dtu.dk/services/SignalP/ (accessed on 29 August 2019) and an HMM to predict signal and propeptide sites, respectively. After the prediction of hypothetical cleavage sites, mature peptides were aligned using the Clustal omega program [52]. The abundance of transcript abundance was measured by TPM using RSEM as was described by Estrada-Gomez et al. [10]. The MS/MS fragments identified from the venom of P. verdolaga by rp-HPLC matching were aligned to the reference transcriptome of P. verdolaga to identify the peptide similarity using the pipeline of FASTA program (fastm36) [53]. The best model for amino acid substitution and the phylogenetic analysis was estimated by Maximum-Likelihood using branch supports with the ultrafast bootstrap IQ-TREE [54]. All trees were run sampling 1000 replicates and trees were edited using iTOL [55]. The quality data of the transcriptomic material can be consulted at [10].
Finally, toxins validated via transcriptomic and proteomic analysis were uploaded into the European Nucleotide Archive ENA under accession: PRJEB21288/ERS1788422/ERX2067777-ERR2008012.

5.6. Nomenclature

Peptides and proteins identified by proteomic or transcriptomic experiments were named following the rational nomenclature proposed by King et al. [56], with some modifications for proteins (masses above 20 kDa), i.e., - protein group, followed by the isoform number and the species name.

5.7. Signal Peptide and Disulfide Bond Prediction

Signal peptides were predicted using the on-line software SignalP 5.0 Server available at http://www.cbs.dtu.dk/services/SignalP/ (accessed on 25 May 2021) [57]. Disulfide bonds were predicted using the Cysteines Disulfide Bonding State and Connectivity Predictor, DiANNA and DISULFIND available at http://clavius.bc.edu/~clotelab/DiANNA/ (accessed on 25 May 2021) and http://disulfind.dsi.unifi.it/ (accessed on 19 September 2020), respectively, web-based tools for disulfide engineering in proteins [58,59,60].

5.8. Data Availability

The transcriptomic datasets generated during and/or analyzed during the current study are available in the European Nucleotide Archive (ENA) repository under accession: PRJEB21288/ERS1788422/ERX2067777-ERR2008012. The proteomic raw material can be found in the Supplementary Materials.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/toxins13070453/s1, Supplementary File S1: Section S1: Full-length translated sequences for putative protein ORFs corresponding to phospholipases A2, phospholipases D, phospholipases B, kunitz-type, hyaluronidases, lycotoxins toxins, CRISP proteins, Hephaestin-like protein, and venom metalloproteinase. Section S2: Full-length translated sequences for putative protein ORFs corresponding to proteins matching housekeeping and cellular process proteins. Section S3: Raw material of proteomic reports. Section S4: Gene ontology terms using the Panther database of the different proteins with catalytic activity. Figure S1. Phylogenetic tree of phospholipase A2. The tree includes sequences of phospholipase A2 reported for different spider families. P. verdolaga sequences (green) are orthologous with different species, grouped with good branch supports (>50%). Multiple duplication events occurred during the evolution of phospholipase A2 in P. verdolaga. The triangle represents collapsed sequences from other species used to build the tree. Phospholipase A2 from Ixodes scapularis was used as outgroup. Figure S2. Phylogenetic tree of kunitz-like protein family. The tree includes the kunitz reported in databases for different spider families. The Phylogenetic tree show that P. verdolaga sequences (green) are orthologous with different species, grouped with good branch supports (>50%). The triangle represents collapsed sequences from other species used to build the tree. Kunitz from Ixodes scapularis was used as outgroup. Figure S3. Phylogenetic tree of the metalloproteinase. The tree includes the metalloproteinase reported in databases for different spider families. The Phylogenetic tree show that P. verdolaga sequence (green) is orthologous with the sequences reported for Araneus ventricosus with a branch support of 44%. The triangle represents collapsed sequences from other species used to build the tree. Metalloproteinase sequence from Ixodes scapularis was used as outgroup. Figure S4. Phylogenetic tree of lycotoxin-like protein. The tree includes the lycotoxin-like proteins reported in databases for different spider families. The phylogenetic tree supports (branch support 100%) that P. verdolaga sequence c28990 is a basal protein that belong to the lycotoxin-like family in spiders and multiple duplication events allowed the diversification of the protein in different spider species. The triangle represents collapsed sequences from other species used to build the tree. lycotoxin from Tentranychus urticae was used as outgroup. Supplementary File S2: Transcriptome abundance. Supplementary File S3: Prediction of Cys-Cys formation of putative protein ORFs corresponding to phospholipases A2, phospholipases D, phospholipases B, kunitz-type, hyaluronidases, lycotoxins toxins, CRISP proteins, Hephaestin-like protein and venom metalloproteinase.

Author Contributions

S.E.-G. and C.S.L. contributed with the conceptualization, methodology design, and the transcriptomic/proteomic data interpretation/analysis. L.J.V.-M. and S.E.-G. contributed to the investigation and provided resources. M.M.S.-C. and C.M.A.-G. contributed to the formal analysis of bioinformatics, transcriptomic, and phylogenetic data. All authors contributed to writing—original draft preparation and writing—review and editing. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Universidad de Antioquia (UdeA) through the Programa de Gestión Tecnologica, Vicerectoría de Extensión—UdeA, and Comité para el Desarrollo de la Investigación CONADI, Universidad Cooperativa de Colombia.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Not applicable.

Acknowledgments

The authors are grateful for Jorge Asprilla and Janet García from the Serpentario—Universidad de Antioquia. We thank Emily Lucas for the revision and comments to the manuscript.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. King, G.F.; Hardy, M.C. Spider-venom peptides: Structure, pharmacology, and potential for control of insect pests. Annu. Rev. Entomol. 2013, 58, 475–496. [Google Scholar] [CrossRef] [PubMed]
  2. Cheng, T.C.; Long, R.W.; Wu, Y.Q.; Guo, Y.B.; Liu, D.L.; Peng, L.; Li, D.Q.; Yang, D.W.; Xu, X.; Liu, F.X.; et al. Identification and characterization of toxins in the venom gland of the Chinese bird spider, Haplopelma hainanum, by transcriptomic analysis. Insect Sci. 2016, 23, 487–499. [Google Scholar] [CrossRef] [PubMed]
  3. Jiang, L.; Peng, L.; Chen, J.; Zhang, Y.; Xiong, X.; Liang, S. Molecular diversification based on analysis of expressed sequence tags from the venom glands of the Chinese bird spider Ornithoctonus huwena. Toxicon 2008, 51, 1479–1489. [Google Scholar] [CrossRef]
  4. Yuan, C.; Jin, Q.; Tang, X.; Hu, W.; Cao, R.; Yang, S.; Xiong, J.; Xie, C.; Xie, J.; Liang, S. Proteomic and peptidomic characterization of the venom from the Chinese bird spider, Ornithoctonus huwena Wang. J. Proteome Res. 2007, 6, 2792–2801. [Google Scholar] [CrossRef]
  5. Borges, M.H.; Figueiredo, S.G.; Leprevost, F.V.; De Lima, M.E.; Cordeiro Mdo, N.; Diniz, M.R.; Moresco, J.; Carvalho, P.C.; Yates, J.R. Venomous extract protein profile of Brazilian tarantula Grammostola iheringi: Searching for potential biotechnological applications. J. Proteom. 2016, 136, 35–47. [Google Scholar] [CrossRef]
  6. Liao, Z.; Cao, J.; Li, S.; Yan, X.; Hu, W.; He, Q.; Chen, J.; Tang, J.; Xie, J.; Liang, S. Proteomic and peptidomic analysis of the venom from Chinese tarantula Chilobrachys jingzhao. Proteomics 2007, 7, 1892–1907. [Google Scholar] [CrossRef]
  7. Cifuentes, Y.; Estrada-Gomez, S.; Vargas Munoz, L.J.; Perafan, C. Description and molecular characterization of a new species of tarantula, Pamphobeteus verdolaga, from Colombia (Aranae: Mygalomorphae: Theraphosidae). Zoologia 2016, 33. [Google Scholar] [CrossRef] [Green Version]
  8. Estrada-Gomez, S.; Vargas Munoz, L.J.; Quintana Castillo, J.C. Extraction and partial characterization of venom from the Colombian spider Pamphobeteus aff. nigricolor (Aranae:Theraphosidae). Toxicon 2013, 76C, 301–309. [Google Scholar] [CrossRef] [PubMed]
  9. Estrada-Gomez, S.; Vargas-Munoz, L.J.; Saldarriaga-Cordoba, M.; Cifuentes, Y.; Perafan, C. Identifying different transcribed proteins in the newly described Theraphosidae Pamphobeteus verdolaga. Toxicon 2017, 129, 81–88. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  10. Estrada-Gomez, S.; Caldas Cardoso, F.; Vargas-Munoz, L.J.; Quintana-Castillo, J.C.; Arenas Gomez, C.M.; Pineda, S.S. Venomic, transcriptomic, and bioactivity analyses of Pamphobeteus verdolaga venom reveal complex disulfide-rich peptides that modulate calcium channels. Toxins 2019, 11, 496. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  11. Clement, H.; Olvera, A.; Rodriguez, M.; Zamudio, F.; Palomares, L.A.; Possani, L.D.; Odell, G.V.; Alagon, A.; Sanchez-Lopez, R. Identification, cDNA cloning and heterologous expression of a hyaluronidase from the tarantula Brachypelma vagans venom. Toxicon 2012, 60, 1223–1227. [Google Scholar] [CrossRef]
  12. Ortiz, E.; Gurrola, G.B.; Schwartz, E.F.; Possani, L.D. Scorpion venom components as potential candidates for drug development. Toxicon 2015, 93, 125–135. [Google Scholar] [CrossRef]
  13. Vargas Munoz, L.J.; Estrada-Gomez, S. Purification and Characterization of Venom Components as Source for Antibiotics. Mini-Rev. Org. Chem. 2014, 11, 15–27. [Google Scholar] [CrossRef]
  14. Vargas Munoz, L.J.; Estrada-Gomez, S.; Escobar, J. Snake and scorpion toxins venoms, a natural source of molecules with antimicrobial activity. Curare 2015, 2. [Google Scholar] [CrossRef]
  15. Kini, R.M. Structure-function relationships and mechanism of anticoagulant phospholipase A2 enzymes from snake venoms. Toxicon 2005, 45, 1147–1161. [Google Scholar] [CrossRef]
  16. Zhu, H.; Dupureur, C.M.; Zhang, X.; Tsai, M.D. Phospholipase A2 engineering. The roles of disulfide bonds in structure, conformational stability, and catalytic function. Biochemistry 1995, 34, 15307–15314. [Google Scholar] [CrossRef] [PubMed]
  17. Ho, I.C.; Arm, J.P.; Bingham, C.O., 3rd; Choi, A.; Austen, K.F.; Glimcher, L.H. A novel group of phospholipase A2s preferentially expressed in type 2 helper T cells. J. Biol. Chem. 2001, 276, 18321–18326. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  18. Haney, R.A.; Clarke, T.H.; Gadgil, R.; Fitzpatrick, R.; Hayashi, C.Y.; Ayoub, N.A.; Garb, J.E. Effects of Gene Duplication, Positive Selection, and Shifts in Gene Expression on the Evolution of the Venom Gland Transcriptome in Widow Spiders. Genome Biol. Evol. 2016, 8, 228–242. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  19. Dantas, A.E.; Carmo, A.O.; Horta, C.C.; Leal, H.G.; Oliveira-Mendes, B.B.; Martins, A.P.; Chavez-Olortegui, C.; Kalapothakis, E. Description of Loxtox protein family and identification of a new group of Phospholipases D from Loxosceles similis venom gland. Toxicon 2016, 120, 97–106. [Google Scholar] [CrossRef] [PubMed]
  20. Chaves-Moreira, D.; Souza, F.N.; Fogaça, R.T.; Mangili, O.C.; Gremski, W.; Senff-Ribeiro, A.; Chaim, O.M.; Veiga, S.S. The relationship between calcium and the metabolism of plasma membrane phospholipids in hemolysis induced by brown spider venom phospholipase-D toxin. J. Cell. Biochem. 2011, 112, 2529–2540. [Google Scholar] [CrossRef]
  21. Yao, Y.; Li, J.; Lin, Y.; Zhou, J.; Zhang, P.; Xu, Y. Structural insights into phospholipase D function. Prog. Lipid Res. 2021, 81, 101070. [Google Scholar] [CrossRef] [PubMed]
  22. Kudo, I.; Murakami, M. Phospholipase A2 enzymes. Prostaglandins Other Lipid Mediat. 2002, 68–69, 3–58. [Google Scholar] [CrossRef]
  23. Earl, S.T.H.; Richards, R.; Johnson, L.A.; Flight, S.; Anderson, S.; Liao, A.; De Jersey, J.; Masci, P.P.; Lavin, M.F. Identification and characterisation of Kunitz-type plasma kallikrein inhibitors unique to Oxyuranus sp. snake venoms. Biochimie 2012, 94, 365–373. [Google Scholar] [CrossRef]
  24. Mukherjee, A.K.; Mackessy, S.P.; Dutta, S. Characterization of a Kunitz-type protease inhibitor peptide (Rusvikunin) purified from Daboia russelii russelii venom. Int. J. Biol. Macromol. 2014, 67, 154–162. [Google Scholar] [CrossRef] [PubMed]
  25. Qiu, Y.; Lee, K.S.; Choo, Y.M.; Kong, D.; Yoon, H.J.; Jin, B.R. Molecular cloning and antifibrinolytic activity of a serine protease inhibitor from bumblebee (Bombus terrestris) venom. Toxicon 2013, 63, 1–6. [Google Scholar] [CrossRef] [PubMed]
  26. Chang, L.-s.; Chung, C.; Huang, H.-B.; Lin, S.-r. Purification and Characterization of a Chymotrypsin Inhibitor from the Venom of Ophiophagus hannah (King Cobra). Biochem. Biophys. Res. Commun. 2001, 283, 862–867. [Google Scholar] [CrossRef]
  27. Yang, X.; Wang, Y.; Lu, Z.; Zhai, L.; Jiang, J.; Liu, J.; Yu, H. A novel serine protease inhibitor from the venom of Vespa bicolor Fabricius. Comp. Biochem. Physiol. Part B Biochem. Mol. Biol. 2009, 153, 116–120. [Google Scholar] [CrossRef] [PubMed]
  28. Wan, H.; Lee, K.S.; Kim, B.Y.; Zou, F.M.; Yoon, H.J.; Je, Y.H.; Li, J.; Jin, B.R. A spider-derived Kunitz-type serine protease inhibitor that acts as a plasmin inhibitor and an elastase inhibitor. PLoS ONE 2013, 8, e53343. [Google Scholar] [CrossRef] [PubMed]
  29. Tang, X.; Zhang, Y.; Hu, W.; Xu, D.; Tao, H.; Yang, X.; Li, Y.; Jiang, L.; Liang, S. Molecular diversification of peptide toxins from the tarantula Haplopelma hainanum (Ornithoctonus hainana) venom based on transcriptomic, peptidomic, and genomic analyses. J. Proteome Res. 2010, 9, 2550–2564. [Google Scholar] [CrossRef]
  30. Yuan, C.H.; He, Q.Y.; Peng, K.; Diao, J.B.; Jiang, L.P.; Tang, X.; Liang, S.P. Discovery of a distinct superfamily of Kunitz-type toxin (KTT) from tarantulas. PLoS ONE 2008, 3, e3414. [Google Scholar] [CrossRef]
  31. Undheim, E.A.; Sunagar, K.; Herzig, V.; Kely, L.; Low, D.H.; Jackson, T.N.; Jones, A.; Kurniawan, N.; King, G.F.; Ali, S.A.; et al. A proteomics and transcriptomics investigation of the venom from the barychelid spider Trittame loki (brush-foot trapdoor). Toxins 2013, 5, 2488–2503. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  32. Zweckstetter, M.; Czisch, M.; Mayer, U.; Chu, M.L.; Zinth, W.; Timpl, R.; Holak, T.A. Structure and multiple conformations of the kunitz-type domain from human type VI collagen alpha3(VI) chain in solution. Structure 1996, 4, 195–209. [Google Scholar] [CrossRef] [Green Version]
  33. He, Q.; Duan, Z.; Yu, Y.; Liu, Z.; Liu, Z.; Liang, S. The venom gland transcriptome of Latrodectus tredecimguttatus revealed by deep sequencing and cDNA library analysis. PLoS ONE 2013, 8, e81357. [Google Scholar] [CrossRef] [Green Version]
  34. Kumar, S.; Stecher, G.; Suleski, M.; Hedges, S.B. TimeTree: A Resource for Timelines, Timetrees, and Divergence Times. Mol. Biol. Evol. 2017, 34, 1812–1819. [Google Scholar] [CrossRef]
  35. Yan, L.; Adams, M.E. Lycotoxins, antimicrobial peptides from venom of the wolf spider Lycosa carolinensis. J. Biol. Chem. 1998, 273, 2059–2066. [Google Scholar] [CrossRef] [Green Version]
  36. Hughes, S.R.; Dowd, P.F.; Hector, R.E.; Panavas, T.; Sterner, D.E.; Qureshi, N.; Bischoff, K.M.; Bang, S.S.; Mertens, J.A.; Johnson, E.T.; et al. Lycotoxin-1 insecticidal peptide optimized by amino acid scanning mutagenesis and expressed as a coproduct in an ethanologenic Saccharomyces cerevisiae strain. J. Pept. Sci. 2008, 14, 1039–1050. [Google Scholar] [CrossRef]
  37. Chen, J.; Zhao, L.; Jiang, L.; Meng, E.; Zhang, Y.; Xiong, X.; Liang, S. Transcriptome analysis revealed novel possible venom components and cellular processes of the tarantula Chilobrachys jingzhao venom gland. Toxicon 2008, 52, 794–806. [Google Scholar] [CrossRef]
  38. Diego-Garcia, E.; Peigneur, S.; Waelkens, E.; Debaveye, S.; Tytgat, J. Venom components from Citharischius crawshayi spider (Family Theraphosidae): Exploring transcriptome, venomics, and function. Cell. Mol. Life Sci. 2010, 67, 2799–2813. [Google Scholar] [CrossRef]
  39. Zhang, B.; Liu, Q.; Yin, W.; Zhang, X.; Huang, Y.; Luo, Y.; Qiu, P.; Su, X.; Yu, J.; Hu, S.; et al. Transcriptome analysis of Deinagkistrodon acutus venomous gland focusing on cellular structure and functional aspects using expressed sequence tags. BMC Genom. 2006, 7, 152. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  40. Liang, S. Proteome and peptidome profiling of spider venoms. Expert Rev. Proteom. 2008, 5, 731–746. [Google Scholar] [CrossRef]
  41. Duan, Z.G.; Yan, X.J.; He, X.Z.; Zhou, H.; Chen, P.; Cao, R.; Xiong, J.X.; Hu, W.J.; Wang, X.C.; Liang, S.P. Extraction and protein component analysis of venom from the dissected venom glands of Latrodectus tredecimguttatus. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2006, 145, 350–357. [Google Scholar] [CrossRef] [PubMed]
  42. Gething, M.-J.; Sambrook, J. Protein folding in the cell. Nature 1992, 355, 33–45. [Google Scholar] [CrossRef] [PubMed]
  43. Fernandes-Pedrosa Mde, F.; Junqueira-de-Azevedo Ide, L.; Gonçalves-de-Andrade, R.M.; Kobashi, L.S.; Almeida, D.D.; Ho, P.L.; Tambourgi, D.V. Transcriptome analysis of Loxosceles laeta (Araneae, Sicariidae) spider venomous gland using expressed sequence tags. BMC Genom. 2008, 9, 279. [Google Scholar] [CrossRef] [Green Version]
  44. Laedermann, C.J.; Decosterd, I.; Abriel, H. Ubiquitylation of voltage-gated sodium channels. Handb. Exp. Pharmacol. 2014, 221, 231–250. [Google Scholar] [CrossRef]
  45. Cui, Y.; Zhu, Y.; Lin, Y.; Chen, L.; Feng, Q.; Wang, W.; Xiang, H. New insight into the mechanism underlying the silk gland biological process by knocking out fibroin heavy chain in the silkworm. BMC Genom. 2018, 19, 215. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  46. Oukkache, N.; Chgoury, F.; Lalaoui, M.; Cano, A.A.; Ghalim, N. Comparison between two methods of scorpion venom milking in Morocco. J. Venom. Anim. Toxins Incl. Trop. Dis. 2013, 19, 5. [Google Scholar] [CrossRef] [Green Version]
  47. World Health Organization. Progress in the Characterization of Venoms and Standardization of Antivenoms; WHO Offset Publication: Geneva, Switzerland, 1981; pp. 1–44. [Google Scholar]
  48. Fernandez, J.; Gutierrez, J.M.; Angulo, Y.; Sanz, L.; Juarez, P.; Calvete, J.J.; Lomonte, B. Isolation of an acidic phospholipase A2 from the venom of the snake Bothrops asper of Costa Rica: Biochemical and toxicological characterization. Biochimie 2010, 92, 273–283. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  49. Herzig, V.; Wood, D.L.A.; Newell, F.; Chaumeil, P.-A.; Kaas, Q.; Binford, G.J.; Nicholson, G.M.; Gorse, D.; King, G.F. ArachnoServer 2.0, an updated online resource for spider toxin sequences and structures. Nucleic Acids Res. 2011, 39, D653–D657. [Google Scholar] [CrossRef] [Green Version]
  50. UniProt. UniProt: The universal protein knowledgebase. Nucleic Acids Res. 2017, 45, D158–D169. [Google Scholar] [CrossRef] [Green Version]
  51. NCBI. Database Resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2017, 44, D7–D19. [Google Scholar] [CrossRef] [Green Version]
  52. Goujon, M.; McWilliam, H.; Li, W.; Valentin, F.; Squizzato, S.; Paern, J.; Lopez, R. A new bioinformatics analysis tools framework at EMBL-EBI. Nucleic Acids Res. 2010, 38, W695–W699. [Google Scholar] [CrossRef]
  53. Pearson, W.R. Finding Protein and Nucleotide Similarities with FASTA. Curr. Protoc. Bioinform. 2016, 53, 3–9. [Google Scholar] [CrossRef]
  54. Nguyen, L.T.; Schmidt, H.A.; von Haeseler, A.; Minh, B.Q. IQ-TREE: A fast and effective stochastic algorithm for estimating maximum-likelihood phylogenies. Mol. Biol. Evol. 2015, 32, 268–274. [Google Scholar] [CrossRef] [PubMed]
  55. Letunic, I.; Bork, P. Interactive Tree Of Life (iTOL) v4: Recent updates and new developments. Nucleic Acids Res. 2019, 47, W256–W259. [Google Scholar] [CrossRef] [Green Version]
  56. King, G.F.; Gentz, M.C.; Escoubas, P.; Nicholson, G.M. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon 2008, 52, 264–276. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  57. Almagro Armenteros, J.J.; Tsirigos, K.D.; Sønderby, C.K.; Petersen, T.N.; Winther, O.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat. Biotechnol. 2019, 37, 420–423. [Google Scholar] [CrossRef] [PubMed]
  58. Ceroni, A.; Passerini, A.; Vullo, A.; Frasconi, P. DISULFIND: A disulfide bonding state and cysteine connectivity prediction server. Nucleic Acids Res. 2006, 34, W177–W181. [Google Scholar] [CrossRef] [Green Version]
  59. Ferrè, F.; Clote, P. Disulfide connectivity prediction using secondary structure information and diresidue frequencies. Bioinformatics 2005, 21, 2336–2346. [Google Scholar] [CrossRef] [Green Version]
  60. Ferrè, F.; Clote, P. DiANNA: A web server for disulfide connectivity prediction. Nucleic Acids Res. 2005, 33, W230–W232. [Google Scholar] [CrossRef] [Green Version]
Figure 1. Pamphobeteus verdolaga phospholipases sequence. (A) PLA2 complete sequences of contigs c12950, c18752, and c60448. For all sequences, residues highlighted in grey indicate the signal peptide, while magenta highlighted residues indicate the propeptide according to Spider|ProHMM, from the arachnoserver. Residues highlighted in yellow show cysteines potentially forming disulfide bridges. (B) Pairwise sequence alignment of mature phospholipaseA2-3-pverdolaga (c15998) from P. verdolaga with a phospholipase A2 from Stegodyphus mimosarum (UniProtKB—A0A087U096). For all alignments, * (asterisk) indicates positions which have a single, fully conserved residue; : (colon) indicate conservation between groups of strongly similar properties, scoring >0.5; and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5. (C) PLD complete sequences of contigs c46024 and c14372. (D) Pairwise sequence alignment of phospholipaseD-1-pverdolaga (c46024) from P. verdolaga with a phospholipase D from Loxosceles intermedia (UniProtKB—Q1W694).
Figure 1. Pamphobeteus verdolaga phospholipases sequence. (A) PLA2 complete sequences of contigs c12950, c18752, and c60448. For all sequences, residues highlighted in grey indicate the signal peptide, while magenta highlighted residues indicate the propeptide according to Spider|ProHMM, from the arachnoserver. Residues highlighted in yellow show cysteines potentially forming disulfide bridges. (B) Pairwise sequence alignment of mature phospholipaseA2-3-pverdolaga (c15998) from P. verdolaga with a phospholipase A2 from Stegodyphus mimosarum (UniProtKB—A0A087U096). For all alignments, * (asterisk) indicates positions which have a single, fully conserved residue; : (colon) indicate conservation between groups of strongly similar properties, scoring >0.5; and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5. (C) PLD complete sequences of contigs c46024 and c14372. (D) Pairwise sequence alignment of phospholipaseD-1-pverdolaga (c46024) from P. verdolaga with a phospholipase D from Loxosceles intermedia (UniProtKB—Q1W694).
Toxins 13 00453 g001aToxins 13 00453 g001b
Figure 2. Pamphobeteus verdolaga sequence alignments. Pairwise sequence alignment of the protein sequence encoded in transcript c9496 (kunitz-13-pverdolaga) and the kunitz-type serine protease inhibitor huwentoxin-11 (κ-theraphotoxin-Hs1a) from H. schmidti (UniProt P68425). * (asterisk) indicates positions which have a single, fully conserved residue; : (colon) indicates conservation between groups of strongly similar properties, scoring >0.5; and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5.
Figure 2. Pamphobeteus verdolaga sequence alignments. Pairwise sequence alignment of the protein sequence encoded in transcript c9496 (kunitz-13-pverdolaga) and the kunitz-type serine protease inhibitor huwentoxin-11 (κ-theraphotoxin-Hs1a) from H. schmidti (UniProt P68425). * (asterisk) indicates positions which have a single, fully conserved residue; : (colon) indicates conservation between groups of strongly similar properties, scoring >0.5; and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5.
Toxins 13 00453 g002
Figure 3. Pamphobeteus verdolaga sequence alignments. Pairwise sequence alignment of the amino acid sequence encoded in transcript c51925 (hyaluronidase-2-pverdolaga) and hyaluronidase J9XYC6 from Brachypelma. vagans. * (asterisk) indicates positions which have a single, fully conserved residue, : (colon) indicate conservation between groups of strongly similar properties, scoring >0.5 and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5.
Figure 3. Pamphobeteus verdolaga sequence alignments. Pairwise sequence alignment of the amino acid sequence encoded in transcript c51925 (hyaluronidase-2-pverdolaga) and hyaluronidase J9XYC6 from Brachypelma. vagans. * (asterisk) indicates positions which have a single, fully conserved residue, : (colon) indicate conservation between groups of strongly similar properties, scoring >0.5 and . (period) indicates conservation between groups of weakly similar properties, scoring ≤0.5.
Toxins 13 00453 g003
Figure 4. Mature hyaluronidase-2 translated from Pamphobeteus verdolaga. Cysteines’ pattern distribution of mature hyaluronidase-2-pverdolaga protein. Cysteines’ position are Cys17, Cys176, Cys183, Cys196, Cys218, Cys307, Cys332, Cys337, Cys343, Cys371, Cys373, and Cys383. Yellow highlighted residues correspond to cysteines’ residues involved in the catalytic domain according to the work in [11]. Red highlighted residues correspond to cysteines’ residues involved in the EGF-like domain according to the work in [11]. Green highlighted residues correspond to any known hyaluronidase domain according to the work in [11].
Figure 4. Mature hyaluronidase-2 translated from Pamphobeteus verdolaga. Cysteines’ pattern distribution of mature hyaluronidase-2-pverdolaga protein. Cysteines’ position are Cys17, Cys176, Cys183, Cys196, Cys218, Cys307, Cys332, Cys337, Cys343, Cys371, Cys373, and Cys383. Yellow highlighted residues correspond to cysteines’ residues involved in the catalytic domain according to the work in [11]. Red highlighted residues correspond to cysteines’ residues involved in the EGF-like domain according to the work in [11]. Green highlighted residues correspond to any known hyaluronidase domain according to the work in [11].
Toxins 13 00453 g004
Figure 5. Amino acid sequences of lycotoxin translated from Pamphobeteus verdolaga. Prediction of disulfide bridges, commonly described in the ICK peptides, according to DISULFIND. Residues highlighted in grey indicate the signal peptide, while blue highlighted residues indicate the propeptide according to Spider|ProHMM from the arachnoserver.
Figure 5. Amino acid sequences of lycotoxin translated from Pamphobeteus verdolaga. Prediction of disulfide bridges, commonly described in the ICK peptides, according to DISULFIND. Residues highlighted in grey indicate the signal peptide, while blue highlighted residues indicate the propeptide according to Spider|ProHMM from the arachnoserver.
Toxins 13 00453 g005
Figure 6. P. verdolaga venom profile. rp-HPLC (C18 column, 250 × 4.6 mm) chromatographic profile of P. verdolaga’s venom. Red squares indicate the HMMC detected by MS/MS similar to proteins with enzymatic activity.
Figure 6. P. verdolaga venom profile. rp-HPLC (C18 column, 250 × 4.6 mm) chromatographic profile of P. verdolaga’s venom. Red squares indicate the HMMC detected by MS/MS similar to proteins with enzymatic activity.
Toxins 13 00453 g006
Table 1. Contigs from P. verdolaga venom gland transcriptome matching: A, phospholipases A2 (PLA2); B, phospholipases D (PLD); C, phospholipases B; D, kunitz-type serine protease inhibitors (KTSPI); E, hyaluronidases; F, lycotoxin-like peptides; G, CRISP proteins; H, hephaestin-like; and I, metalloproteinase. Accession numbers beginning with “XP” correspond to the NCBI database, while others correspond to UniProt. TPM, transcripts per million.
Table 1. Contigs from P. verdolaga venom gland transcriptome matching: A, phospholipases A2 (PLA2); B, phospholipases D (PLD); C, phospholipases B; D, kunitz-type serine protease inhibitors (KTSPI); E, hyaluronidases; F, lycotoxin-like peptides; G, CRISP proteins; H, hephaestin-like; and I, metalloproteinase. Accession numbers beginning with “XP” correspond to the NCBI database, while others correspond to UniProt. TPM, transcripts per million.
A. Phospholipase A2-Like Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c3142PhospholipaseA2-1-pverdolagaCalcium-independent phospholipase A2A0A087UHX4Stegodyphus mimosarum173.337.09 × 10−505.79
c4865PhospholipaseA2-2-pverdolagaCytosolic phospholipase A2XP_003214621.2Anolis carolinensis112.082.93 × 10−255.45
c15998PhospholipaseA2-3-pverdolagaGroup XV phospholipase A2A0A087U096S. mimosarum560.840.00 × 10+0028.76
c33599PhospholipaseA2-4-pverdolagaCytosolic phospholipase A2A0A087UL94S. mimosarum139.045.33 × 10−391.51
c45513PhospholipaseA2-5-pverdolagaCalcium-independent phospholipase A2A0A087UHX4S. mimosarum275.027.49 × 10−883.09
c10524PhospholipaseA2-6-pverdolagaCalcium-independent phospholipase A2A0A0J7L0J5Lasius niger101.291.51 × 10−186.49
c11106PhospholipaseA2-7-pverdolagaPhospholipase A2A0A087SVA4S. mimosarum149.063.02 × 10−418.04
c12950PhospholipaseA2-8-pverdolagaPhospholipase A2A0A087TLC5S. mimosarum87.042.14 × 10−1758.98
c18752PhospholipaseA2-9-pverdolagaGroup XIIA secretory phospholipase A2XP_011150082.1Harpegnathos saltator135.583.87 × 10−35138.53
c21159PhospholipaseA2-10-pverdolagaCalcium-independent phospholipase A2E2B1P4Camponotus floridanus114.393.47 × 10−242.68
c42153PhospholipaseA2-11-pverdolagaCytosolic phospholipase A2A0A087UL97S. mimosarum117.861.08 × 10−312.65
c20465PhospholipaseA2-12-pverdolagaCalcium-independent phospholipase A2XP_002399324.1Ixodes scapularis342.811.19 × 10−1052.66
c29120PhospholipaseA2-13-pverdolagaGroup 3 secretory phospholipase A2XP_012259279.1Athalia rosae137.896.44 × 10−361.4
c57457PhospholipaseA2-14-pverdolagaPhospholipase A2A0A087UYP4S. mimosarum118.241.83 × 10−292.01
c61053PhospholipaseA2-15-pverdolagaCalcium-independent phospholipase A2A0A087TW26S. mimosarum479.561.22 × 10−15810.53
c60448PhospholipaseA2-16-pverdolagaPhospholipase A2-activating proteinB7PWX1Ixodes scapularis6240.00 × 10+005.76
B. Phospholipase D-Like Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c46024PhospholipaseD-1-pverdolagaPhospholipase D LiSicTox-betaID1Q1W694Loxosceles intermedia319.703.17 × 10−1009.24
c14372PhospholipaseD-2-pverdolagaPhospholipase D StSicTox-betaIF1C0JB54Sicarius terrosus214.544.16 × 10−6116.94
c45658PhospholipaseD-3-pverdolagaPhospholipase D1KFM64830.1S. mimosarum1651 × 10−481.98
c54699PhospholipaseD-4-pverdolagaPhospholipase D1XP_003744259.1Metaseiulus occidentalis3534.94 × 10−1182.34
C. Phospholipase B-Like Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c17591Phospholipase-B-1-pverdolagaPutative phospholipase B-like 2XP_015925352.1Parasteatoda tepidariorum7520.00 × 10+0031.29
D. KTPSI-Like Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c1808Kunitz-1-pverdolagaKunitz-type serine protease inhibitor huwentoxin-11g11B2ZBB6H. schmidti75.879.22 × 10−155.22
c8989Kunitz-2-pverdolagaKunitz-type serine protease inhibitor kunitz-1W4VSH9Trittame loki66.244.76 × 10−1023.43
c12801Kunitz-3-pverdolagaKunitz-type serine protease inhibitor HWTX-XI-IS4P0DJ76H. schmidti99.375.62 × 10−23157.37
c15163Kunitz-4-pverdolagaKunitz-type serine protease inhibitor kunitz-1W4VSH9Trittame loki128.262.03 × 10−3238.26
c16277Kunitz-5-pverdolagaKunitz-type serine protease inhibitor 6-likeKFM65460.1S. mimosarum137.501 × 10−3813.39
c30159Kunitz-6-pverdolagaKunitz-type serine protease inhibitor huwentoxin-11g11B2ZBB6H. schmidti92.824.50 × 10−2276.26
c41726Kunitz-7-pverdolagaProtein with kunitz domainXP_002435922.1Ixodes scapularis74.331.38 × 10−162.85
c59058Kunitz-8-pverdolagaKunitz-type serine protease inhibitor huwentoxin-11g11B2ZBB6H. schmidti64.701.40 × 10−094.26
c66767Kunitz-9-pverdolagaKunitz-type protease inhibitor AXPI-I-likeXP_011135446.1Harpegnathos saltator63.164.85 × 10−101.58
c43290Kunitz-10-pverdolagaKunitz-type protease inhibitor kalicludine-3-likeXP_012273912.1Orussus abietinus51.991.71 × 10−061.66
c52646Kunitz-11-pverdolagaKunitz-type serine protease inhibitor huwentoxin-11g11B2ZBB6H. schmidti84.732.64 × 10−17144.34
c6182Kunitz-12-pverdolagaKunitz-type serine protease inhibitor kunitz-1W4VSH9Trittame loki64.319.75 × 10−103.02
c9496Kunitz-13-pverdolagaKunitz-type serine protease inhibitor huwentoxin-11P68425H. schmidti119.781.02 × 10−30325.15
E. Hyaluronidase-Like Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c17398Hyaluronidase-1-pverdolagaHyaluronidase-3A0A0F8AST4Larimichthys crocea79.344.21 × 10−1314.8
c51925Hyaluronidase-2-pverdolagaHyaluronidaseJ9XYC6Brachypelma vagans816.990.00 × 10+001107.75
F. Lycotoxin-Like Peptides.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c3316Lycotoxin-1-pverdolagaU15-lycotoxin-Ls1dB6DD42Lycosa singoriensis50.16 × 10−067.36
c28990Lycotoxin-2-pverdolagaU16-lycotoxin-Ls1bB6DD53Lycosa singoriensis428 × 10−72.35
c13977Lycotoxin-3-pverdolagaU20-lycotoxin-Ls1c-likeA0A087UBG5S. mimosarum52.372.96 × 10−066.38
G. CRISP Proteins.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c9788CRISP-1- pverdolagaGTx-CRISP1BAN13537.1Grammostola rosea5180.00 × 10+001388.9
C9919CRISP-2- pverdolagaGTx-VA1BAN13538.1G. rosea5900.00 × 10+0018191.29
c18710CRISP-3- pverdolagaGTx-CRISP1BAN13537.1G. rosea3224 × 10−10812.97
H. Hephaestin-Like Protein.
Contig NumberGiven NameSimilarity withAccession numberOrganismScoreE-ValueTPM
c5907hephaestin-1- pverdolagaHephaestin-like proteinXP_021003833.1Parasteatoda tepidariorum10170.00 × 10+004.18
c20814hephaestin-2- pverdolagaHephaestinPRD23536.1Nephila clavipes1931 × 10−593.16
I. Venom Metalloproteinase.
Contig NumberGiven NameSimilarity withAccession NumberOrganismScoreE-ValueTPM
c728Metalloproteinase-1- pverdolagaA disintegrin and metalloproteinase with thrombospondin motifs 1KFM63257.1S. mimosarum7580.00 × 10+0020.99
Table 3. Assignment of the rp-HPLC fractions from P. verdolaga venom, isolated as observed in Figure 2, matching high-molecular-mass protein families with enzymatic activities from a non-redundant external database.
Table 3. Assignment of the rp-HPLC fractions from P. verdolaga venom, isolated as observed in Figure 2, matching high-molecular-mass protein families with enzymatic activities from a non-redundant external database.
rp-HPLCProtein FamilyProtein NameOrganism
6HyaluronidaseHyaluronidase, partialBrachypelma vagans
6LycotoxinU16-lycotoxin-Ls1aLycosa singoriensis
21–22CRISPGTx-VA1Grammostola rosea
CRISPGTx-VA1
CRISPGTx-VA1
CRISPGTx-VA1
7Phospholipases DPhospholipase D isoform 1Loxosceles laeta
Phospholipases DPhospholipase D LlSicTox-alphaIII1i
6No matchNo matchNo match
Table 4. MS/MS fragments identified from the venom of P. verdolaga rp-HPLC matching high-molecular-mass compound with housekeeping and cellular process activities. ID, transcript identification number.
Table 4. MS/MS fragments identified from the venom of P. verdolaga rp-HPLC matching high-molecular-mass compound with housekeeping and cellular process activities. ID, transcript identification number.
Sequences% SimilarityIDMatch
AGFAGDDAPR100c6436_g1_i1Actin
AVFPSIVGRPR
DSYVGDEAQSKR
HQGVMVGMGQKDSYVGDEAQSK
RGILTLK
EITALAPSTMK100c62193_g1_i1Actin
VAPEEHPVLLTEAPLNPK100c13011_g1_i1Actin
MTQIMFETFNSPAMYVAIQAVLSLYASGR96.55
ESRSE100c15096_g1_i3Cytosolic purine 5′-nucleotidase
GKPKIQVEYK100c27174_g1_i1Heat shock protein
LSKEEIER100
SENVQDLLLLDVAPLSLGIETAGGVMTALIK90.32
SENVQDLLLLDVAPLSLGIETAGGVMTSLIK90.32
GVPQIEVTFDLDANGILQVSAQDKSTGK89.29
QTQIFTTYSDNQPGVLIQVYEGER95.8
QTQTFITYSDNQPGVLIQVYEGER95.8
GVPQIEVTFDIDANGILNVTATDK91.67
EIAEAYLGYPVTNAVITVPAYFNDSQR88.89
LLQDFFNGR88.89
SENVQDLLLLDVAPLSLGLETAGGVMTALIK87.1
NQVALNPQNTVFDAK86.67
SENVQDLLLLDVAALSLGLETAGGVMTALIK83.87
DVLLVDVAPLSLGIETAGGVMTK100c15743_g1_i1Heat shock protein
KLFNPEEISAMVLTK100
LFNPEEISAMVLTK100
DAGVIAGLNVLR91.67
TTPSYVAFTDTER100c10792_g1_i2Heat shock protein
YRPGTVALREIR100c2143_g1_i2Histone
TITLEVEPSDTIENVK100c16774_g1_i2Polyubiquitin-B
AGFAGDDAPRAVFPSIVGRPR100c17180_g4_i1Actin
DLYANTVLSGGTTMYPGIADRMQK100
MQKEITALAPSTMK100
SYELPDGQVITIGNER100
YSVWIGGSI100
TTGIVLDSGDGVSHTVPIYEGYALPHAILWLDLAGRDLTDYLMK97.73
MQKEITALAPSQMK92.86
MQKEITALAPSWMK92.86
MQKEITALAPSYMK92.86
SINPDEAVAYGAAVQAAILMGDK95.65c16820_g1_i1Heat shock protein
IINEPTAAALAYGLDR93.75c9831_g1_i1Heat shock protein
TITLEVEPSDTAENVK93.75c16774_g1_i2Polyubiquitin-B
FELSGIPPAPR90.91c14336_g1_i1Heat shock protein
AASSSSTEK88.89c51913_g1_i1Actin
MAATKQTAR88.89c2143_g1_i2Histone
KSAMATGGVK80
MAGTKQTAR88.89c4667_g1_i1Histone
MANTKQTAR88.89
AVTKQTAR87.5
KSAAATGGVK80
KSACATGGVK80
KSAEATGGVK80
KSAGATGGVK80
KSAHATGGVK80
KSASATGGVK80
KSASATGGVK80
KSAWATGGVK80
KSAYATGGVK80
SAIATGGVKKPHR84.62
CNDMMNVGRLQGFEGK87.5c15300_g1_i1Triple functional domain protein
ELEEAER85.71c34105_g1_i1Ubiquitin
QAAEAAPEDK80c5964_g1_i2PDZ and LIM domain protein Zasp
GSSSGGGYSSGSSSYGSGGR80c14908_g1_i2Protein phosphatase
LENEIQTYR77.78c4688_g1_i1Dystonin
CKINFCLK75c14491_g1_i2AN1-type zinc finger protein
SPATREGK75c9864_g1_i1Cip1-interacting zinc finger protein
KVLPLPQR75c62910_g1_i1Developmental protein
EDQEQRER75c29740_g1_i1Intersectin-1
KLMEMVNN75c11572_g1_i1Serine/threonine-protein kinase
IPCCGKSR75c5016_g1_i1Ubiquitin
VQGHSHSK75c17992_g1_i1Uncharacterized protein
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Estrada-Gómez, S.; Vargas-Muñoz, L.J.; Segura Latorre, C.; Saldarriaga-Cordoba, M.M.; Arenas-Gómez, C.M. Analysis of High Molecular Mass Compounds from the Spider Pamphobeteus verdolaga Venom Gland. A Transcriptomic and MS ID Approach. Toxins 2021, 13, 453. https://doi.org/10.3390/toxins13070453

AMA Style

Estrada-Gómez S, Vargas-Muñoz LJ, Segura Latorre C, Saldarriaga-Cordoba MM, Arenas-Gómez CM. Analysis of High Molecular Mass Compounds from the Spider Pamphobeteus verdolaga Venom Gland. A Transcriptomic and MS ID Approach. Toxins. 2021; 13(7):453. https://doi.org/10.3390/toxins13070453

Chicago/Turabian Style

Estrada-Gómez, Sebastian, Leidy Johana Vargas-Muñoz, Cesar Segura Latorre, Monica Maria Saldarriaga-Cordoba, and Claudia Marcela Arenas-Gómez. 2021. "Analysis of High Molecular Mass Compounds from the Spider Pamphobeteus verdolaga Venom Gland. A Transcriptomic and MS ID Approach" Toxins 13, no. 7: 453. https://doi.org/10.3390/toxins13070453

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop