Next Article in Journal
The Role of Escherichia coli Shiga Toxins in STEC Colonization of Cattle
Next Article in Special Issue
Bee Venom Phospholipase A2 Ameliorates Atherosclerosis by Modulating Regulatory T Cells
Previous Article in Journal
Reduction of Aflatoxin B1 in Corn by Water-Assisted Microwaves Treatment and Its Effects on Corn Quality
Previous Article in Special Issue
Evaluation of the Effectiveness of Crotoxin as an Antiseptic against Candida spp. Biofilms
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Antibiofilm Activity of Acidic Phospholipase Isoform Isolated from Bothrops erythromelas Snake Venom

1
Postgraduate Program in Cellular and Molecular Biology—Federal University of Paraíba, João Pessoa, PB 58051-900, Brazil
2
S-Inova Biotech, Postgraduate Program in Biotechnology—Dom Bosco Catholic University, Campo Grande, MS 79117-010, Brazil
3
Protein Purification Laboratory and its Biological Functions, Faculty of Medicine, FAMED, Federal University of Mato Grosso do Sul (UFMS), Campo Grande, MS 79603-011, Brazil
4
Embrapa Beef Cattle, Campo Grande, MS 79106-550, Brazil
5
Center for Proteomic and Biochemical Analysis, Graduate Program in Genomic Sciences and Biotechnology, Catholic University of Brasilia, Brasilia 71966-700, Federal District, Brazil
6
Center of Biological and Health Sciences, Postgraduate Program in Science and Mathematics Education, Paraíba State University, Campina Grande PB 58429-500, Brazil
*
Author to whom correspondence should be addressed.
Toxins 2020, 12(9), 606; https://doi.org/10.3390/toxins12090606
Submission received: 2 July 2020 / Revised: 27 July 2020 / Accepted: 7 August 2020 / Published: 20 September 2020
(This article belongs to the Special Issue Application of Venom Phospholipase in the Treatment of Diseases)

Abstract

Introduction: Bacterial resistance is a worldwide public health problem, requiring new therapeutic options. An alternative approach to this problem is the use of animal toxins isolated from snake venom, such as phospholipases A2 (PLA2), which have important antimicrobial activities. Bothrops erythromelas is one of the snake species in the northeast of Brazil that attracts great medical-scientific interest. Here, we aimed to purify and characterize a PLA2 from B. erythromelas, searching for heterologous activities against bacterial biofilms. Methods: Venom extraction and quantification were followed by reverse-phase high-performance liquid chromatography (RP-HPLC) in C18 column, matrix-assisted ionization time-of-flight (MALDI-ToF) mass spectrometry, and sequencing by Edman degradation. All experiments were monitored by specific activity using a 4-nitro-3-(octanoyloxy) benzoic acid (4N3OBA) substrate. In addition, hemolytic tests and antibacterial tests including action against Escherichia coli, Staphylococcus aureus, and Acinetobacter baumannii were carried out. Moreover, tests of antibiofilm action against A. baumannii were also performed. Results: PLA2, after one purification step, presented 31 N-terminal amino acid residues and a molecular weight of 13.6564 Da, with enzymatic activity confirmed in 0.06 µM concentration. Antibacterial activity against S. aureus (IC50 = 30.2 µM) and antibiofilm activity against A. baumannii (IC50 = 1.1 µM) were observed. Conclusions: This is the first time that PLA2 purified from B. erythromelas venom has appeared as an alternative candidate in studies of new antibacterial medicines.
Key Contribution: Antibiofilm activity of phospholipase A2 isolated from snake venom was tested. PLA2 was isolated from B. erythromelas venom without hemolytic activity in murine blood.

Graphical Abstract

1. Introduction

With the increase in mortality, morbidity, and the rising demand for spending on diagnostic and therapeutic procedures, public health problems require attention from the scientific community. Among the main pathologies in Brazil and worldwide, nosocomial infections, such as infections caused by bacteria, have become more potent due to the increase in bacterial resistance. These increases are characterized by natural and evolutionary processes observed in microorganisms as responses to environmental stimuli, which are intensified by the incorrect use of antibiotics, leading to bacterial resistance to the usual drugs. In the next 30 years, the number of deaths related to bacterial infections might reach 10 million people worldwide and 392,000 in Latin America alone annually [1,2,3,4].
Bacteria can present two forms of life: the first is planktonic, characterized by independent growth, that is, decoupled from a solid structure or from other organisms such as fungi or even other bacteria, this way of life facilitates their proliferation. The second is as biofilms, which form a community involved in an extracellular matrix composed of several biopolymers, such as extracellular polysaccharides, proteins, DNA, and lipids, in addition to the association of other microorganisms, such as fungi [5,6].
The formation and adhesion of surface bacterial biofilms can be reversible or irreversible, depending on the physical–chemical forces present in the environment. It also depends on the mechanisms of regulation of cell density and collective behavior, called quorum sensing, which allow bacteria to synchronize their gene expression for the formation of the biofilm [7,8,9,10,11,12]. Biofilm formation seems to be related to gene expression and the presence of structures that alter bacterial conformation to the state of biofilm, such as flagella and lashes. The absence of a gene or lack of expression may be directly related to the lack of capacity to form biofilms, even within the same species, depending on different strains [6].
Biofilms provide some benefits to bacteria, including the increased tolerance of such microorganisms to extreme environmental conditions. Furthermore, the exopolysaccharides (EPSs) increase protection against bactericidal agents. This mechanism allows the exchange of genetic material between different species of bacteria and between organisms of the same species, thus facilitating the spread of bacterial resistance, a fact that has aroused interest in the scientific community [12,13,14,15].
On the other hand, the bioprospecting of animal toxin molecules with pharmaceutical application has gained attention, since the variety of these compounds offers alternative candidate sources for the production of new antimicrobial and antitumor drugs for the treatment of viral infections, cancer, and parasitic and bacterial infections [16,17]. Among these sources, snake venoms have a wide variety of components, where about 90% of their dry weight is composed of proteins, among which are phospholipases A2 (PLA2), enzymatic proteins that generally have low molecular weight. These are responsible for catalyzing the hydrolysis of the 3-sn-phosphoglyceride-dependent calcium 2-acyl ester bond, obtaining lysophospholipids and fatty acid products [18,19,20].
These enzymes play an important role in the metabolism of lipid molecules and are also related to the production and release of arachidonic acid (AA), a precursor of bioactive lipids that participates in cellular activities, due to the release of compounds such as prostaglandins, thromboxane, and leukotrienes, characterizing a perception of pain and inflammation [20,21,22,23,24]. Indeed, bites caused by snakes from the genus Bothrops show pharmacological effects characteristic of PLA2 action, such as inflammation, local pain, anticoagulant effects, and edema. The viper Bothrops erythromelas is of the greatest medical pharmacological interest [25,26].
The A2 phospholipases of snake venoms are similar to each other, but they have different toxicological profiles, such as myotoxicity, neurotoxicity, anticoagulant activity, hemolysis, hyperalgesia, inflammation, edema, cytotoxicity, hypotension, and antimicrobial activity [20,27,28,29,30,31]. In this context, the antibacterial activity already observed for phospholipases has drawn attention to the use of these toxins as an alternative for the production of medicines. Therefore, this work aimed to purify A2 phospholipases of the venom from B. erythromelas and further evaluate their antibacterial and antibiofilm activities.

2. Results

2.1. Purification and Characterization of PLA2 from B. erythromelas

Following venom extraction and lyophilization, the crude venom was applied to a reverse-phase chromatograph (RP-HPLC) using a C18 column. The crude venom exhibited a protein profile of 14 peaks, eluted along the gradient of buffer B (Figure 1a). Peak 8 showed a retention time of 29.4 min and was eluted with ~40% of buffer B, corresponding to the PLA2 from B. erythromelas.
In order to confirm the purity of the collected PLA2, the sample was subjected to analysis in a mass spectrometer (Figure 1b), which generated a spectrum with a mass of 13.6564 Da and the presence of double [M + 2H]2+ (6.8265 Da) and triple [M + 3H]3+ (4.5499 Da) charge, confirming the purity of the fraction collected from RP-HPLC.
Figure 2 demonstrates that the PLA2 isoform of B. erythromelas venom in a concentration of 0.06 µM showed enzymatic activity that was three times more powerful than commercial phospholipase (bovine pancreas phospholipase A2—P9913 Sigma) and the crude venom of the snake, compared to the synthetic substrate acid 4-nitro-3-(octanoyloxy)benzoic acid (4N3OBA).
Edman’s degradation provided an amino acid sequence with 31 N-terminal amino acid residues, with 13 hydrophobic residues and no charge. Subsequently, the sequence was submitted to Basic Local Alignment Search Tool (BLAST), where 96% homology was observed for three acidic PLA2: bpPLA2-TXI from Bothrops pauloensis, sPLA2-II from Bothrops diporus, and BE-I-PLA2 from B. erythromelas. To compare the sequences, alignment was performed using ClustalW, where it was possible to observe that only the amino acids Trp1 and Asp25 in the sequence of our sample are different from the compared sequences, and the PLA2 isoform has one hydrophobic residue more than other sequences, configuring a more hydrophobic property for the isoform PLA2 (Table 1) [32,33,34].

2.2. Hemolytic Activity Assays

Once purified, we investigated the hemolytic activity of PLA2 from B. erythromelas against murine blood, since the absence of hemolysis is a prerequisite for further biochemical and pharmacological assays. The PLA2 from B. erythromelas showed no hemolysis when incubated, even at the maximum concentration assayed, from 1.17 to 37.5 µM. This result shows the feasibility for carrying out biological tests with the purified fraction.

2.3. Antibacterial and Antibiofilm Activity

The tests showed that the purified PLA2 isoform exerts activity in Gram-positive strains. In the first tests with Staphylococcus aureus ATCC (American Type Culture Collection) 7133623, there was activity at all concentrations tested, with the best concentration being 37.49 µM, representing 62% ± 17% of activity, whereas for Escherichia coli ATCC 25922, low activity was observed at the concentration of 37.49 µM, representing only 12% ± 2% of activity, however, ciprofloxacin showed the best results in the activity observed in PLA2, as shown in Table 2 and Figure S1 (Supplementary Materials).
The isolated clinical strain of Acinetobacter baumannii 00332126 was then tested. Although it showed greater growth, it also showed better antibacterial activity at concentrations of 37.49 µM, representing 37% ± 10% of activity, showing better activity including compared to antibiotic, which was not able to inhibit bacterial growth of A. baumannii. As the S. aureus ATCC 7133623 strain did not present biofilm growth, antibiofilm activity was also tested in A. baumannii 00332126. The test showed activity at all concentrations through the PLA2 isoform. The best concentration was 1.17 µM, with 53% ± 11% of activity, also showing better activity when compared to antibiotic (Table 2 and Figure S1 in Supplementary Materials).

3. Discussion

Our results present a PLA2 with acidic characteristics that showed a homology of 96% with the only PLA2 already described, so far, for B. erythromelas venom (BE-I-PLA2). The main difference in the purification of our PLA2 was in the steps used, because in our work we sought to optimize time by applying only one chromatographic step, i.e., RP-HPLC in a C18 column. In this way, a PLA2 was obtained with a molecular mass of 13.6564 Da, whereas for the purification of BE-I-PLA2, four steps were applied with different buffers for elution, and column C4 in RP-HPLC, obtaining a PLA2 with a molecular mass of 13.64957 Da [34].
The use of several steps during the purification of PLA2 from snake venom has been common for a long time. Some studies report the use of at least two stages, such as PLA2 isolated from the venom of Bothrops alternatus, Bothrops asper, and Bothrops neuwiedi, using two chromatographic stages, where in the RP-HPLC stages, like us, they used column C18 [35,36,37].
Other reports show the use of up to three stages, such as studies involving the species Bothrops atrox and Bothrops jararaca, which were subjected to different stages and buffers. The other purifications mentioned were the use of a C18 column in the RP-HPLC stage, differing only from BE-I-PLA2 isolated from B. erythromelas [34,38,39].
More recent studies point to a reduction in the chromatographic steps during the purification of PLA2, as in our work. Using the same methodology applied in the present work, a study involving the species B. pauloensis showed the purification of a PLA2 (BpPLA2-TXI), with 96% homology with our isoform. Confirming that the use of only one step is satisfactory during purification, another study was done with the species Bothrops cotiara, which used a methodology similar to ours and managed to purify a basic PLA2 with a mass of 13.716 ± 3 Da [32,40].
Therefore, the type of solvent involved in the dilution of the lyophilized sample, as well as the methodology applied, in relation to the linear gradient and the separation column, proved to be important factors for the possible purity of the sample in just one chromatographic step. Thus, it is important to establish the best method of purification, optimizing the time spent on research.
Once purified, we subjected the PLA2 from B. erythromelas to enzymatic assays. The enzymatic profile observed in Figure 2 demonstrated that our purification process yielded a catalytically active PLA2, since a high consumption of the substrate by the purified fraction was observed, indicating a possible Asp49 residue, as in the isoform BE-I-PLA2 reported earlier [34]. Comparing the enzymatic activity of two PLA2 forms isolated from Bothrops jararacussu (BthTx-I and BjVIII) with a commercial PLA2, and using 4N3OBA as substrate, enzymatic activity was observed. This is a basic characteristic of this type of PLA2, determining a PLA2 Lys49. Likewise, the enzymatic activity of a PLA2 from Bothrops neuwiedi urutu, which contains Lys49, was absent when the synthetic substrate 4N3OBA was used [37,41]. Similarly, studies using the substrate 4N3OBA compared the catalytic activity of a PLA2 (Bmaj-9) isolated from the venom of the snake Bothrops marajoensis with the crude venom of the same snake. They observed that Bmaj-9 also showed catalytic activity at a concentration of 1.46 µM, higher than that of the snake’s crude venom [42].
The N-terminal amino acid sequencing for phospholipase showed two different amino acids when compared with another PLA2 (BpPLA2-TXI; sPLA2-II and BE-I-PLA2). However, the similarity among N-terminal sequences was maintained at 96%. The presence of a Trp1 indicates the greater hydrophobicity of the sample, since this amino acid has aromatic characteristics with a relatively non-polar side chain, which also facilitates the absorption of light. The presence of an Asp25 indicates an increase in the acidic characteristic of our sample, since this amino acid is between the two amino acids that have the negatively charged group R at pH 7.0, thus giving it an acidic property. Asp25 also justifies the presence of a null charge in the isolated sequence, since the presence of this amino acid increases the positive charges, making them equal to the negative charges, which are consequently annulled [32,33,34,43].
In our study, no hemolytic activity was observed for PLA2 from B. erythromelas. The lack of hemolytic activity for a PLA2 is unusual, but studies speculate that some actions of PLA2 are still not well described, based on the absence of toxicity for some prey. Furthermore, the actions may be related to the evolution of this enzyme, which can be present in the venom gland but not develop its expected toxic activity. Studies with an acidic PLA2 (BmooPLA2) isolated from Bothrops moojeni showed a presence of hemolytic activity at 0.07 µM [44].
A further study carried out with an acidic PLA2 isolated from Porthidium nasutum (PnPLA2), displayed hemolytic activity from 0.47 µM [45]. Indirect hemolytic activities in sheep blood were also reported for PLA2 from B. alternatus at 47.26 µM [35]. However, a study involving the isolation of two PLA2 (PLA2-12 and PLA2-17), from the snake Micrurus fulvius, showed that one of the enzymes showed intravascular hemolytic activity in a mice model, namely PLA2-17, while PLA2-12 did not show intravascular hemolysis in the same model tested [46]. This last result corroborates our findings.
Our findings show that the isoform purified from the B. erythromelas venom showed IC50 for the Gram-positive strain, whereas for the Gram-negative strains no IC50 was reached at the assayed concentration. These data are in accordance with studies where basic the PLA2 isolated from B. marajoensis venom showed loss of inhibitory activity in all tested strains [47].
The PLA2 Lys49 from Lachesis muta venom, also belonging to the Viperidae family, showed antimicrobial activity against S. aureus ATCC 29213 at 0.9 µM. Similarly, studies of a basic PLA2 isolated from Daboia russelii (Viperidae), showed better antimicrobial effects for Gram-positive bacteria in comparison with that for Gram-negative bacteria [48,49]. These data corroborate our findings.
It is believed that the antimicrobial activity of PLA2, especially those with basic properties, is related to disturbances of bacterial membrane integrity [37,50,51]. As Gram-negative bacteria have a cell wall with an outer membrane made up of asymmetric lipids, followed by a layer of peptidoglycans, and an inner membrane made up of phospholipids, it is well established that this conformation makes it difficult for some drugs to enter. This can also be seen in the activity of PLA2, since the outer membrane is naturally resistant to the action of PLA2 [16].
Otherwise, Gram-positive bacteria have only one layer of peptidoglycans followed by an internal cell membrane, showing that they are more susceptible to the action of a PLA2. Thus, the low bactericidal activity of some phospholipases in Gram-negative bacteria compared to the activity observed in Gram-positive bacteria is probably related to the structure of their cell wall, which makes Gram-negative bacteria more resistant to the action of toxic compounds [16,52].
Commercial polypeptide antibiotics, such as bacitracin, act on Gram-positive bacteria, inhibiting the synthesis of the bacterial cell wall, preventing the addition of amino acids and nucleotides to the cell wall. Based on the mechanism of action observed in polypeptide antibiotics, it is believed that such proteins should act similarly to these antibiotics in the tested bacteria [53,54].
Research involving the participation of bioactive molecules from several organisms, such as microalgae, plants, and animals, against biofilms is ongoing. These molecules have several pharmacological and toxicological actions that can be used as an alternative for production of drugs that help in the treatment of infections caused by microorganisms, an emerging problem in the human population, also caused by biofilm formation [55,56].
There are several molecular mechanisms involved in the formation of biofilms between species and between strains of bacteria. It is known that a determining factor for the formation of biofilms is the presence of a disturbance or stress caused by bacteria, as well as the presence of proteins or genes that provide for the formation of these matrices. This is observed in S. aureus strains, which have as a determinant for the formation of biofilm the presence of Operon ICA (The intercellular adhesion), or even the formation of a biopolymer essential for the formation of biofilm in this species, such as N-acetyl glucosamine [6,57].
In our experiments, however, we observed that the S. aureus ATCC 7133623 strain is not capable of forming biofilms. For this is reason, antibiofilm assays were carried out only with A. baumannii 00332126.
A study involving the purification of a venom fraction from Naja ashei, showed antibiofilm activity against a clinical isolate of Staphylococcus epidermidis. In the isolated fraction (F2), the authors report the presence of PLA2, in addition to other proteins such as 3FTx and LAAO, they also believe that an antibiofilm activity is performed by PLA2, considering that this enzyme is successful for antibacterial activities [58]. This result corroborates with our findings.
Similarly, studies involving an antimicrobial peptide isolated from Naja atra (NA-CATH) showed a 50% reduction in the biofilm formation of the bacterium Burkholderia thailandensis at a concentration of 0.22 μM, indicating the proven pharmacological potential of snake venoms organic molecules, corroborating the findings, since they have identified a relevant reduction in the biofilm formation of A. baumannii 00332126 [59].
The antimicrobial peptide Cath-A, purified from Bungarus fasciatus (Elapidae), also reduced A. baumannii biofilm formation at ≥2.2 μM. At a higher concentration (≥17.6 µM), Cath-A destroys almost all cells adhering to the biofilm. Further studies with synthetic antimicrobial peptides showed antibiofilm activity against Pseudomonas aeruginosa and A. baumannii with IC50 and IC90 4 and 8 μM, respectively [60,61].
In antibiofilm tests with C-type lectins isolated from B. jararacussu venom, an IC50 at a concentration of 6.67 µM was observed for S. aureus and S. epidermidis, but the protein was unable to interfere in bacterial growth [62]. Similarly, a study involving B. moojeni isolated molecules showing a reduction in biofilm formation, without influencing bacterial growth [63].
In our studies, growth reduction of the biofilm was obtained from the lowest concentration tested. We observed that the achieved antibiofilm activity was about 20% more concentrated in the enzyme activity of the molecule, indicating a strong interaction between the enzyme and its specific substrate, in view of its low concentration. The reported activity, however, is unusual for acidic PLA2, since antibacterial activity is often present in basic PLA2, as previously reported. This may explain the activity in biofilm and bacteria at concentrations starting at 20% higher than the enzyme activity of the molecule [47].
This is the first report of an isoform of PLA2 that exhibits antibiofilm activity isolated from a snake of the Viperidae family in the literature, demonstrating how molecules from biological sources can contribute to research regarding bacterial infections, acting as an important source of molecules capable of reducing or eradicating biofilms. The PLA2 from B. erythromelas, purified by our group, is safe for further biological assays, since no hemolytic activity was noticed against murine erythrocytes. These findings emphasize the importance of bioprospection studies with molecules from animal toxins, especially snakes, to control bacterial biofilms, contributing to advances in the control of infections caused by these microorganisms.

4. Conclusions

The purification of the PLA2 isoform from B. erythromelas venom using a single chromatographic step was reported, resulting in protein with 13.6564 Da. The amino-terminal portion of the PLA2 isoform showed 96% of identity with another PLA2 previously described. Beyond the high enzymatic activity, no hemolytic activity was observed against murine erythrocytes. Notable antibiofilm activity was seen against A. baumannii clinical isolates at a low concentration. These findings confirm that purified molecules from snake venoms possess several biological and pharmacological properties. It is therefore necessary to develop basic research around these components, aiming to develop new drugs for the treatment of various diseases that affect human health.

5. Methods

5.1. B. erythromelas Venom Extraction

B. erythromelas venom was collected from 5 adult specimens in captivity at the Zoo for Reptiles of the Caatinga, located in the municipality of Puxinanã, metropolitan region of Campina Grande, state of Paraiba.
After lyophilization, the venom was kept at −20 °C until use. The samples used are registered with the Genetic Heritage Management Council (SisGen) under the register: A883C5B.

5.2. Quantification of Venom Proteins

After diluting the lyophilized sample in ultrapure water, the Bradford method (1976), was carried out to quantify the proteins present in the purified fraction. Serial dilutions of the sample were used. As standard for these concentrations, bovine serum albumin (BSA) was used in the same concentration as the purified sample. All samples were tested in triplicate [64].

5.3. Purification of Venom Proteins

The crude venom was subjected to high-performance liquid chromatography (Waters and 2695 Separations Module) in a C18 column (Xterra MS 5 µm—4.6 × 250 mm column). The solvent system was composed of 0.1% trifluoroacetic acid (TFA) in H2O (Solvent A) and 0.1% TFA in acetonitrile (Solvent B) in a flow of 2 mL.min−1 and a linear gradient of 5–95% acetonitrile, for 60 min. Protein peaks were monitored at 216 and 280 nm. The fractions presented in the graphical representation were collected and lyophilized. Subsequently, the fraction with phospholipase activity was selected to be subjected to the mass spectrometer.

5.4. Phospholipase Activity

To analyze the phospholipase activity of B. erythromelas venom, the methodology described by Holzer and Mackessy (1996) was used, with changes made by Serino-Silva et al. (2014) [65,66].
The substrate for reaction, 4-nitro-3-(octanoyloxy) benzoic acid (4N3OBA, Enzy Life Science, Farmingdale, NY, USA) was used. As a positive control, a commercial phospholipase with a concentration of 0.06 µM (1 mg.mL−1) (bovine pancreas phospholipase A2—P9913 Sigma) was prepared, and BSA was used as negative protein control, at the same concentration.

5.5. Mass Spectrometry

To measure the molecular mass of the selected fraction, a matrix-assisted ionization time-of-flight (MALDI-ToF) mass spectrometer (AutoFlex III) Smartbeam (Bruker Daltonics, Bremen, Germany) controlled by Flex Control 3.0 software was used (Bruker Daltonics, Bremen, Germany). A 0.37 µM sample was solubilized in Ultrapure water, mixed (1:1 v:v) in a saturated solution of sinapinic acid, as matrix, and applied to the target plate (Bruker Daltonics, Bremen, Germany) to dry at room temperature. The compound had its molecular mass obtained in the positive linear mode after external calibration, with Protein Calibration Standard (Bruker Daltonics, Bremen, Germany). The MALDI-ToF spectra were processed with Flex Analysis 3.0 software (Bruker Daltonics, Bremen, Germany).

5.6. Amino-Terminal Sequencing of PLA2 from B. erythromelas

The amino-terminal sequencing was obtained through Edman’s degradation, using an automatic Shimadzu PPSQ-31B/33B, initially calibrated with the PTH–amino acid mixture standard. A sample of the purified PLA2 was resuspended in 37% acetonitrile and applied onto a nitrocellulose membrane (PVDF) and dried under nitrogen flow. According to the manufacturer’s recommendations, phenyl thiohydantoin amino acids were detected after separation on an RP-HPLC C18 column (4.6 × 250 mm). The resulting sequences were applied to the CAST protein BLAST search (BLASTP 2.8.0+) and the significant sequences were aligned using ClustalW 1.2.4.

5.7. Hemolysis Test

Erythrocytes of Mus musculus were used for the tests, approved by the ethics committee of the Catholic University Dom Bosco (UCDB) under registration no. 014/2018.
The collected blood was stored at 4 °C until use. The cells were washed three times with 50 mM phosphate buffer, pH 7.4. To the erythrocyte suspension was added the fraction of B. erythromelas venom referring to phospholipase at a concentration of 0.07 μM, in serial dilution of 1.17 to 37.49 μM in a final volume of 100 mL. The samples were incubated at room temperature for 60 min. After centrifugation at 3000 rpm, hemoglobin release was monitored by reading the absorbance of the supernatant at 425 nm in a SpectraMax microplates readers (Thermo Fisher Scientific Oy, Vantaa, Finland). To control hemolysis, erythrocytes suspended in 5 × 104 µM phosphate buffer, pH 7.4 were used; as a positive control (100% erythrocyte lysis), a 1% (by volume) solution of triton X-100 dissolved in distilled water was used to replace the venom fraction. The tests were performed in triplicate [67].

5.8. Antibacterial Activity

Strains of E. coli ATCC 25922, S. aureus ATCC 7133623, and A. baumannii 00332126 (a resistant clinical isolate) were used. For the antibacterial tests, a purified fraction of the venom of the snake B. erythromelas with phospholipase activity was used. The tests to observe the antibacterial activity were performed according to the protocol described by CLSI (Clinical and Laboratory Standards Institute), using the 96-well microplate dilution method. Three technical replicates were organized on the microplates at a final bacterial concentration of 2.5 × 105 CFU.mL−1 (colony forming unit). The samples were tested in concentrations ranging from 1.17 to 37.49 μM. For positive control, the antibiotic ciprofloxacin was used in the same concentrations as the samples, while the bacterial suspension in MHB (Mueller-Hinton Broth) was used as a negative control [68].

5.9. Antibiofilm Activity

Basal Medium 2 (BM2) was used to analyze the biofilm formation. Bacterial cultures of A. baumannii 00332126, proven to be clinical isolate resistant, were used. As bacterial suspensions, they were inoculated into 96-well round-bottom plates, including samples from serial dilutions from 1.17 to 37.49 μM. As negative control, only bacteria were used in the BM2 medium, and as a positive control, the antibiotic ciprofloxacin was used in the same concentrations as the sample. To analyze the growth of planktonic cells, an absorbance of 600 nm was used [69,70].
To assess for biofilm formation, performed as described by Naves et al., 2019, the biofilm formation was read at an absorbance of 595 nm. All absorbance readings were performed with the Multiskan GO microplate reader (Thermo Scientific). All tests were performed in triplicate [71].

Supplementary Materials

The following are available online at https://www.mdpi.com/2072-6651/12/9/606/s1, Figure S1: Antibacterial and antibiofilm activity of the PLA2 isoform.

Author Contributions

E.N. contributed to the work by carrying out all experiments and writing the article; B.F. contributed to the work by teaching techniques such as Bradford, RP-HPLC, and phospholipase activity, following the experiments with the lead author; E.B. contributed to the research by assisting in the antifilm tests; T.F. contributed by helping with the antibacterial test; C.d.O. assisted by carrying out the amino acid sequencing by the E.D. method; N.V. contributed with MALD-ToF; A.d.F.J. contributed by evaluating the writing and supervising students, O.F. contributed by evaluating the writing and supervising students; M.d.M. contributed with the Edman Degradation method; L.M. contributed as a co-advisor, providing space at the S-Inova Laboratory of the Catholic University Dom Bosco, and following the tests performed, as well as correcting the writing of this article; K.L., as a work advisor, contributed in helping with the formation of the objectives and in the development of the experimental design of the research, as well as supervising the writing of this article, making the necessary contributions. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the agency CAPES (Coordination for the Improvement of Higher Education Personnel), https://www.capes.gov.br/.

Acknowledgments

To the research funding agency CAPES (Coordination for the Improvement of Higher Education Personnel) for the scholarship during the period of this work. To the Federal University of Paraiba and the Catholic University Don Bosco for welcoming the first author as a student during this research.

Conflicts of Interest

The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript; or in the decision to publish the results.

References

  1. Livermore, D.M. Minimizing antibiotic resistance. Lancet Infect. Dis. 2005, 5, 450–459. [Google Scholar] [CrossRef] [Scilit]
  2. Loureiro, R.J.; Roque, F.; Rodrigues, A.T.; Herdeiro, M.T.; Ramalheira, E. O uso de antibióticos e as resistências bacterianas: Breves notas sobre a sua evolução. Rev. Port. Saúde Pública 2016, 34, 77–84. [Google Scholar] [CrossRef] [Scilit]
  3. World Health Organization. Containing Antimicrobial Resistance; WHO: Geneva, Switzerland, 2018; Available online: https://www.who.int/antimicrobial-resistance/en/ (accessed on 23 June 2019).
  4. Prevenção e Controle de Infecções e de Resistência aos Antimicrobianos–2017: Programa de Prevenção e Controle de Infecções e de Resistência aos Antimicrobianos 45. Available online: https://www.sns.gov.pt/wp-content/uploads/2017/12/DGS_PCIRA_V8.pdf (accessed on 15 January 2019).
  5. Costerton, J.W.; Irvin, R.T.; Cheng, K.J. The Bacterial Glycocalyx in Nature and Disease. Annu. Rev. Microbiol. 1981, 35, 299–324. [Google Scholar] [CrossRef] [Scilit]
  6. López, D.; Vlamakis, H.; Kolter, R. Biofilms. Cold Spring Harb. Perspect. Biol. 2010, 2, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Donlan, R.M.; Costerton, J.W. Biofilms: Survival mechanisms of clinically relevant microorganisms. Clin. Microbiol. Rev. 2002, 15, 167–193. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Oliveira, M.M.M.; Brugnera, D.F.; Piccoli, R.H. Biofilmes microbianos na indústria de alimentos: Uma revisão. Rev. Inst. Adolfo Lutz 2010, 69, 277–284. [Google Scholar]
  9. Renner, L.D.; Weibel, D.B. Physicochemical regulation of biofilm formation. MRS Bull. 2011, 36, 347–355. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  10. West, S.A.; Winzer, K.; Gardner, A.; Diggle, S.P. Quorum sensing and the confusion about diffusion. Trends Microbiol. 2012, 20, 586–594. [Google Scholar] [CrossRef] [Scilit]
  11. Trentin, D.; Giordani, R.; Macedo, A. Biofilmes bacterianos patogênicos: Aspectos gerais, importância clínica e estratégias de combate. Rev. Lib. 2013, 14, 213. [Google Scholar] [CrossRef] [Scilit]
  12. Rabin, N.; Zheng, Y.; Opoku-Temeng, C.; Du, Y.; Bonsu, E.; Sintim, H.O. Biofilm formation mechanisms and targests for developing antibiofim agents. Future Med. Chem. 2015, 7, 493–512. [Google Scholar] [CrossRef] [Scilit]
  13. Costerton, L.W.; Lewandowski, Z.; Debeer, D.; Caldwell, D.; Korber, D.; James, G. Biofilms, the customized microniche. J. Bacteriol. 1994, 176, 2137–2142. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Donlan, R.M. Biofilms: Microbial life on surfaces. Emerg. Infect. Dis. 2002, 8, 881–890. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Chandra, J.; Mukherjee, P.K. Candida Biofilms: Development, Architecture, and Resistance. Microbiol. Spectr. 2015, 3, 1–24. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Nevalainen, T.J.; Graham, G.G.; Scott, K.F. Antibacterial actions of secreted phospholipases A2. Rev. Biochim. Biophys. Acta 2008, 1781, 1–9. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Samy, R.P.; Gopalakrishnakone, P.; Chow, V.T.K.; Ho, B. Viper metalloproteinase (Agkistrodon halyspallas) with antimicrobial activity against multi-drug resistant human pathogens. J. Cell Physiol. 2008, 216, 54–68. [Google Scholar] [CrossRef] [Scilit]
  18. Moreira, V.; De Castro Souto, P.C.; Ramirez Vinolo, M.A.; Lomonte, B.; Gutiérrez, J.M.; Curi, R.; Teixeira, C. A catalytically-inactive snake venom Lys49 phospholipase A2 homolog induces expression of cyclooxygenase-2 and production of prostaglandins through selected signaling pathways in macrophages. Eur. J. Pharmacol. 2013, 708, 68–79. [Google Scholar] [CrossRef] [Scilit]
  19. Dias, R.G.; Sampaio, S.C.; Sant’anna, M.B.; Cunha, F.Q.; Gutiérrez, J.M.; Lomonte, B.; Cury, Y.; Picolo, G. Articular inflammation induced by an enzymatically-inactive Lys49 phospholipase A2: Activation of endogenous phospholipases contributes to the pronociceptive effect. J. Venom. Anim. Toxins Trop. Dis. 2017, 23, 1–13. [Google Scholar] [CrossRef] [Scilit]
  20. Vindas, J.; Carrera, Y.; Lomonte, B.; Gutiérrez, J.M.; Calvete, J.J.; Sanz, L.; Fernández, J. A novel pentameric phospholipase A2myotoxin (PophPLA2) from the venom of the pit viper porthidium ophryomegas. Int. J. Biol. Macromol. 2018, 118, 1–8. [Google Scholar] [CrossRef] [Scilit]
  21. Scott, D.L.; White, S.P.; Otwinowski, Z.; Yuan, W.; Gelb, M.H.; Singler, P.B. Interfacial catalysis: The mechanism of phospholipase A2. Science 1990, 250, 1541–1546. [Google Scholar] [CrossRef] [Scilit]
  22. Schaloske, R.H.; Dennis, E.A. The phospholipase A2 superfamily and its group numbering system. Biochim. Biophys. Acta 2006, 1761, 1246–1259. [Google Scholar] [CrossRef] [Scilit]
  23. De Maria, L.; Vind, J.; Oxenboll, K.M.; Svendsen, A.; Patkar, S. Phospholipases and their industrial applications. Appl. Microbiol. Biotechnol. 2007, 74, 290–300. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Gutiérrez, J.M.; Rucavado, A.; Chaves, F.; Díaz, C.; Escalante, T. Experimental pathology of local tissue damage induced by Bothrops asper snake venom. Toxicon 2009, 54, 958–975. [Google Scholar] [CrossRef] [Scilit]
  25. Jorge, R.J.B.; Monteiro, H.S.; Gonçalves-Machado, L.; Guarnieri, M.C.; Ximenes, R.M.; Borges-Nojosa, D.M.; Luna, K.P.; Zingali, R.B.; Corrêa-Netto, C.; Gutiérrez, J.M.; et al. Venomics and antivenomics of Bothrops erythromelas from five geographic populations within the Caatinga ecoregion of northeastern Brazil. J. Proteom. 2015, 30, 93–114. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Nery, N.M.; Luna, K.P.O.; Fernandes, C.F.C.; Zuliani, J.P. An overview of Bothrops erythromelas venom. Rev. Soc. Bras. Med. Trop. 2016, 49, 680–686. [Google Scholar] [CrossRef] [Scilit]
  27. Kini, R.M.; Evans, H.J. A model to explain the pharmacological effects of snake venom phospholipases A2. Toxicon 1989, 27, 613–635. [Google Scholar] [CrossRef] [Scilit]
  28. Kini, R.M. Excitement ahead: Structure, function and mechanism of snake venom phospholipase A2 enzymes. Toxicon 2003, 42, 827–840. [Google Scholar] [CrossRef] [Scilit]
  29. Soares, A.; Fontes, M.; Giglio, J. Phospholipase A2 Myotoxins from Bothrops Snake Venoms: Structure-Function Relationship. Curr. Org. Chem. 2004, 8, 1677–1690. [Google Scholar] [CrossRef] [Scilit]
  30. Montecucco, C.O.; Rossetto, O.; Caccin, P.; Rigoni, M.; Carli, L.; Morbiato, L.; Muraro, L.; Paoli, M. Different mechanisms of inhibition of nerve terminals by botulinum and snake presynaptic neurotoxins. Toxicon 2009, 54, 561–564. [Google Scholar] [CrossRef] [Scilit]
  31. Gutiérrez, J.M.; Lomonte, B. Phospholipases A2: Unveiling the secrets of a functionally versatile group of snake venom toxins. Toxicon 2013, 62, 27–39. [Google Scholar] [CrossRef] [Scilit]
  32. Rodrigues, R.S.; Boldrini-França, J.; Fonseca, F.P.; De La Torre, P.; Henrique-Silva, F.; Sanz, L.; Calvete, J.J.; Rodrigues, V.M. Combined snake venomics and venom gland transcriptomic analysis of Bothropoides pauloensis. J. Proteom. 2012, 75, 2707–2720. [Google Scholar] [CrossRef] [Scilit]
  33. Yunes Quartino, P.J.; Barra, J.L.; Fidelio, G.D. Cloning and functional expression of secreted phospholipases A2 from Bothrops diporus (Yarará Chica). Biochem. Biophys. Res. Commun. 2012, 427, 321–325. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Modesto, J.C.A.; Spencer, P.J.; Fritzen, M.; Valença, R.C.; Oliva, M.L.V.; Silva, M.B.; Chudzinski-Tavassi, A.M.; Guarnieri, M.C. BE-I-PLA2, a novel acidic phospholipase A2 from Bothrops erythromelas venom: Isolation, cloning and characterization as potent anti-platelet and inductor of prostaglandin I2 release by endothelial cells. Biochem. Pharmacol. 2006, 72, 377–384. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Garcia Denegri, M.E.; Acosta, O.C.; Huancahuire-Veja, S.; Martins-De-Souza, D.; Marangoni, S.; Maruñak, S.L.; Teibler, G.P.; Leiva, L.C.; Ponce-Soto, L.A. Isolation and functional characterization of a new acidic PLA2 Ba SpII RP4 of the Bothrops alternatus snake venom from Argentina. Toxicon 2010, 56, 64–74. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Pereanez, J.A.; Quintana, J.C.; Alarcón, J.C.; Núñez, V. Isolation and functional characterization of a basic phospholipase A2 from Colombian Bothrops asper venom. Vitae Rev. La Fac. Química Farm. 2014, 21, 38–48. [Google Scholar]
  37. Corrêa, E.A.; Kayano, A.M.; Diniz-Sousa, R.; Setúbal, S.S.; Zanchi, F.B.; Zuliani, J.P.; Matos, N.B.; Almeida, J.R.; Resende, L.M.; Marangoni, S.; et al. Isolation, structural and functional characterization of a new Lys49 phospholipase A2 homologue from Bothrops neuwiedi urutu with bactericidal potential. Toxicon 2016, 115, 13–21. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Menaldo, D.L.; Jacob-Ferreira, A.L.; Bernardes, C.P.; Cintra, A.C.O.; Sampaio, S.V. Purification procedure for the isolation of a P-I metalloprotease and an acidic phospholipase A2 from Bothrops atrox snake venom. J. Venom. Anim. Toxins Trop. Dis. 2015, 21, 1–14. [Google Scholar] [CrossRef] [Scilit]
  39. Cedro, R.C.A.; Menaldo, D.L.; Costa, T.R.; Zoccal, K.F.; Sartim, M.A.; Santos-Filho, N.A.; Faccioli, S.H.; Sampaio, S.V. Cytotoxic and inflammatory potential of a phospholipase A2 from Bothrops jararaca snake venom. J. Venom. Anim. Toxins Trop. Dis. 2018, 24, 1–14. [Google Scholar] [CrossRef] [Scilit]
  40. De Roodt, A.; Fernández, J.; Solano, D.; Lomonte, B. A myotoxic Lys49 phospholipase A2-homologue is the major component of the venom of Bothrops cotiara from Misiones, Argentine. Toxicon 2018, 148, 143–148. [Google Scholar] [CrossRef] [Scilit]
  41. Fagundes, F.H.R.; Aparicio, R.; Dos Santos, M.L.; Diz, E.B.S.; Oliveira, S.C.B.; Toyama, D.O.; Toyama, M.H. A Catalytically Inactive Lys49 PLA2 Isoform from Bothrops jararacussu venom that Stimulates Insulin Secretion in Pancreatic Beta Cells. Protein Pept. Lett. 2011, 18, 1133–1139. [Google Scholar] [CrossRef] [Scilit]
  42. Galbiatti, C.; Rocha, T.; Randazzo-Moura, P.; Ponce-Soto, L.A.; Marangoni, S.; Cruz-Höfling, M.A.; Rodrigues-Simioni, L. Pharmacological and partial biochemical characterization of Bmaj-9 isolated from Bothrops marajoensis snake venom. J. Venom. Anim. Toxins Trop. Dis. 2012, 18, 62–72. [Google Scholar] [CrossRef] [Scilit]
  43. Fernandes, C.A.H.; Borges, R.J.; Lomonte, B.; Fontes, M.R.M. A structural-based proposal for a comprehensive myotoxic mechanism of phospholipase A2-like proteins from viperid snake venoms. Biochim. Biophys. Acta 2014, 1844, 2265–2276. [Google Scholar] [CrossRef] [Scilit]
  44. Silveira, L.B.; Marchi-Salvador, D.P.; Santos-Filho, N.A.; Silva, F.P., Jr.; Marcussi, S.; Fuly, A.L.; Nomizo, A.; Da Silva, S.L.; Stábeli, R.G.; Arantes, E.C.; et al. Isolation and expression of a hypotensive and anti-platelet acidic phospholipase A2 from Bothrops moojeni snake venom. J. Pharm. Biomed. Anal. 2013, 73, 35–43. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Vargas, L.J.; Londoño, M.; Quintana, J.C.; Rua, C.; Segura, C.; Lomonte, B.; Núñez, V. An acidic phospholipase A2 with antibacterial activity from Porthidium nasutum snake venom. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2012, 161, 341–347. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Fernández, M.L.; Quartino, P.Y.; Arce-Bejarano, R.; Fernadez, J.; Camacho, L.F.; Gutiérrez, J.M.; Kuemmel, D.; Fidelio, G.; Lomonte, B. Intravascular hemolysis induced by phospholipase A2 from the venom of the Eastern coral snake, Micrurus fulvius: Functional profiles of hemolytic and non-hemolytic isoforms. Toxicol. Lett. 2018, 286, 39–47. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Costa-Torres, A.F.; Dantas, R.T.; Toyama, M.H.; Diz Filho, E.; Zara, F.J.; Rodrigues De Queiroz, M.G.; Pinto Nogueira, N.A.; Rosa De Oliveira, M.; De Oliveira Toyama, D.; Monteiro, H.S.; et al. Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: Phospholipase A2 and L-aminoacid oxidase. Toxicon 2010, 55, 795–804. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Diniz-Sousa, R.; Caldeira, C.A.S.; Kayano, A.M.; Paloschi, M.V.; Pimenta, D.C.; Simôes-Silva, R.; Ferreira, A.S.; Zanchi, F.B.; Matos, N.B.; Grabner, F.P.; et al. Identification of the Molecular Determinants of the Antibacterial Activity of LmutTX, a Lys49 Phospholipase A2 Homologue Isolated from Lachesis muta muta Snake Venom (Linnaeus, 1766). Basic Clin. Pharm. Toxicol. 2018, 122, 413–423. [Google Scholar] [CrossRef] [Scilit]
  49. Sudharshan, S.; Dhananjaya, B.L. Antibacterial potential of a basic phospholipase A2 (VRV-PL-VIIIa) from Daboia russelii pulchella (Russell’s viper) venom. J. Venom. Anim. Toxins Trop. Dis. 2015, 21, 1–8. [Google Scholar] [CrossRef] [Scilit]
  50. Yan, X.M.; Zhang, S.Q.; Chang, Q.; Liu, P.; Xu, J.S. Antibacterial and antifungal effects of Agkistrodon halys Pallas: Purification of its antibacterial protein-LAO. Shi Yan Sheng Wu Xue Bao 2000, 33, 309–316. [Google Scholar]
  51. Soares, A.M.; Guerra-Sa, R.; Borja-Oliveira, C.R.; Rodrigues, V.M.; Rodrigues-Simioni, L.; Rodrigues, V.; Fontes, M.R.M.; Lomonte, B.; Gutierrez, J.M.; Giglio, J.R. Structural and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi pauloensis venom. Arch. Biochem. Biophys. 2000, 378, 201–209. [Google Scholar] [CrossRef] [Scilit]
  52. Furtado, M.F.D. Biological and immunological properties of the venom of Bothrops alcatraz, and endemic species of pitviper from Brazil. Comp. Biochem. Physiol. 2005, 141, 117–123. [Google Scholar] [CrossRef] [Scilit]
  53. Raetz, C.R.H.; Whitfield, C. Lipopolysaccharide Endotoxins. Annu. Rev. Biochem. 2002, 71, 635–700. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. De Nemacetin-Anvisa, B. Available online: http://www.anvisa.gov.br/datavisa/fila_bula/frmVisualizarBula.asp?pNuTransacao=21331052016&pIdAnexo=3776379 (accessed on 10 September 2019).
  55. Villa, F.; Cappitelli, F. Plant-derived bioactive compounds at sub-lethal concentrations towards smart biocide-free antibiofilm strategies. Phytochem. Rev. 2013, 12, 245–254. [Google Scholar] [CrossRef] [Scilit]
  56. Lauritano, C.; Andersen, J.H.; Hansen, E.; Albrigsten, M.; Escalera, L.; Esposito, F.; Helland, K.; Hanssen, K.; Romano, G.; Ianora, A. Bioactivity Screening of Microalgae for Antioxidant, Anti-Inflammatory, Anticancer, Anti-Diabetes, and Antibacterial Activities. Front. Mar. Sci. 2016, 3, 68. [Google Scholar] [CrossRef] [Scilit]
  57. O’gara, J.P. Ica and beyond: Biofilm mechanisms and regulation in Staphylococcus epidermidis and Staphylococcus aureus. FEMS Microbiol. Lett. 2007, 270, 179–188. [Google Scholar] [CrossRef] [Scilit]
  58. Bocian, A.; Ciszkowicz, E.; Hus, K.K.; Buczkowicz, J.; Lecka-Szlachta, K.; Pietrowska, M.; Petrilla, V.; Petrillova, M.; Legath, L.; Legáth, J. Antimicrobial Activity of Protein Fraction from Naja ashei Venom against Staphylococcus epidermidis. Molecules 2020, 25, 293. [Google Scholar] [CrossRef] [Scilit]
  59. Blower, R.J.; Barksdale, S.M.; Van Hoek, M.L. Snake Cathelicidin NA-CATH and Smaller Helical Antimicrobial Peptides Are Effective against Burkholderia thailandensis. PLoS Negl. Trop. Dis. 2015, 9, 1–16. [Google Scholar] [CrossRef] [Scilit]
  60. Tajbakhsh, M.; Akhavan, M.M.; Fallah, F.; Karimi, A. A Recombinant Snake Cathelicidin Derivative Peptide: Antibiofilm Properties and Expression in Escherichia coli. Biomolecules 2018, 8, 118. [Google Scholar] [CrossRef] [Scilit]
  61. Mohamed, F.M.; Brezden, A.; Mohammad, H.; Chmielewski, J.; Seleem, M.N. A short D-enantiomeric antimicrobial peptide with potent immunomodulatory and antibiofilm activity against multidrug-resistant Pseudomonas aeruginosa and Acinetobacter baumannii. Sci. Rep. 2017, 7, 1–13. [Google Scholar] [CrossRef] [Scilit]
  62. Klein, R.C.; Fabres-Klein, M.H.; De Oliveira, L.L.; Feio, R.N.; Malouin, F.; Ribon, A.D.O.B. A C-Type Lectin from Bothrops jararacussu Venom Disrupts Staphylococcal Biofilms. PLoS ONE 2015, 10, 1–16. [Google Scholar] [CrossRef] [Scilit]
  63. Canhas, I.N.; Heneine, L.G.D.; Fraga, T.; Assis, D.C.S.; Borges, M.H.; Chartone-Souza, E.; Nascimento, A.M.A. Antibacterial activity of different types of snake venom from the Viperidae family against Staphylococcus aureus. Acta Sci. Biol. Sci. 2017, 39, 309–319. [Google Scholar] [CrossRef] [Scilit]
  64. Bradford, M.M. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing the principle of protein dye binding. Anal. Biochem. 1976, 72, 248–254. [Google Scholar] [CrossRef]
  65. Holzer, M.; Mackessy, S. An aqueous endpoint assay of snake venom phospholipase A2. Toxicon 1996, 34, 1149–1155. [Google Scholar] [CrossRef] [Scilit]
  66. Serino-Silva, C.; Morais-Zani, K.; Toyama, M.H.; Toyama, D.O.; Gaeta, H.H.; Rodrigues, C.F.B.; Aguiar, W.S.; Tashima, A.K.; Grego, K.F.; Tanaka-Azevedo, A.M. Purification and characterization of the first γ-phospholipase inhibitor (γPLI) from Bothrops jararaca snake serum. PLoS ONE 2018, 13, 1–16. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Cardoso, M.H.; Ribeiro, S.M.; Nolasco, D.O.; De La Fuente-Núñez, C.; Felício, M.R.; Gonçalves, S.; Mattos, O.C.; Liao, L.M.; Santos, N.C.; Hancock, R.E.W.; et al. A polyalanine peptide derived from polar fish with anti-infectious activities. Sci. Rep. 2016, 6, 1–15. [Google Scholar] [CrossRef] [Scilit]
  68. Hecht, D.W.; Citron, D.M.; Dzink-Fox, J.; Gregory, W.W.; Jacobus, N.V.; Jenkins, S.G.; Rosenblatt, J.E.; Schuetz, A.N.; Wexler, H. Methods for Antimicrobial Susceptibility Testing of Anaerobic Bacteria, Approved Standard, 8th ed.; CLSI Document M11-A8; Clinical and Laboratory Standards Institute: Wayne, PA, USA; Annapolis Junction, MD, USA, 2012; pp. 1–39. [Google Scholar]
  69. De La Fuente-Núnez, C.; Reffuveille, F.; Haney, E.F.; Straus, S.K.; Hancock, R.E.W. Broad-Spectrum Anti-biofilm Peptide That Targets a Cellular Stress Response. PLoS Pathog. 2014, 10, 1–12. [Google Scholar] [CrossRef] [Scilit]
  70. De La Fuente-Núnez, C.; Reffuveille, F.; Mansour, S.C.; Reckseidler-Zenteno, S.L.; Hernández, D.; Brackman, G.; Coenye, T.; Hancock, R.E. D-enantiomeric peptides that eradicate wild-type and multi-drug resistant biofilms and protect against lethal Pseudomonas aeruginosa infections. Chem. Biol. 2015, 22, 196–205. [Google Scholar] [CrossRef] [Scilit]
  71. Naves, P.; Del Prado, G.; Huelves, L.; Gracia, M.; Ruiz, V.; Blanco, J.; Soriano, F. Correlation between virulence factors and in vitro biofilm formation by Escherichia coli strains. Microb. Pathog. 2008, 45, 86–91. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Phospholipase A2 (PLA2) purification from Bothrops erythromelas venom. (a) Reverse-phase chromatographic profile, fractions 1 to 14, on a C18 column equilibrated with solvent A (0.1% TFA in water) and eluted with 5–95% solvent B (acetonitrile: solvent A, 9:1, v:v) and a flow rate of 2 mL.min−1. (b) Fraction 8 (VIII) (*) analyzed by mass spectrometry; ion mass-to-charge ratios are indicated, demonstrating single (C) [M + H]+ 13.6564 Da, double (B) [M + 2H]2+ 6.8265 Da, and triple (A) [M + 3H]3+ 4.5499 Da charge states for the same analyte.
Figure 1. Phospholipase A2 (PLA2) purification from Bothrops erythromelas venom. (a) Reverse-phase chromatographic profile, fractions 1 to 14, on a C18 column equilibrated with solvent A (0.1% TFA in water) and eluted with 5–95% solvent B (acetonitrile: solvent A, 9:1, v:v) and a flow rate of 2 mL.min−1. (b) Fraction 8 (VIII) (*) analyzed by mass spectrometry; ion mass-to-charge ratios are indicated, demonstrating single (C) [M + H]+ 13.6564 Da, double (B) [M + 2H]2+ 6.8265 Da, and triple (A) [M + 3H]3+ 4.5499 Da charge states for the same analyte.
Toxins 12 00606 g001
Figure 2. Comparison between activity of the crude venom of B. erythromelas, the purified fraction PLA2, a commercial phospholipase, and the bovine serum albumin (BSA) consumption of substrate 4N3OBA in a concentration of 0.06 µM. Legend colors: black: PLA2 isoform; blue: PLA2 commercial; red: crude venom; green: BSA.
Figure 2. Comparison between activity of the crude venom of B. erythromelas, the purified fraction PLA2, a commercial phospholipase, and the bovine serum albumin (BSA) consumption of substrate 4N3OBA in a concentration of 0.06 µM. Legend colors: black: PLA2 isoform; blue: PLA2 commercial; red: crude venom; green: BSA.
Toxins 12 00606 g002
Table 1. Sequence alignment of the phospholipase A2 isoform with phospholipase activity with BpPLA2-TXI, sPLA2-II, and BE-I-PLA2, using the ClustalW tool. Legend: asterisk = identity.
Table 1. Sequence alignment of the phospholipase A2 isoform with phospholipase activity with BpPLA2-TXI, sPLA2-II, and BE-I-PLA2, using the ClustalW tool. Legend: asterisk = identity.
SpeciesAccess NumberPLA2AlignmentHomology (%)Charge
B. erythromelas - PLA2 IsoformWLVQFETLIMKIAGRSGVWYYGSYDCYCGSG-0
B. pauloensisD0UGJ0.1BpPLA2-TXINLVQFETLIMKIAGRSGVWYYGSYGCYCGSG96+1
B. diporusAFJ79208.1sPLA2-IINLVQFETLIMKIAGRSGVWYYGSYGCYCGSG96+1
B. erythromelasQ2HZ28.1BE-I-PLA2SLVQFETLIMKIAGRSGVWYYGSYGCYCGSG 96+1
***********************.******
The similarity observed in the purified fraction with the phospholipases BpPLA2-TXI, sPLA2-II, and BE-I-PLA2 offers reliable indications of an acidic characteristic in our sample.
Table 2. Antibacterial and antibiofilm activity and IC50 in vitro evaluation for PLA2 against Escherichia coli ATCC 25922, Acinetobacter baumannii 00332126, and Staphylococcus aureus ATCC 7133623 compared to ciprofloxacin antibiotic activity.
Table 2. Antibacterial and antibiofilm activity and IC50 in vitro evaluation for PLA2 against Escherichia coli ATCC 25922, Acinetobacter baumannii 00332126, and Staphylococcus aureus ATCC 7133623 compared to ciprofloxacin antibiotic activity.
BacteriaConcentration (µM)Ciprofloxacin (%)Activity PLA2 (%)IC50 PLA2 (µM)
E. coli ATCC 25922 37.497 ± 1612 ± 20-
S. aureus ATCC 713362337.490 ± 1862 ± 1730.2
A. baumannii 0033212637.4037 ± 10-
Biofilm
A. baumannii 003321261.177 ± 653 ± 111.1

Share and Cite

MDPI and ACS Style

Nunes, E.; Frihling, B.; Barros, E.; de Oliveira, C.; Verbisck, N.; Flores, T.; de Freitas Júnior, A.; Franco, O.; de Macedo, M.; Migliolo, L.; et al. Antibiofilm Activity of Acidic Phospholipase Isoform Isolated from Bothrops erythromelas Snake Venom. Toxins 2020, 12, 606. https://doi.org/10.3390/toxins12090606

AMA Style

Nunes E, Frihling B, Barros E, de Oliveira C, Verbisck N, Flores T, de Freitas Júnior A, Franco O, de Macedo M, Migliolo L, et al. Antibiofilm Activity of Acidic Phospholipase Isoform Isolated from Bothrops erythromelas Snake Venom. Toxins. 2020; 12(9):606. https://doi.org/10.3390/toxins12090606

Chicago/Turabian Style

Nunes, Ellynes, Breno Frihling, Elizângela Barros, Caio de Oliveira, Newton Verbisck, Taylla Flores, Augusto de Freitas Júnior, Octávio Franco, Maria de Macedo, Ludovico Migliolo, and et al. 2020. "Antibiofilm Activity of Acidic Phospholipase Isoform Isolated from Bothrops erythromelas Snake Venom" Toxins 12, no. 9: 606. https://doi.org/10.3390/toxins12090606

APA Style

Nunes, E., Frihling, B., Barros, E., de Oliveira, C., Verbisck, N., Flores, T., de Freitas Júnior, A., Franco, O., de Macedo, M., Migliolo, L., & Luna, K. (2020). Antibiofilm Activity of Acidic Phospholipase Isoform Isolated from Bothrops erythromelas Snake Venom. Toxins, 12(9), 606. https://doi.org/10.3390/toxins12090606

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop