Designed Cell-Penetrating Peptide Constructs for Inhibition of Pathogenic Protein Self-Assembly
Abstract
1. Introduction
2. Therapeutic Strategies for Amyloid Diseases
3. Cell-Penetrating Peptides (CPPs)
4. CPP-Based Amyloid Inhibitors
4.1. Prion Protein (PrP)-Derived CPPs
4.2. CPP Inhibitors of Aβ Aggregation
4.3. CPP Inhibitors of Tau Aggregation
4.4. CPP Inhibitors of α-Synuclein Aggregation
5. A Functional Bridge: Amyloids and Cancer
6. Conclusions
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
Abbreviation
AAMPs | Amyloidogenic antimicrobial peptides |
Aβ | Amyloid-β peptide |
AβPP | Transmembrane amyloid-β precursor protein |
AD | Alzheimer’s disease |
AFM | Atomic force microscopy |
AICD | APP intracellular domain |
α-syn | α-synuclein |
As2O3 | Arsenic trioxide |
BBB | Blood-brain barrier |
BSE | Bovine spongiform encephalopathy |
β-syn | β-synuclein |
C99 | Membrane-associated carboxy-terminal fragment composed of 99 amino acids |
CD | Circular dichroism spectroscopy |
CJD | Creutzfeldt-Jakob disease |
CPP | Cell-penetrating peptide |
CPP12 | Cyclic cell-penetrating peptide 12 |
cryo-EM | Cryo-electron microscopy |
CTPs | Cancer-targeting peptides |
DBD | DNA-binding domain |
FTIR | Fourier transform infrared spectroscopy |
GPI | Glycosylphosphatidylinositol |
HD | Huntington’s disease |
HIV-1 | Human immunodeficiency virus type-1 |
HTT | Huntingtin |
IAPP | Islet amyloid polypeptide |
IDP | Intrinsically disordered proteins |
iPS | Induced pluripotent stem |
LB | Lewy body |
LN | Lewy neurite |
MAP | Model amphipathic peptide |
MD | Molecular dynamics |
mHTT | mutant Huntingtin |
NAC | Non-Aβ component |
NCAM1 | Neural cell adhesion molecule-1 |
NFT | Neurofibrillary tangles |
NLS | Nuclear localization signal |
NMDA | N-methyl-D-aspartate |
NMR | Nuclear magnetic resonance |
pAntp | Penetratin |
PD | Parkinson’s disease |
PPI | Protein-protein interaction |
PRIMA-1 | Quinuclidinone compound |
PrP | Prion protein |
PrPC | Endogenous cellular form of PrP |
PrPNLS | NLS-like sequence of PrP |
PrPSc | Misfolded and infectious scrapie isoform of PrP |
PTD | Protein transduction domain |
RI | Retro-inverso |
SAP | Sweet arrow peptide |
SAR | Structure-activity relationship |
SIM | SUMO-interacting motifs |
siRNA | Short interfering RNA |
SUMO1 | Small ubiquitin-like modifier protein |
TAT | trans-activator of transcription protein |
T2D | Type II diabetes |
TEM | Transmission electron microscopy |
ThT | Thioflavin T |
TSE | Transmissible spongiform encephalopathies |
TTR | Transthyretin |
VE | Vascular endothelial |
WT | Wild-type |
References
- Louros, N.; Schymkowitz, J.; Rousseau, F. Mechanisms and Pathology of Protein Misfolding and Aggregation. Nat. Rev. Mol. Cell Biol. 2023, 24, 912–933. [Google Scholar] [CrossRef] [PubMed]
- Ghiso, J.; Frangione, B. Amyloidosis and Alzheimer’s Disease. Adv. Drug Deliv. Rev. 2002, 54, 1539–1551. [Google Scholar] [CrossRef] [PubMed]
- Swuec, P.; Lavatelli, F.; Tasaki, M.; Paissoni, C.; Rognoni, P.; Maritan, M.; Brambilla, F.; Milani, P.; Mauri, P.; Camilloni, C.; et al. Cryo-EM Structure of Cardiac Amyloid Fibrils from an Immunoglobulin Light Chain AL Amyloidosis Patient. Nat. Commun. 2019, 10, 1269. [Google Scholar] [CrossRef]
- Limbocker, R.; Cremades, N.; Cascella, R.; Tessier, P.M.; Vendruscolo, M.; Chiti, F. Characterization of Pairs of Toxic and Nontoxic Misfolded Protein Oligomers Elucidates the Structural Determinants of Oligomer Toxicity in Protein Misfolding Diseases. Acc. Chem. Res. 2023, 56, 1395–1405. [Google Scholar] [CrossRef]
- Chiti, F.; Dobson, C.M. Protein Misfolding, Amyloid Formation, and Human Disease: A Summary of Progress over the Last Decade. Annu. Rev. Biochem. 2017, 86, 27–68. [Google Scholar] [CrossRef] [PubMed]
- Heneka, M.T.; Kummer, M.P.; Latz, E. Innate Immune Activation in Neurodegenerative Disease. Nat. Rev. Immunol. 2014, 14, 463–477. [Google Scholar] [CrossRef] [PubMed]
- Masters, S.L.; O’Neill, L.A.J. Disease-Associated Amyloid and Misfolded Protein Aggregates Activate the Inflammasome. Trends Mol. Med. 2011, 17, 276–282. [Google Scholar] [CrossRef] [PubMed]
- Iadanza, M.G.; Jackson, M.P.; Hewitt, E.W.; Ranson, N.A.; Radford, S.E. A New Era for Understanding Amyloid Structures and Disease. Nat. Rev. Mol. Cell Biol. 2018, 19, 755–773. [Google Scholar] [CrossRef]
- Jackson, M.P.; Hewitt, E.W. Cellular Proteostasis: Degradation of Misfolded Proteins by Lysosomes. Essays Biochem. 2016, 60, 173–180. [Google Scholar] [CrossRef]
- Willbold, D.; Strodel, B.; Schröder, G.F.; Hoyer, W.; Heise, H. Amyloid-Type Protein Aggregation and Prion-like Properties of Amyloids. Chem. Rev. 2021, 121, 8285–8307. [Google Scholar] [CrossRef]
- Ilie, I.M.; Caflisch, A. Simulation Studies of Amyloidogenic Polypeptides and Their Aggregates. Chem. Rev. 2019, 119, 6956–6993. [Google Scholar] [CrossRef] [PubMed]
- Hansson, O. Biomarkers for Neurodegenerative Diseases. Nat. Med. 2021, 27, 954–963. [Google Scholar] [CrossRef] [PubMed]
- Thal, D.R.; Griffin, W.S.T.; Braak, H. Parenchymal and Vascular Aβ-Deposition and Its Effects on the Degeneration of Neurons and Cognition in Alzheimer’s Disease. J. Cell. Mol Med. 2008, 12, 1848–1862. [Google Scholar] [CrossRef] [PubMed]
- Hampel, H.; Hardy, J.; Blennow, K.; Chen, C.; Perry, G.; Kim, S.H.; Villemagne, V.L.; Aisen, P.; Vendruscolo, M.; Iwatsubo, T.; et al. The Amyloid-β Pathway in Alzheimer’s Disease. Mol. Psychiatry 2021, 26, 5481–5503. [Google Scholar] [CrossRef]
- Wong, C.W.; Quaranta, V.; Glenner, G.G. Neuritic Plaques and Cerebrovascular Amyloid in Alzheimer Disease Are Antigenically Related. Proc. Natl. Acad. Sci. USA 1985, 82, 8729–8732. [Google Scholar] [CrossRef]
- Goedert, M.; Spillantini, M.G. A Century of Alzheimer’s Disease. Science 2006, 314, 777–781. [Google Scholar] [CrossRef]
- Haass, C.; Kaether, C.; Thinakaran, G.; Sisodia, S. Trafficking and Proteolytic Processing of APP. Cold Spring Harb. Perspect. Med. 2012, 2, a006270. [Google Scholar] [CrossRef]
- Selkoe, D.J. Alzheimer’s Disease: Genes, Proteins, and Therapy. Physiol. Rev. 2001, 81, 741–766. [Google Scholar] [CrossRef]
- Roher, A.E.; Lowenson, J.D.; Clarke, S.; Wolkow, C.; Wang, R.; Cotter, R.J.; Reardon, I.M.; Zürcher-Neely, H.A.; Heinrikson, R.L.; Ball, M.J. Structural Alterations in the Peptide Backbone of Beta-Amyloid Core Protein May Account for Its Deposition and Stability in Alzheimer’s Disease. J. Biol. Chem. 1993, 268, 3072–3083. [Google Scholar] [CrossRef]
- Kosik, K.S.; Joachim, C.L.; Selkoe, D.J. Microtubule-Associated Protein Tau (Tau) Is a Major Antigenic Component of Paired Helical Filaments in Alzheimer Disease. Proc. Natl. Acad. Sci. USA 1986, 83, 4044–4048. [Google Scholar] [CrossRef]
- Grundke-Iqbal, I.; Iqbal, K.; Quinlan, M.; Tung, Y.C.; Zaidi, M.S.; Wisniewski, H.M. Microtubule-Associated Protein Tau. A Component of Alzheimer Paired Helical Filaments. J. Biol. Chem. 1986, 261, 6084–6089. [Google Scholar] [CrossRef] [PubMed]
- Muralidar, S.; Ambi, S.V.; Sekaran, S.; Thirumalai, D.; Palaniappan, B. Role of Tau Protein in Alzheimer’s Disease: The Prime Pathological Player. Int. J. Biol. Macromol. 2020, 163, 1599–1617. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Mandelkow, E. Tau in Physiology and Pathology. Nat. Rev. Neurosci. 2016, 17, 22–35. [Google Scholar] [CrossRef]
- Parra Bravo, C.; Naguib, S.A.; Gan, L. Cellular and Pathological Functions of Tau. Nat. Rev. Mol. Cell Biol. 2024, 25, 845–864. [Google Scholar] [CrossRef] [PubMed]
- Chu, D.; Liu, F. Pathological Changes of Tau Related to Alzheimer’s Disease. ACS Chem. Neurosci. 2019, 10, 931–944. [Google Scholar] [CrossRef]
- Brunello, C.A.; Merezhko, M.; Uronen, R.-L.; Huttunen, H.J. Mechanisms of Secretion and Spreading of Pathological Tau Protein. Cell. Mol. Life Sci. 2020, 77, 1721–1744. [Google Scholar] [CrossRef]
- Martial, B.; Lefèvre, T.; Auger, M. Understanding Amyloid Fibril Formation Using Protein Fragments: Structural Investigations via Vibrational Spectroscopy and Solid-State NMR. Biophys. Rev. 2018, 10, 1133–1149. [Google Scholar] [CrossRef]
- Munishkina, L.A.; Fink, A.L. Fluorescence as a Method to Reveal Structures and Membrane-Interactions of Amyloidogenic Proteins. Biochim. Biophys. Acta (BBA) Biomembr. 2007, 1768, 1862–1885. [Google Scholar] [CrossRef]
- Cohen, S.I.A.; Vendruscolo, M.; Dobson, C.M.; Knowles, T.P.J. From Macroscopic Measurements to Microscopic Mechanisms of Protein Aggregation. J. Mol. Biol. 2012, 421, 160–171. [Google Scholar] [CrossRef]
- Ferrone, F. [17] Analysis of Protein Aggregation Kinetics. In Methods in Enzymology; Amyloid, Prions, and Other Protein Aggregates; Academic Press: Cambridge, MA, USA, 1999; Volume 309, pp. 256–274. [Google Scholar]
- Almeida, Z.L.; Brito, R.M.M. Structure and Aggregation Mechanisms in Amyloids. Molecules 2020, 25, 1195. [Google Scholar] [CrossRef]
- Mannini, B.; Mulvihill, E.; Sgromo, C.; Cascella, R.; Khodarahmi, R.; Ramazzotti, M.; Dobson, C.M.; Cecchi, C.; Chiti, F. Toxicity of Protein Oligomers Is Rationalized by a Function Combining Size and Surface Hydrophobicity. ACS Chem. Biol. 2014, 9, 2309–2317. [Google Scholar] [CrossRef] [PubMed]
- DaRocha-Souto, B.; Scotton, T.C.; Coma, M.; Serrano-Pozo, A.; Hashimoto, T.; Serenó, L.; Rodríguez, M.; Sánchez, B.; Hyman, B.T.; Gómez-Isla, T. Brain Oligomeric β-Amyloid But Not Total Amyloid Plaque Burden Correlates with Neuronal Loss and Astrocyte Inflammatory Response in Amyloid Precursor Protein/Tau Transgenic Mice. J. Neuropathol. Exp. Neurol. 2011, 70, 360–376. [Google Scholar] [CrossRef]
- Selkoe, D.J. Soluble Oligomers of the Amyloid β-Protein Impair Synaptic Plasticity and Behavior. Behav. Brain Res. 2008, 192, 106–113. [Google Scholar] [CrossRef]
- Toyama, B.H.; Weissman, J.S. Amyloid Structure: Conformational Diversity and Consequences. Annu. Rev. Biochem. 2011, 80, 557–585. [Google Scholar] [CrossRef] [PubMed]
- Buxbaum, J.N.; Dispenzieri, A.; Eisenberg, D.S.; Fändrich, M.; Merlini, G.; Saraiva, M.J.M.; Sekijima, Y.; Westermark, P. Amyloid Nomenclature 2022: Update, Novel Proteins, and Recommendations by the International Society of Amyloidosis (ISA) Nomenclature Committee. Amyloid 2022, 29, 213–219. [Google Scholar] [CrossRef] [PubMed]
- Rinauro, D.J.; Chiti, F.; Vendruscolo, M.; Limbocker, R. Misfolded Protein Oligomers: Mechanisms of Formation, Cytotoxic Effects, and Pharmacological Approaches against Protein Misfolding Diseases. Mol. Neurodegener. 2024, 19, 20. [Google Scholar] [CrossRef]
- de Oliveira, E.C.L.; da Costa, K.S.; Taube, P.S.; Lima, A.H.; Junior, C.d.S.d.S. Biological Membrane-Penetrating Peptides: Computational Prediction and Applications. Front. Cell. Infect. Microbiol. 2022, 12, 838259. [Google Scholar] [CrossRef] [PubMed]
- Österlund, N.; Wärmländer, S.K.T.S.; Gräslund, A. Cell-Penetrating Peptides with Unexpected Anti-Amyloid Properties. Pharmaceutics 2022, 14, 823. [Google Scholar] [CrossRef]
- Xie, J.; Bi, Y.; Zhang, H.; Dong, S.; Teng, L.; Lee, R.J.; Yang, Z. Cell-Penetrating Peptides in Diagnosis and Treatment of Human Diseases: From Preclinical Research to Clinical Application. Front. Pharmacol. 2020, 11, 697. [Google Scholar] [CrossRef]
- Kurrikoff, K.; Vunk, B.; Langel, Ü. Status Update in the Use of Cell-Penetrating Peptides for the Delivery of Macromolecular Therapeutics. Expert Opin. Biol. Ther. 2021, 21, 361–370. [Google Scholar] [CrossRef]
- Lönn, P.; Dowdy, S.F. Cationic PTD/CPP-Mediated Macromolecular Delivery: Charging into the Cell. Expert Opin. Drug Deliv. 2015, 12, 1627–1636. [Google Scholar] [CrossRef] [PubMed]
- Schwarze, S.R.; Ho, A.; Vocero-Akbani, A.; Dowdy, S.F. In Vivo Protein Transduction: Delivery of a Biologically Active Protein into the Mouse. Science 1999, 285, 1569–1572. [Google Scholar] [CrossRef] [PubMed]
- Stalmans, S.; Bracke, N.; Wynendaele, E.; Gevaert, B.; Peremans, K.; Burvenich, C.; Polis, I.; Spiegeleer, B.D. Cell-Penetrating Peptides Selectively Cross the Blood-Brain Barrier In Vivo. PLoS ONE 2015, 10, e0139652. [Google Scholar] [CrossRef] [PubMed]
- He, H.; Sheng, J.; David, A.E.; Kwon, Y.M.; Zhang, J.; Huang, Y.; Wang, J.; Yang, V.C. The Use of Low Molecular Weight Protamine Chemical Chimera to Enhance Monomeric Insulin Intestinal Absorption. Biomaterials 2013, 34, 7733–7743. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Zhao, Y.; Wang, H.; Gong, J.; He, H.; Shin, M.C.; Yang, V.C.; Huang, Y. Low-Molecular-Weight Protamine-Modified PLGA Nanoparticles for Overcoming Drug-Resistant Breast Cancer. J. Control. Release 2014, 192, 47–56. [Google Scholar] [CrossRef]
- Bottens, R.A.; Yamada, T. Cell-Penetrating Peptides (CPPs) as Therapeutic and Diagnostic Agents for Cancer. Cancers 2022, 14, 5546. [Google Scholar] [CrossRef]
- Gessner, I.; Neundorf, I. Nanoparticles Modified with Cell-Penetrating Peptides: Conjugation Mechanisms, Physicochemical Properties, and Application in Cancer Diagnosis and Therapy. Int. J. Mol. Sci. 2020, 21, 2536. [Google Scholar] [CrossRef]
- Zorko, M.; Jones, S.; Langel, Ü. Cell-Penetrating Peptides in Protein Mimicry and Cancer Therapeutics. Adv. Drug Deliv. Rev. 2022, 180, 114044. [Google Scholar] [CrossRef]
- Soto, C.; Pritzkow, S. Protein Misfolding, Aggregation, and Conformational Strains in Neurodegenerative Diseases. Nat. Neurosci. 2018, 21, 1332–1340. [Google Scholar] [CrossRef]
- Zhang, Y.; Chen, H.; Li, R.; Sterling, K.; Song, W. Amyloid β-Based Therapy for Alzheimer’s Disease: Challenges, Successes and Future. Sig. Transduct. Target Ther. 2023, 8, 248. [Google Scholar] [CrossRef]
- Basha, S.; Mukunda, D.C.; Rodrigues, J.; Gail D’Souza, M.; Gangadharan, G.; Pai, A.R.; Mahato, K.K. A Comprehensive Review of Protein Misfolding Disorders, Underlying Mechanism, Clinical Diagnosis, and Therapeutic Strategies. Ageing Res. Rev. 2023, 90, 102017. [Google Scholar] [CrossRef] [PubMed]
- Singh, B.; Day, C.M.; Abdella, S.; Garg, S. Alzheimer’s Disease Current Therapies, Novel Drug Delivery Systems and Future Directions for Better Disease Management. J. Control. Release 2024, 367, 402–424. [Google Scholar] [CrossRef] [PubMed]
- Guo, J.; Wang, Z.; Liu, R.; Huang, Y.; Zhang, N.; Zhang, R. Memantine, Donepezil, or Combination Therapy—What Is the Best Therapy for Alzheimer’s Disease? A Network Meta-Analysis. Brain Behav. 2020, 10, e01831. [Google Scholar] [CrossRef] [PubMed]
- Yaghmaei, E.; Lu, H.; Ehwerhemuepha, L.; Zheng, J.; Danioko, S.; Rezaie, A.; Sajjadi, S.A.; Rakovski, C. Combined Use of Donepezil and Memantine Increases the Probability of Five-Year Survival of Alzheimer’s Disease Patients. Commun. Med. 2024, 4, 99. [Google Scholar] [CrossRef] [PubMed]
- Dong, H.; Csernansky, C.A.; Martin, M.V.; Bertchume, A.; Vallera, D.; Csernansky, J.G. Acetylcholinesterase Inhibitors Ameliorate Behavioral Deficits in the Tg2576 Mouse Model of Alzheimer’s Disease. Psychopharmacology 2005, 181, 145–152. [Google Scholar] [CrossRef]
- Armiento, V.; Spanopoulou, A.; Kapurniotu, A. Peptide-Based Molecular Strategies To Interfere with Protein Misfolding, Aggregation, and Cell Degeneration. Angew. Chem. Int. Ed. 2020, 59, 3372–3384. [Google Scholar] [CrossRef]
- Yee, A.W.; Aldeghi, M.; Blakeley, M.P.; Ostermann, A.; Mas, P.J.; Moulin, M.; de Sanctis, D.; Bowler, M.W.; Mueller-Dieckmann, C.; Mitchell, E.P.; et al. A Molecular Mechanism for Transthyretin Amyloidogenesis. Nat. Commun. 2019, 10, 925. [Google Scholar] [CrossRef]
- Adams, D.; Koike, H.; Slama, M.; Coelho, T. Hereditary Transthyretin Amyloidosis: A Model of Medical Progress for a Fatal Disease. Nat. Rev. Neurol. 2019, 15, 387–404. [Google Scholar] [CrossRef]
- Koike, H.; Katsuno, M. Transthyretin Amyloidosis: Update on the Clinical Spectrum, Pathogenesis, and Disease-Modifying Therapies. Neurol. Ther. 2020, 9, 317–333. [Google Scholar] [CrossRef]
- Aimo, A.; Castiglione, V.; Rapezzi, C.; Franzini, M.; Panichella, G.; Vergaro, G.; Gillmore, J.; Fontana, M.; Passino, C.; Emdin, M. RNA-Targeting and Gene Editing Therapies for Transthyretin Amyloidosis. Nat. Rev. Cardiol. 2022, 19, 655–667. [Google Scholar] [CrossRef]
- Hu, B.; Zhong, L.; Weng, Y.; Peng, L.; Huang, Y.; Zhao, Y.; Liang, X.-J. Therapeutic siRNA: State of the Art. Sig. Transduct. Target Ther. 2020, 5, 101. [Google Scholar] [CrossRef] [PubMed]
- Yan, R.; Vassar, R. Targeting the β Secretase BACE1 for Alzheimer’s Disease Therapy. Lancet Neurol. 2014, 13, 319–329. [Google Scholar] [CrossRef] [PubMed]
- Dovey, H.F.; John, V.; Anderson, J.P.; Chen, L.Z.; de Saint Andrieu, P.; Fang, L.Y.; Freedman, S.B.; Folmer, B.; Goldbach, E.; Holsztynska, E.J.; et al. Functional Gamma-Secretase Inhibitors Reduce Beta-Amyloid Peptide Levels in Brain. J. Neurochem. 2001, 76, 173–181. [Google Scholar] [CrossRef] [PubMed]
- Citron, M. Alzheimer’s Disease: Strategies for Disease Modification. Nat. Rev. Drug Discov. 2010, 9, 387–398. [Google Scholar] [CrossRef]
- Reitz, C. Alzheimer′s Disease and the Amyloid Cascade Hypothesis: A Critical Review. Int. J. Alzheimer’s Dis. 2012, 2012, 369808. [Google Scholar] [CrossRef]
- Hong, L.; Koelsch, G.; Lin, X.; Wu, S.; Terzyan, S.; Ghosh, A.K.; Zhang, X.C.; Tang, J. Structure of the Protease Domain of Memapsin 2 (β-Secretase) Complexed with Inhibitor. Science 2000, 290, 150–153. [Google Scholar] [CrossRef]
- Albert, J.S. 4—Progress in the Development of β-Secretase Inhibitors for Alzheimer’s Disease. In Progress in Medicinal Chemistry; Lawton, G., Witty, D.R., Eds.; Elsevier: Amsterdam, The Netherlands, 2009; Volume 48, pp. 133–161. [Google Scholar]
- Vassar, R.; Kovacs, D.M.; Yan, R.; Wong, P.C. The β-Secretase Enzyme BACE in Health and Alzheimer’s Disease: Regulation, Cell Biology, Function, and Therapeutic Potential. J. Neurosci. 2009, 29, 12787–12794. [Google Scholar] [CrossRef]
- Wolfe, M.S. Structure and Function of the γ-Secretase Complex. Biochemistry 2019, 58, 2953–2966. [Google Scholar] [CrossRef]
- Yang, G.; Zhou, R.; Zhou, Q.; Guo, X.; Yan, C.; Ke, M.; Lei, J.; Shi, Y. Structural Basis of Notch Recognition by Human γ-Secretase. Nature 2019, 565, 192–197. [Google Scholar] [CrossRef]
- De Strooper, B.; Annaert, W.; Cupers, P.; Saftig, P.; Craessaerts, K.; Mumm, J.S.; Schroeter, E.H.; Schrijvers, V.; Wolfe, M.S.; Ray, W.J.; et al. A Presenilin-1-Dependent γ-Secretase-like Protease Mediates Release of Notch Intracellular Domain. Nature 1999, 398, 518–522. [Google Scholar] [CrossRef]
- Artavanis-Tsakonas, S.; Rand, M.D.; Lake, R.J. Notch Signaling: Cell Fate Control and Signal Integration in Development. Science 1999, 284, 770–776. [Google Scholar] [CrossRef] [PubMed]
- Zhou, B.; Lin, W.; Long, Y.; Yang, Y.; Zhang, H.; Wu, K.; Chu, Q. Notch Signaling Pathway: Architecture, Disease, and Therapeutics. Sig. Transduct. Target Ther. 2022, 7, 95. [Google Scholar] [CrossRef] [PubMed]
- Panza, F.; Frisardi, V.; Imbimbo, B.P.; Capurso, C.; Logroscino, G.; Sancarlo, D.; Seripa, D.; Vendemiale, G.; Pilotto, A.; Solfrizzi, V. REVIEW: γ-Secretase Inhibitors for the Treatment of Alzheimer’s Disease: The Current State. CNS Neurosci. Ther. 2010, 16, 272–284. [Google Scholar] [CrossRef] [PubMed]
- Doody, R.S.; Raman, R.; Sperling, R.A.; Seimers, E.; Sethuraman, G.; Mohs, R.; Farlow, M.; Iwatsubo, T.; Vellas, B.; Sun, X.; et al. Peripheral and Central Effects of γ-Secretase Inhibition by Semagacestat in Alzheimer’s Disease. Alzheimer’s Res. Ther. 2015, 7, 36. [Google Scholar] [CrossRef] [PubMed]
- Simutis, F.J.; Sanderson, T.P.; Pilcher, G.D.; Graziano, M.J. Nonclinical Safety Assessment of the γ-Secretase Inhibitor Avagacestat. Toxicol. Sci. 2018, 163, 525–542. [Google Scholar] [CrossRef]
- Buxbaum, J.N.; Reixach, N. Transthyretin: The Servant of Many Masters. Cell. Mol. Life Sci. 2009, 66, 3095–3101. [Google Scholar] [CrossRef]
- Sosa, L.J.; Cáceres, A.; Dupraz, S.; Oksdath, M.; Quiroga, S.; Lorenzo, A. The Physiological Role of the Amyloid Precursor Protein as an Adhesion Molecule in the Developing Nervous System. J. Neurochem. 2017, 143, 11–29. [Google Scholar] [CrossRef]
- Chen, J.; Chen, J.-S.; Li, S.; Zhang, F.; Deng, J.; Zeng, L.-H.; Tan, J. Amyloid Precursor Protein: A Regulatory Hub in Alzheimer’s Disease. Aging Dis. 2024, 15, 201–225. [Google Scholar] [CrossRef]
- Brothers, H.M.; Gosztyla, M.L.; Robinson, S.R. The Physiological Roles of Amyloid-β Peptide Hint at New Ways to Treat Alzheimer’s Disease. Front. Aging Neurosci. 2018, 10, 118. [Google Scholar] [CrossRef]
- Kumar, D.K.V.; Choi, S.H.; Washicosky, K.J.; Eimer, W.A.; Tucker, S.; Ghofrani, J.; Lefkowitz, A.; McColl, G.; Goldstein, L.E.; Tanzi, R.E.; et al. Amyloid-β Peptide Protects against Microbial Infection in Mouse and Worm Models of Alzheimer’s Disease. Sci. Transl. Med. 2016, 8, ra72. [Google Scholar] [CrossRef]
- Bishop, G.M.; Robinson, S.R. Physiological Roles of Amyloid-β and Implications for Its Removal in Alzheimer’s Disease. Drugs Aging 2004, 21, 621–630. [Google Scholar] [CrossRef] [PubMed]
- Gabriele, R.M.C.; Abel, E.; Fox, N.C.; Wray, S.; Arber, C. Knockdown of Amyloid Precursor Protein: Biological Consequences and Clinical Opportunities. Front. Neurosci. 2022, 16, 835645. [Google Scholar] [CrossRef]
- Zheng, H.; Jiang, M.; Trumbauer, M.E.; Sirinathsinghji, D.J.; Hopkins, R.; Smith, D.W.; Heavens, R.P.; Dawson, G.R.; Boyce, S.; Conner, M.W.; et al. Beta-Amyloid Precursor Protein-Deficient Mice Show Reactive Gliosis and Decreased Locomotor Activity. Cell 1995, 81, 525–531. [Google Scholar] [CrossRef] [PubMed]
- Young-Pearse, T.L.; Bai, J.; Chang, R.; Zheng, J.B.; LoTurco, J.J.; Selkoe, D.J. A Critical Function for β-Amyloid Precursor Protein in Neuronal Migration Revealed by In Utero RNA Interference. J. Neurosci. 2007, 27, 14459–14469. [Google Scholar] [CrossRef] [PubMed]
- Palhano, F.L.; Lee, J.; Grimster, N.P.; Kelly, J.W. Toward the Molecular Mechanism(s) by Which EGCG Treatment Remodels Mature Amyloid Fibrils. J. Am. Chem. Soc. 2013, 135, 7503–7510. [Google Scholar] [CrossRef]
- Maity, D.; Oh, Y.; Gremer, L.; Hoyer, W.; Magzoub, M.; Hamilton, A.D. Cucurbit[7]Uril Inhibits Islet Amyloid Polypeptide Aggregation by Targeting N Terminus Hot Segments and Attenuates Cytotoxicity. Chem. A Eur. J. 2022, 28, e202200456. [Google Scholar] [CrossRef]
- Xu, Y.; Maya-Martinez, R.; Guthertz, N.; Heath, G.R.; Manfield, I.W.; Breeze, A.L.; Sobott, F.; Foster, R.; Radford, S.E. Tuning the Rate of Aggregation of hIAPP into Amyloid Using Small-Molecule Modulators of Assembly. Nat. Commun. 2022, 13, 1040. [Google Scholar] [CrossRef] [PubMed]
- Sayed, R.H.; Hawkins, P.N.; Lachmann, H.J. Emerging Treatments for Amyloidosis. Kidney Int. 2015, 87, 516–526. [Google Scholar] [CrossRef]
- Coelho, T.; Maia, L.F.; Martins da Silva, A.; Waddington Cruz, M.; Planté-Bordeneuve, V.; Lozeron, P.; Suhr, O.B.; Campistol, J.M.; Conceição, I.M.; Schmidt, H.H.-J.; et al. Tafamidis for Transthyretin Familial Amyloid Polyneuropathy. Neurology 2012, 79, 785–792. [Google Scholar] [CrossRef]
- Hammarström, P.; Wiseman, R.L.; Powers, E.T.; Kelly, J.W. Prevention of Transthyretin Amyloid Disease by Changing Protein Misfolding Energetics. Science 2003, 299, 713–716. [Google Scholar] [CrossRef]
- Necula, M.; Breydo, L.; Milton, S.; Kayed, R.; van der Veer, W.E.; Tone, P.; Glabe, C.G. Methylene Blue Inhibits Amyloid Aβ Oligomerization by Promoting Fibrillization. Biochemistry 2007, 46, 8850–8860. [Google Scholar] [CrossRef] [PubMed]
- Ehrnhoefer, D.E.; Bieschke, J.; Boeddrich, A.; Herbst, M.; Masino, L.; Lurz, R.; Engemann, S.; Pastore, A.; Wanker, E.E. EGCG Redirects Amyloidogenic Polypeptides into Unstructured, off-Pathway Oligomers. Nat. Struct Mol. Biol. 2008, 15, 558–566. [Google Scholar] [CrossRef] [PubMed]
- Cummings, C.G.; Hamilton, A.D. Disrupting Protein–Protein Interactions with Non-Peptidic, Small Molecule α-Helix Mimetics. Curr. Opin. Chem. Biol. 2010, 14, 341–346. [Google Scholar] [CrossRef]
- Azzarito, V.; Long, K.; Murphy, N.S.; Wilson, A.J. Inhibition of α-Helix-Mediated Protein–Protein Interactions Using Designed Molecules. Nat. Chem. 2013, 5, 161–173. [Google Scholar] [CrossRef] [PubMed]
- Kumar, S.; Henning-Knechtel, A.; Chehade, I.; Magzoub, M.; Hamilton, A.D. Foldamer-Mediated Structural Rearrangement Attenuates Aβ Oligomerization and Cytotoxicity. J. Am. Chem. Soc. 2017, 139, 17098–17108. [Google Scholar] [CrossRef]
- Maity, D.; Howarth, M.; Vogel, M.C.; Magzoub, M.; Hamilton, A.D. Peptidomimetic-Based Vesicles Inhibit Amyloid-β Fibrillation and Attenuate Cytotoxicity. J. Am. Chem. Soc. 2021, 143, 3086–3093. [Google Scholar] [CrossRef]
- Kumar, S.; Henning-Knechtel, A.; Magzoub, M.; Hamilton, A.D. Peptidomimetic-Based Multidomain Targeting Offers Critical Evaluation of Aβ Structure and Toxic Function. J. Am. Chem. Soc. 2018, 140, 6562–6574. [Google Scholar] [CrossRef]
- Wang, L.; Wang, N.; Zhang, W.; Cheng, X.; Yan, Z.; Shao, G.; Wang, X.; Wang, R.; Fu, C. Therapeutic Peptides: Current Applications and Future Directions. Sig. Transduct. Target Ther. 2022, 7, 48. [Google Scholar] [CrossRef]
- Ribarič, S. Peptides as Potential Therapeutics for Alzheimer’s Disease. Molecules 2018, 23, 283. [Google Scholar] [CrossRef]
- Neddenriep, B.; Calciano, A.; Conti, D.; Sauve, E.; Paterson, M.; Bruno, E.; Moffet, D.A. Short Peptides as Inhibitors of Amyloid Aggregation. Open Biotechnol. J. 2011, 5, 39–46. [Google Scholar] [CrossRef]
- Brasnjevic, I.; Steinbusch, H.W.M.; Schmitz, C.; Martinez-Martinez, P. Delivery of Peptide and Protein Drugs over the Blood–Brain Barrier. Prog. Neurobiol. 2009, 87, 212–251. [Google Scholar] [CrossRef] [PubMed]
- Magzoub, M.; Zhang, H.; Dix, J.A.; Verkman, A.S. Extracellular Space Volume Measured by Two-Color Pulsed Dye Infusion with Microfiberoptic Fluorescence Photodetection. Biophys. J. 2009, 96, 2382–2390. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Chan, A.; Tsourkas, A. Intracellular Protein Delivery: Approaches, Challenges, and Clinical Applications. BME Front. 2024, 5, 35. [Google Scholar] [CrossRef]
- Stewart, M.P.; Langer, R.; Jensen, K.F. Intracellular Delivery by Membrane Disruption: Mechanisms, Strategies, and Concepts. Chem. Rev. 2018, 118, 7409–7531. [Google Scholar] [CrossRef]
- Patel, S.; Kim, J.; Herrera, M.; Mukherjee, A.; Kabanov, A.V.; Sahay, G. Brief Update on Endocytosis of Nanomedicines. Adv. Drug Deliv. Rev. 2019, 144, 90–111. [Google Scholar] [CrossRef]
- Frankel, A.D.; Pabo, C.O. Cellular Uptake of the Tat Protein from Human Immunodeficiency Virus. Cell 1988, 55, 1189–1193. [Google Scholar] [CrossRef]
- Green, M.; Loewenstein, P.M. Autonomous Functional Domains of Chemically Synthesized Human Immunodeficiency Virus Tat Trans-Activator Protein. Cell 1988, 55, 1179–1188. [Google Scholar] [CrossRef] [PubMed]
- Joliot, A.; Pernelle, C.; Deagostini-Bazin, H.; Prochiantz, A. Antennapedia Homeobox Peptide Regulates Neural Morphogenesis. Proc. Natl. Acad. Sci. USA 1991, 88, 1864–1868. [Google Scholar] [CrossRef]
- Green, M.; Ishino, M.; Loewenstein, P.M. Mutational Analysis of HIV-1 Tat Minimal Domain Peptides: Identification of Trans-Dominant Mutants That Suppress HIV-LTR-Driven Gene Expression. Cell 1989, 58, 215–223. [Google Scholar] [CrossRef]
- Vivès, E.; Brodin, P.; Lebleu, B. A Truncated HIV-1 Tat Protein Basic Domain Rapidly Translocates through the Plasma Membrane and Accumulates in the Cell Nucleus. J. Biol. Chem. 1997, 272, 16010–16017. [Google Scholar] [CrossRef]
- Derossi, D.; Joliot, A.H.; Chassaing, G.; Prochiantz, A. The Third Helix of the Antennapedia Homeodomain Translocates through Biological Membranes. J. Biol. Chem. 1994, 269, 10444–10450. [Google Scholar] [CrossRef] [PubMed]
- Magzoub, M.; Gräslund, A. Cell-Penetrating Peptides: Small from Inception to Application. Q. Rev. Biophys. 2004, 37, 147–195. [Google Scholar] [CrossRef] [PubMed]
- Gori, A.; Lodigiani, G.; Colombarolli, S.G.; Bergamaschi, G.; Vitali, A. Cell Penetrating Peptides: Classification, Mechanisms, Methods of Study, and Applications. ChemMedChem 2023, 18, e202300236. [Google Scholar] [CrossRef]
- Bangera, P.D.; Kara, D.D.; Tanvi, K.; Tippavajhala, V.K.; Rathnanand, M. Highlights on Cell-Penetrating Peptides and Polymer-Lipid Hybrid Nanoparticle: Overview and Therapeutic Applications for Targeted Anticancer Therapy. AAPS PharmSciTech 2023, 24, 124. [Google Scholar] [CrossRef]
- Ruseska, I.; Zimmer, A. Internalization Mechanisms of Cell-Penetrating Peptides. Beilstein J. Nanotechnol. 2020, 11, 101–123. [Google Scholar] [CrossRef] [PubMed]
- Åmand, H.L.; Fant, K.; Nordén, B.; Esbjörner, E.K. Stimulated Endocytosis in Penetratin Uptake: Effect of Arginine and Lysine. Biochem. Biophys. Res. Commun. 2008, 371, 621–625. [Google Scholar] [CrossRef] [PubMed]
- Mitchell, D.J.; Steinman, L.; Kim, D.T.; Fathman, C.G.; Rothbard, J.B. Polyarginine Enters Cells More Efficiently than Other Polycationic Homopolymers. J. Pept. Res. 2000, 56, 318–325. [Google Scholar] [CrossRef]
- Futaki, S.; Suzuki, T.; Ohashi, W.; Yagami, T.; Tanaka, S.; Ueda, K.; Sugiura, Y. Arginine-Rich Peptides: An abundant source of membrane-permeable peptides having potential as carriers for intracellular protein delivery. J. Biol. Chem. 2001, 276, 5836–5840. [Google Scholar] [CrossRef]
- Kim, G.C.; Cheon, D.H.; Lee, Y. Challenge to Overcome Current Limitations of Cell-Penetrating Peptides. Biochim. Biophys. Acta (BBA) Proteins Proteom. 2021, 1869, 140604. [Google Scholar] [CrossRef]
- Martín, I.; Teixidó, M.; Giralt, E. Design, Synthesis and Characterization of a New Anionic Cell-Penetrating Peptide: SAP(E). ChemBioChem 2011, 12, 896–903. [Google Scholar] [CrossRef]
- Franz, J.; Lelle, M.; Peneva, K.; Bonn, M.; Weidner, T. SAP(E)—A Cell-Penetrating Polyproline Helix at Lipid Interfaces. Biochim. Biophys. Acta (BBA) Biomembr. 2016, 1858, 2028–2034. [Google Scholar] [CrossRef] [PubMed]
- Rydström, A.; Deshayes, S.; Konate, K.; Crombez, L.; Padari, K.; Boukhaddaoui, H.; Aldrian, G.; Pooga, M.; Divita, G. Direct Translocation as Major Cellular Uptake for CADY Self-Assembling Peptide-Based Nanoparticles. PLoS ONE 2011, 6, e25924. [Google Scholar] [CrossRef] [PubMed]
- Copolovici, D.M.; Langel, K.; Eriste, E.; Langel, Ü. Cell-Penetrating Peptides: Design, Synthesis, and Applications. ACS Nano 2014, 8, 1972–1994. [Google Scholar] [CrossRef]
- Hao, M.; Zhang, L.; Chen, P. Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides. Int. J. Mol. Sci. 2022, 23, 9038. [Google Scholar] [CrossRef]
- Patel, S.G.; Sayers, E.J.; He, L.; Narayan, R.; Williams, T.L.; Mills, E.M.; Allemann, R.K.; Luk, L.Y.P.; Jones, A.T.; Tsai, Y.-H. Cell-Penetrating Peptide Sequence and Modification Dependent Uptake and Subcellular Distribution of Green Florescent Protein in Different Cell Lines. Sci. Rep. 2019, 9, 6298. [Google Scholar] [CrossRef]
- Hymel, H.C.; Rahnama, A.; Sanchez, O.M.; Liu, D.; Gauthier, T.J.; Melvin, A.T. How Cargo Identity Alters the Uptake of Cell-Penetrating Peptide (CPP)/Cargo Complexes: A Study on the Effect of Net Cargo Charge and Length. Cells 2022, 11, 1195. [Google Scholar] [CrossRef]
- Brock, R. The Uptake of Arginine-Rich Cell-Penetrating Peptides: Putting the Puzzle Together. Bioconjug. Chem. 2014, 25, 863–868. [Google Scholar] [CrossRef] [PubMed]
- Löfgren, K.; Wahlström, A.; Lundberg, P.; Langel, Ö.; Gräslund, A.; Bedecs, K. Antiprion Properties of Prion Protein-Derived Cell-Penetrating Peptides. FASEB J. 2008, 22, 2177–2184. [Google Scholar] [CrossRef]
- Prusiner, S.B. Prions. Proc. Natl. Acad. Sci. USA 1998, 95, 13363–13383. [Google Scholar] [CrossRef]
- Zerr, I.; Ladogana, A.; Mead, S.; Hermann, P.; Forloni, G.; Appleby, B.S. Creutzfeldt–Jakob Disease and Other Prion Diseases. Nat. Rev. Dis. Primers 2024, 10, 14. [Google Scholar] [CrossRef]
- Kretzschmar, H.A.; Prusiner, S.B.; Stowring, L.E.; DeArmond, S.J. Scrapie Prion Proteins Are Synthesized in Neurons. Am. J. Pathol. 1986, 122, 1–5. [Google Scholar] [PubMed]
- Ford, M.J.; Burton, L.J.; Morris, R.J.; Hall, S.M. Selective Expression of Prion Protein in Peripheral Tissues of the Adult Mouse. Neuroscience 2002, 113, 177–192. [Google Scholar] [CrossRef] [PubMed]
- Beekes, M.; McBride, P.A. Early Accumulation of Pathological PrP in the Enteric Nervous System and Gut-Associated Lymphoid Tissue of Hamsters Orally Infected with Scrapie. Neurosci. Lett. 2000, 278, 181–184. [Google Scholar] [CrossRef] [PubMed]
- Brown, D.R. Prion and Prejudice: Normal Protein and the Synapse. Trends Neurosci. 2001, 24, 85–90. [Google Scholar] [CrossRef] [PubMed]
- Stewart, R.S.; Drisaldi, B.; Harris, D.A. A Transmembrane Form of the Prion Protein Contains an Uncleaved Signal Peptide and Is Retained in the Endoplasmic Reticululm. MBoC 2001, 12, 881–889. [Google Scholar] [CrossRef]
- Lundberg, P.; Magzoub, M.; Lindberg, M.; Hällbrink, M.; Jarvet, J.; Eriksson, L.E.G.; Langel, Ü.; Gräslund, A. Cell Membrane Translocation of the N-Terminal (1–28) Part of the Prion Protein. Biochem. Biophys. Res. Commun. 2002, 299, 85–90. [Google Scholar] [CrossRef]
- Stewart, R.S.; Harris, D.A. A Transmembrane Form of the Prion Protein Is Localized in the Golgi Apparatus of Neurons. J. Biol. Chem. 2005, 280, 15855–15864. [Google Scholar] [CrossRef]
- Hegde, R.S.; Mastrianni, J.A.; Scott, M.R.; DeFea, K.A.; Tremblay, P.; Torchia, M.; DeArmond, S.J.; Prusiner, S.B.; Lingappa, V.R. A Transmembrane Form of the Prion Protein in Neurodegenerative Disease. Science 1998, 279, 827–834. [Google Scholar] [CrossRef]
- Boulikas, T. Putative Nuclear Localization Signals (NLS) in Protein Transcription Factors. J. Cell. Biochem. 1994, 55, 32–58. [Google Scholar] [CrossRef]
- Gu, Y.; Hinnerwisch, J.; Fredricks, R.; Kalepu, S.; Mishra, R.S.; Singh, N. Identification of Cryptic Nuclear Localization Signals in the Prion Protein. Neurobiol. Dis. 2003, 12, 133–149. [Google Scholar] [CrossRef]
- Solomon, I.H.; Khatri, N.; Biasini, E.; Massignan, T.; Huettner, J.E.; Harris, D.A. An N-Terminal Polybasic Domain and Cell Surface Localization Are Required for Mutant Prion Protein Toxicity. J. Biol. Chem. 2011, 286, 14724–14736. [Google Scholar] [CrossRef] [PubMed]
- Turnbaugh, J.A.; Unterberger, U.; Saá, P.; Massignan, T.; Fluharty, B.R.; Bowman, F.P.; Miller, M.B.; Supattapone, S.; Biasini, E.; Harris, D.A. The N-Terminal, Polybasic Region of PrPC Dictates the Efficiency of Prion Propagation by Binding to PrPSc. J. Neurosci. 2012, 32, 8817–8830. [Google Scholar] [CrossRef] [PubMed]
- Magzoub, M.; Sandgren, S.; Lundberg, P.; Oglęcka, K.; Lilja, J.; Wittrup, A.; Göran Eriksson, L.E.; Langel, Ü.; Belting, M.; Gräslund, A. N-Terminal Peptides from Unprocessed Prion Proteins Enter Cells by Macropinocytosis. Biochem. Biophys. Res. Commun. 2006, 348, 379–385. [Google Scholar] [CrossRef]
- Magzoub, M.; Oglęcka, K.; Pramanik, A.; Göran Eriksson, L.E.; Gräslund, A. Membrane Perturbation Effects of Peptides Derived from the N-Termini of Unprocessed Prion Proteins. Biochim. Biophys. Acta (BBA) Biomembr. 2005, 1716, 126–136. [Google Scholar] [CrossRef]
- Magzoub, M.; Pramanik, A.; Gräslund, A. Modeling the Endosomal Escape of Cell-Penetrating Peptides: Transmembrane pH Gradient Driven Translocation across Phospholipid Bilayers. Biochemistry 2005, 44, 14890–14897. [Google Scholar] [CrossRef]
- Mukundan, V.; Maksoudian, C.; Vogel, M.C.; Chehade, I.; Katsiotis, M.S.; Alhassan, S.M.; Magzoub, M. Cytotoxicity of Prion Protein-Derived Cell-Penetrating Peptides Is Modulated by pH but Independent of Amyloid Formation. Arch. Biochem. Biophys. 2017, 613, 31–42. [Google Scholar] [CrossRef]
- Söderberg, K.L.; Guterstam, P.; Langel, Ü.; Gräslund, A. Targeting Prion Propagation Using Peptide Constructs with Signal Sequence Motifs. Arch. Biochem. Biophys. 2014, 564, 254–261. [Google Scholar] [CrossRef] [PubMed]
- Henning-Knechtel, A.; Kumar, S.; Wallin, C.; Król, S.; Wärmländer, S.K.T.S.; Jarvet, J.; Esposito, G.; Kirmizialtin, S.; Gräslund, A.; Hamilton, A.D.; et al. Designed Cell-Penetrating Peptide Inhibitors of Amyloid-Beta Aggregation and Cytotoxicity. Cell Rep. Phys. Sci. 2020, 1, 100014. [Google Scholar] [CrossRef]
- Olubiyi, O.O.; Frenzel, D.; Bartnik, D.; Gluck, J.M.; Brener, O.; Nagel-Steger, L.; Funke, S.A.; Willbold, D.; Strodel, B. Amyloid Aggregation Inhibitory Mechanism of Arginine-Rich D-Peptides. Curr. Med. Chem. 2014, 21, 1448–1457. [Google Scholar] [CrossRef]
- Taylor, M.; Moore, S.; Mayes, J.; Parkin, E.; Beeg, M.; Canovi, M.; Gobbi, M.; Mann, D.M.A.; Allsop, D. Development of a Proteolytically Stable Retro-Inverso Peptide Inhibitor of β-Amyloid Oligomerization as a Potential Novel Treatment for Alzheimer’s Disease. Biochemistry 2010, 49, 3261–3272. [Google Scholar] [CrossRef]
- Parthsarathy, V.; McClean, P.L.; Hölscher, C.; Taylor, M.; Tinker, C.; Jones, G.; Kolosov, O.; Salvati, E.; Gregori, M.; Masserini, M.; et al. A Novel Retro-Inverso Peptide Inhibitor Reduces Amyloid Deposition, Oxidation and Inflammation and Stimulates Neurogenesis in the APPswe/PS1ΔE9 Mouse Model of Alzheimer’s Disease. PLoS ONE 2013, 8, e54769. [Google Scholar] [CrossRef]
- Di Fede, G.; Catania, M.; Maderna, E.; Morbin, M.; Moda, F.; Colombo, L.; Rossi, A.; Cagnotto, A.; Virgilio, T.; Palamara, L.; et al. Tackling Amyloidogenesis in Alzheimer’s Disease with A2V Variants of Amyloid-β. Sci. Rep. 2016, 6, 20949. [Google Scholar] [CrossRef] [PubMed]
- Aggidis, A.; Chatterjee, S.; Townsend, D.; Fullwood, N.J.; Ortega, E.R.; Tarutani, A.; Hasegawa, M.; Lucas, H.; Mudher, A.; Allsop, D. Peptide-Based Inhibitors of Tau Aggregation as a Potential Therapeutic for Alzheimer’s Disease and Other Tauopathies. bioRxiv 2021. [Google Scholar] [CrossRef]
- Malhis, M.; Kaniyappan, S.; Aillaud, I.; Chandupatla, R.R.; Ramirez, L.M.; Zweckstetter, M.; Horn, A.H.C.; Mandelkow, E.; Sticht, H.; Funke, S.A. Potent Tau Aggregation Inhibitor D-Peptides Selected against Tau-Repeat 2 Using Mirror Image Phage Display. ChemBioChem 2021, 22, 3049–3059. [Google Scholar] [CrossRef] [PubMed]
- Imamura, T.; Fujita, K.; Tagawa, K.; Ikura, T.; Chen, X.; Homma, H.; Tamura, T.; Mao, Y.; Taniguchi, J.B.; Motoki, K.; et al. Identification of Hepta-Histidine as a Candidate Drug for Huntington’s Disease by in Silico-in Vitro- in Vivo-Integrated Screens of Chemical Libraries. Sci. Rep. 2016, 6, 33861. [Google Scholar] [CrossRef]
- Kondo, K.; Ikura, T.; Tanaka, H.; Fujita, K.; Takayama, S.; Yoshioka, Y.; Tagawa, K.; Homma, H.; Liu, S.; Kawasaki, R.; et al. Hepta-Histidine Inhibits Tau Aggregation. ACS Chem. Neurosci. 2021, 12, 3015–3027. [Google Scholar] [CrossRef] [PubMed]
- Shaltiel-Karyo, R.; Frenkel-Pinter, M.; Egoz-Matia, N.; Frydman-Marom, A.; Shalev, D.E.; Segal, D.; Gazit, E. Inhibiting α-Synuclein Oligomerization by Stable Cell-Penetrating β-Synuclein Fragments Recovers Phenotype of Parkinson’s Disease Model Flies. PLoS ONE 2010, 5, e13863. [Google Scholar] [CrossRef]
- Richman, M.; Wilk, S.; Chemerovski, M.; Wärmländer, S.K.T.S.; Wahlström, A.; Gräslund, A.; Rahimipour, S. In Vitro and Mechanistic Studies of an Antiamyloidogenic Self-Assembled Cyclic d,l-α-Peptide Architecture. J. Am. Chem. Soc. 2013, 135, 3474–3484. [Google Scholar] [CrossRef]
- Chemerovski-Glikman, M.; Rozentur-Shkop, E.; Richman, M.; Grupi, A.; Getler, A.; Cohen, H.Y.; Shaked, H.; Wallin, C.; Wärmländer, S.K.T.S.; Haas, E.; et al. Self-Assembled Cyclic d,l-α-Peptides as Generic Conformational Inhibitors of the α-Synuclein Aggregation and Toxicity: In Vitro and Mechanistic Studies. Chem. A Eur. J. 2016, 22, 14236–14246. [Google Scholar] [CrossRef]
- Liang, Z.; Chan, H.Y.E.; Lee, M.M.; Chan, M.K. A SUMO1-Derived Peptide Targeting SUMO-Interacting Motif Inhibits α-Synuclein Aggregation. Cell Chem. Biol. 2021, 28, 180–190.e6. [Google Scholar] [CrossRef]
- Chen, Z.; Chen, J.; Keshamouni, V.G.; Kanapathipillai, M. Polyarginine and Its Analogues Inhibit P53 Mutant Aggregation and Cancer Cell Proliferation In Vitro. Biochem. Biophys. Res. Commun. 2017, 489, 130–134. [Google Scholar] [CrossRef] [PubMed]
- Soragni, A.; Janzen, D.M.; Johnson, L.M.; Lindgren, A.G.; Nguyen, A.T.-Q.; Tiourin, E.; Soriaga, A.B.; Lu, J.; Jiang, L.; Faull, K.F.; et al. A Designed Inhibitor of P53 Aggregation Rescues P53 Tumor Suppression in Ovarian Carcinomas. Cancer Cell 2016, 29, 90–103. [Google Scholar] [CrossRef] [PubMed]
- Oglęcka, K.; Lundberg, P.; Magzoub, M.; Göran Eriksson, L.E.; Langel, Ü.; Gräslund, A. Relevance of the N-Terminal NLS-like Sequence of the Prion Protein for Membrane Perturbation Effects. Biochim. Biophys. Acta (BBA) Biomembr. 2008, 1778, 206–213. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Chen, S.; Yadav, S.P.; Surewicz, W.K. Interaction between Human Prion Protein and Amyloid-β (Aβ) Oligomers. J. Biol. Chem. 2010, 285, 26377–26383. [Google Scholar] [CrossRef]
- Yam, A.Y.; Wang, X.; Gao, C.M.; Connolly, M.D.; Zuckermann, R.N.; Bleu, T.; Hall, J.; Fedynyshyn, J.P.; Allauzen, S.; Peretz, D.; et al. A Universal Method for Detection of Amyloidogenic Misfolded Proteins. Biochemistry 2011, 50, 4322–4329. [Google Scholar] [CrossRef]
- Younan, N.D.; Sarell, C.J.; Davies, P.; Brown, D.R.; Viles, J.H. The Cellular Prion Protein Traps Alzheimer’s Aβ in an Oligomeric Form and Disassembles Amyloid Fibers. FASEB J. 2013, 27, 1847–1858. [Google Scholar] [CrossRef]
- Magzoub, M. Combating Proteins with Proteins: Engineering Cell-Penetrating Peptide Antagonists of Amyloid-β Aggregation and Associated Neurotoxicity. DNA Cell Biol. 2020, 39, 920–925. [Google Scholar] [CrossRef]
- Tjernberg, L.O.; Näslund, J.; Lindqvist, F.; Johansson, J.; Karlström, A.R.; Thyberg, J.; Terenius, L.; Nordstedt, C. Arrest of -Amyloid Fibril Formation by a Pentapeptide Ligand. J. Biol. Chem. 1996, 271, 8545–8548. [Google Scholar] [CrossRef]
- Soto, C.; Sigurdsson, E.M.; Morelli, L.; Asok Kumar, R.; Castaño, E.M.; Frangione, B. β-Sheet Breaker Peptides Inhibit Fibrillogenesis in a Rat Brain Model of Amyloidosis: Implications for Alzheimer’s Therapy. Nat. Med. 1998, 4, 822–826. [Google Scholar] [CrossRef]
- Lowe, T.L.; Strzelec, A.; Kiessling, L.L.; Murphy, R.M. Structure−Function Relationships for Inhibitors of β-Amyloid Toxicity Containing the Recognition Sequence KLVFF. Biochemistry 2001, 40, 7882–7889. [Google Scholar] [CrossRef]
- Leithold, L.H.E.; Jiang, N.; Post, J.; Ziehm, T.; Schartmann, E.; Kutzsche, J.; Shah, N.J.; Breitkreutz, J.; Langen, K.-J.; Willuweit, A.; et al. Pharmacokinetic Properties of a Novel D-Peptide Developed to Be Therapeutically Active Against Toxic β-Amyloid Oligomers. Pharm. Res. 2016, 33, 328–336. [Google Scholar] [CrossRef] [PubMed]
- Van Regenmortel, M.H.; Muller, S. D-Peptides as Immunogens and Diagnostic Reagents. Curr. Opin. Biotechnol. 1998, 9, 377–382. [Google Scholar] [CrossRef] [PubMed]
- Dintzis, H.M.; Symer, D.E.; Dintzis, R.Z.; Zawadzke, L.E.; Berg, J.M. A Comparison of the Immunogenicity of a Pair of Enantiomeric Proteins. Proteins Struct. Funct. Bioinform. 1993, 16, 306–308. [Google Scholar] [CrossRef] [PubMed]
- van Groen, T.; Schemmert, S.; Brener, O.; Gremer, L.; Ziehm, T.; Tusche, M.; Nagel-Steger, L.; Kadish, I.; Schartmann, E.; Elfgen, A.; et al. The Aβ Oligomer Eliminating D-Enantiomeric Peptide RD2 Improves Cognition without Changing Plaque Pathology. Sci. Rep. 2017, 7, 16275. [Google Scholar] [CrossRef]
- Zhang, T.; Gering, I.; Kutzsche, J.; Nagel-Steger, L.; Willbold, D. Toward the Mode of Action of the Clinical Stage All-d-Enantiomeric Peptide RD2 on Aβ42 Aggregation. ACS Chem. Neurosci. 2019, 10, 4800–4809. [Google Scholar] [CrossRef]
- Willbold, D.; Kutzsche, J.; Willuweit, A.; Windisch, M.; Jürgens, D. Clinical Phase I Data of the First Orally Available Anti-Aβ-Prionic Drug PRI-002 That Reverses Behavioral and Cognitive Deficits, and Decelerates Neurodegeneration in AD Animal Models. Alzheimer’s Dement. 2020, 16, e038821. [Google Scholar] [CrossRef]
- Chorev, M.; Goodman, M. Recent Developments in Retro Peptides and Proteins—An Ongoing Topochemical Exploration. Trends Biotechnol. 1995, 13, 438–445. [Google Scholar] [CrossRef]
- Di Fede, G.; Catania, M.; Morbin, M.; Rossi, G.; Suardi, S.; Mazzoleni, G.; Merlin, M.; Giovagnoli, A.R.; Prioni, S.; Erbetta, A.; et al. A Recessive Mutation in the APP Gene with Dominant-Negative Effect on Amyloidogenesis. Science 2009, 323, 1473–1477. [Google Scholar] [CrossRef]
- Cimini, S.; Sclip, A.; Mancini, S.; Colombo, L.; Messa, M.; Cagnotto, A.; Di Fede, G.; Tagliavini, F.; Salmona, M.; Borsello, T. The Cell-Permeable Aβ1-6A2VTAT(D) Peptide Reverts Synaptopathy Induced by Aβ1-42wt. Neurobiol. Dis. 2016, 89, 101–111. [Google Scholar] [CrossRef]
- Nelson, P.T.; Alafuzoff, I.; Bigio, E.H.; Bouras, C.; Braak, H.; Cairns, N.J.; Castellani, R.J.; Crain, B.J.; Davies, P.; Tredici, K.D.; et al. Correlation of Alzheimer Disease Neuropathologic Changes With Cognitive Status: A Review of the Literature. J. Neuropathol. Exp. Neurol. 2012, 71, 362–381. [Google Scholar] [CrossRef]
- Song, L.; Wells, E.A.; Robinson, A.S. Critical Molecular and Cellular Contributors to Tau Pathology. Biomedicines 2021, 9, 190. [Google Scholar] [CrossRef] [PubMed]
- Chen, X.-Q.; Mobley, W.C. Alzheimer Disease Pathogenesis: Insights From Molecular and Cellular Biology Studies of Oligomeric Aβ and Tau Species. Front. Neurosci. 2019, 13, 659. [Google Scholar] [CrossRef] [PubMed]
- Congdon, E.E.; Sigurdsson, E.M. Tau-Targeting Therapies for Alzheimer Disease. Nat. Rev. Neurol. 2018, 14, 399–415. [Google Scholar] [CrossRef] [PubMed]
- Chang, C.-W.; Shao, E.; Mucke, L. Tau: Enabler of Diverse Brain Disorders and Target of Rapidly Evolving Therapeutic Strategies. Science 2021, 371, eabb8255. [Google Scholar] [CrossRef]
- Brunden, K.R.; Trojanowski, J.Q.; Lee, V.M.-Y. Advances in Tau-Focused Drug Discovery for Alzheimer’s Disease and Related Tauopathies. Nat. Rev. Drug Discov. 2009, 8, 783–793. [Google Scholar] [CrossRef]
- von Bergen, M.; Friedhoff, P.; Biernat, J.; Heberle, J.; Mandelkow, E.M.; Mandelkow, E. Assembly of Tau Protein into Alzheimer Paired Helical Filaments Depends on a Local Sequence Motif ((306)VQIVYK(311)) Forming Beta Structure. Proc. Natl. Acad. Sci. USA 2000, 97, 5129–5134. [Google Scholar] [CrossRef]
- Reich, N.; Parkin, E.; Dawson, N. Liposome Nanoparticle Conjugation and Cell Penetrating Peptide Sequences (CPPs) Enhance the Cellular Delivery of the Tau Aggregation Inhibitor RI-AG03. J. Cell. Mol. Med. 2024, 28, e18477. [Google Scholar] [CrossRef]
- Seidler, P.M.; Boyer, D.R.; Rodriguez, J.A.; Sawaya, M.R.; Cascio, D.; Murray, K.; Gonen, T.; Eisenberg, D.S. Structure-Based Inhibitors of Tau Aggregation. Nat. Chem. 2018, 10, 170–176. [Google Scholar] [CrossRef]
- von Bergen, M.; Barghorn, S.; Li, L.; Marx, A.; Biernat, J.; Mandelkow, E.-M.; Mandelkow, E. Mutations of Tau Protein in Frontotemporal Dementia Promote Aggregation of Paired Helical Filaments by Enhancing Local β-Structure. J. Biol. Chem. 2001, 276, 48165–48174. [Google Scholar] [CrossRef]
- Poewe, W.; Seppi, K.; Tanner, C.M.; Halliday, G.M.; Brundin, P.; Volkmann, J.; Schrag, A.-E.; Lang, A.E. Parkinson Disease. Nat. Rev. Dis. Primers 2017, 3, 17013. [Google Scholar] [CrossRef]
- Tanner, C.M.; Ostrem, J.L. Parkinson’s Disease. N. Engl. J. Med. 2024, 391, 442–452. [Google Scholar] [CrossRef] [PubMed]
- Recchia, A.; Debetto, P.; Negro, A.; Guidolin, D.; Skaper, S.D.; Giusti, P. α-Synuclein and Parkinson’s Disease. FASEB J. 2004, 18, 617–626. [Google Scholar] [CrossRef] [PubMed]
- Calabresi, P.; Mechelli, A.; Natale, G.; Volpicelli-Daley, L.; Di Lazzaro, G.; Ghiglieri, V. Alpha-Synuclein in Parkinson’s Disease and Other Synucleinopathies: From Overt Neurodegeneration Back to Early Synaptic Dysfunction. Cell Death Dis. 2023, 14, 176. [Google Scholar] [CrossRef] [PubMed]
- Oliveira, L.M.A.; Gasser, T.; Edwards, R.; Zweckstetter, M.; Melki, R.; Stefanis, L.; Lashuel, H.A.; Sulzer, D.; Vekrellis, K.; Halliday, G.M.; et al. Alpha-Synuclein Research: Defining Strategic Moves in the Battle against Parkinson’s Disease. npj Park. Dis. 2021, 7, 65. [Google Scholar] [CrossRef]
- Barba, L.; Paolini Paoletti, F.; Bellomo, G.; Gaetani, L.; Halbgebauer, S.; Oeckl, P.; Otto, M.; Parnetti, L. Alpha and Beta Synucleins: From Pathophysiology to Clinical Application as Biomarkers. Mov. Disord. 2022, 37, 669–683. [Google Scholar] [CrossRef]
- Park, J.-Y.; Lansbury, P.T. β-Synuclein Inhibits Formation of α-Synuclein Protofibrils: A Possible Therapeutic Strategy against Parkinson’s Disease. Biochemistry 2003, 42, 3696–3700. [Google Scholar] [CrossRef]
- Uversky, V.N.; Li, J.; Souillac, P.; Millett, I.S.; Doniach, S.; Jakes, R.; Goedert, M.; Fink, A.L. Biophysical Properties of the Synucleins and Their Propensities to Fibrillate: Inhibition of α-Synuclein Assembly BY β- and γ-Synucleins. J. Biol. Chem. 2002, 277, 11970–11978. [Google Scholar] [CrossRef]
- Brown, J.W.P.; Buell, A.K.; Michaels, T.C.T.; Meisl, G.; Carozza, J.; Flagmeier, P.; Vendruscolo, M.; Knowles, T.P.J.; Dobson, C.M.; Galvagnion, C. β-Synuclein Suppresses Both the Initiation and Amplification Steps of α-Synuclein Aggregation via Competitive Binding to Surfaces. Sci. Rep. 2016, 6, 36010. [Google Scholar] [CrossRef] [PubMed]
- Ghadiri, M.R.; Granja, J.R.; Milligan, R.A.; McRee, D.E.; Khazanovich, N. Self-Assembling Organic Nanotubes Based on a Cyclic Peptide Architecture. Nature 1993, 366, 324–327. [Google Scholar] [CrossRef]
- Abeywardana, T.; Pratt, M.R. Extent of Inhibition of α-Synuclein Aggregation in Vitro by SUMOylation Is Conjugation Site- and SUMO Isoform-Selective. Biochemistry 2015, 54, 959–961. [Google Scholar] [CrossRef]
- Krumova, P.; Meulmeester, E.; Garrido, M.; Tirard, M.; Hsiao, H.-H.; Bossis, G.; Urlaub, H.; Zweckstetter, M.; Kügler, S.; Melchior, F.; et al. Sumoylation Inhibits α-Synuclein Aggregation and Toxicity. J. Cell Biol. 2011, 194, 49–60. [Google Scholar] [CrossRef] [PubMed]
- Doherty, C.P.A.; Ulamec, S.M.; Maya-Martinez, R.; Good, S.C.; Makepeace, J.; Khan, G.N.; van Oosten-Hawle, P.; Radford, S.E.; Brockwell, D.J. A Short Motif in the N-Terminal Region of α-Synuclein Is Critical for both Aggregation and Function. Nat. Struct Mol. Biol. 2020, 27, 249–259. [Google Scholar] [CrossRef]
- Bom, A.P.D.A.; Rangel, L.P.; Costa, D.C.F.; de Oliveira, G.A.P.; Sanches, D.; Braga, C.A.; Gava, L.M.; Ramos, C.H.I.; Cepeda, A.O.T.; Stumbo, A.C.; et al. Mutant P53 Aggregates into Prion-like Amyloid Oligomers and Fibrils: Implications for Cancer. J. Biol. Chem. 2012, 287, 28152–28162. [Google Scholar] [CrossRef]
- Silva, J.L.; Gallo, C.V.D.M.; Costa, D.C.F.; Rangel, L.P. Prion-like Aggregation of Mutant P53 in Cancer. Trends Biochem. Sci. 2014, 39, 260–267. [Google Scholar] [CrossRef]
- Silva, J.L.; Cino, E.A.; Soares, I.N.; Ferreira, V.F.; de Oliveira, G.A.P. Targeting the Prion-like Aggregation of Mutant P53 to Combat Cancer. Acc. Chem. Res. 2018, 51, 181–190. [Google Scholar] [CrossRef] [PubMed]
- Hafner, A.; Bulyk, M.L.; Jambhekar, A.; Lahav, G. The Multiple Mechanisms That Regulate P53 Activity and Cell Fate. Nat. Rev. Mol. Cell Biol. 2019, 20, 199–210. [Google Scholar] [CrossRef]
- Bieging, K.T.; Mello, S.S.; Attardi, L.D. Unravelling Mechanisms of P53-Mediated Tumour Suppression. Nat. Rev. Cancer 2014, 14, 359–370. [Google Scholar] [CrossRef] [PubMed]
- Khoo, K.H.; Verma, C.S.; Lane, D.P. Drugging the P53 Pathway: Understanding the Route to Clinical Efficacy. Nat. Rev. Drug Discov. 2014, 13, 217–236. [Google Scholar] [CrossRef]
- Bykov, V.J.N.; Eriksson, S.E.; Bianchi, J.; Wiman, K.G. Targeting Mutant P53 for Efficient Cancer Therapy. Nat. Rev. Cancer 2018, 18, 89–102. [Google Scholar] [CrossRef]
- Joerger, A.C.; Fersht, A.R. The Tumor Suppressor P53: From Structures to Drug Discovery. Cold Spring Harb. Perspect. Biol. 2010, 2, a000919. [Google Scholar] [CrossRef]
- Joerger, A.C.; Fersht, A.R. The P53 Pathway: Origins, Inactivation in Cancer, and Emerging Therapeutic Approaches. Annu. Rev. Biochem. 2016, 85, 375–404. [Google Scholar] [CrossRef] [PubMed]
- Xu, J.; Reumers, J.; Couceiro, J.R.; De Smet, F.; Gallardo, R.; Rudyak, S.; Cornelis, A.; Rozenski, J.; Zwolinska, A.; Marine, J.-C.; et al. Gain of Function of Mutant P53 by Coaggregation with Multiple Tumor Suppressors. Nat. Chem. Biol. 2011, 7, 285–295. [Google Scholar] [CrossRef] [PubMed]
- Bouaoun, L.; Sonkin, D.; Ardin, M.; Hollstein, M.; Byrnes, G.; Zavadil, J.; Olivier, M. TP53 Variations in Human Cancers: New Lessons from the IARC TP53 Database and Genomics Data. Hum. Mutat. 2016, 37, 865–876. [Google Scholar] [CrossRef] [PubMed]
- Wang, G.; Fersht, A.R. First-Order Rate-Determining Aggregation Mechanism of P53 and Its Implications. Proc. Natl. Acad. Sci. USA 2012, 109, 13590–13595. [Google Scholar] [CrossRef] [PubMed]
- Magzoub, M.; Miranker, A.D. P53 Succumbs to Peer Pressure. Nat. Chem. Biol. 2011, 7, 248–249. [Google Scholar] [CrossRef]
- Zilfou, J.T.; Lowe, S.W. Tumor Suppressive Functions of P53. Cold Spring Harb. Perspect. Biol. 2009, 1, a001883. [Google Scholar] [CrossRef]
- Hishiya, A.; Takayama, S. Molecular Chaperones as Regulators of Cell Death. Oncogene 2008, 27, 6489–6506. [Google Scholar] [CrossRef]
- Grcic, L.; Leech, G.; Kwan, K.; Storr, T. Targeting Misfolding and Aggregation of the Amyloid-β Peptide and Mutant P53 Protein Using Multifunctional Molecules. Chem. Commun. 2024, 60, 1372–1388. [Google Scholar] [CrossRef]
- Ferretti, G.D.S.; Quarti, J.; dos Santos, G.; Rangel, L.P.; Silva, J.L. Anticancer Therapeutic Strategies Targeting P53 Aggregation. Int. J. Mol. Sci. 2022, 23, 11023. [Google Scholar] [CrossRef]
- Ferraz da Costa, D.C.; Campos, N.P.C.; Santos, R.A.; Guedes-da-Silva, F.H.; Martins-Dinis, M.M.D.C.; Zanphorlin, L.; Ramos, C.; Rangel, L.P.; Silva, J.L. Resveratrol Prevents P53 Aggregation in Vitro and in Breast Cancer Cells. Oncotarget 2018, 9, 29112–29122. [Google Scholar] [CrossRef]
- Rangel, L.P.; Ferretti, G.D.S.; Costa, C.L.; Andrade, S.M.M.V.; Carvalho, R.S.; Costa, D.C.F.; Silva, J.L. P53 Reactivation with Induction of Massive Apoptosis-1 (PRIMA-1) Inhibits Amyloid Aggregation of Mutant P53 in Cancer Cells. J. Biol. Chem. 2019, 294, 3670–3682. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.; Wu, J.-L.; Liang, Y.; Tang, Y.-G.; Song, H.-X.; Wu, L.-L.; Xing, Y.-F.; Yan, N.; Li, Y.-T.; Wang, Z.-Y.; et al. Arsenic Trioxide Rescues Structural P53 Mutations through a Cryptic Allosteric Site. Cancer Cell 2021, 39, 225–239.e8. [Google Scholar] [CrossRef]
- Miller, J.J.; Blanchet, A.; Orvain, C.; Nouchikian, L.; Reviriot, Y.; Clarke, R.M.; Martelino, D.; Wilson, D.; Gaiddon, C.; Storr, T. Bifunctional Ligand Design for Modulating Mutant P53 Aggregation in Cancer. Chem. Sci. 2019, 10, 10802–10814. [Google Scholar] [CrossRef] [PubMed]
- Chen, Z.; Kanapathipillai, M. Inhibition of P53 Mutant Peptide Aggregation In Vitro by Cationic Osmolyte Acetylcholine Chloride. Protein Pept. Lett. 2017, 24, 353–357. [Google Scholar]
- Maity, D.; Kumar, S.; AlHussein, R.; Gremer, L.; Howarth, M.; Karpauskaite, L.; Hoyer, W.; Magzoub, M.; Hamilton, A.D. Sub-Stoichiometric Inhibition of IAPP Aggregation: A Peptidomimetic Approach to Anti-Amyloid Agents. RSC Chem. Biol. 2020, 1, 225–232. [Google Scholar] [CrossRef]
- Kulikov, O.V.; Kumar, S.; Magzoub, M.; Knipe, P.C.; Saraogi, I.; Thompson, S.; Miranker, A.D.; Hamilton, A.D. Amphiphilic Oligoamide α-Helix Peptidomimetics Inhibit Islet Amyloid Polypeptide Aggregation. Tetrahedron Lett. 2015, 56, 3670–3673. [Google Scholar] [CrossRef]
- Palanikumar, L.; Karpauskaite, L.; Al-Sayegh, M.; Chehade, I.; Alam, M.; Hassan, S.; Maity, D.; Ali, L.; Kalmouni, M.; Hunashal, Y.; et al. Protein Mimetic Amyloid Inhibitor Potently Abrogates Cancer-Associated Mutant P53 Aggregation and Restores Tumor Suppressor Function. Nat. Commun. 2021, 12, 3962. [Google Scholar] [CrossRef]
- Reumers, J.; Maurer-Stroh, S.; Schymkowitz, J.; Rousseau, F. Protein sequences encode safeguards against aggregation. Hum. Mutat. 2009, 30, 431–437. [Google Scholar] [CrossRef]
- Pawar, A.P.; DuBay, K.F.; Zurdo, J.; Chiti, F.; Vendruscolo, M.; Dobson, C.M. Prediction of “Aggregation-Prone” and “Aggregation-Susceptible” Regions in Proteins Associated with Neurodegenerative Diseases. J. Mol. Biol. 2005, 350, 379–392. [Google Scholar] [CrossRef]
- Baugh, E.H.; Ke, H.; Levine, A.J.; Bonneau, R.A.; Chan, C.S. Why Are There Hotspot Mutations in the TP53 Gene in Human Cancers? Cell Death Differ 2018, 25, 154–160. [Google Scholar] [CrossRef]
- Hidalgo, M. Pancreatic Cancer. N. Engl. J. Med. 2010, 362, 1605–1617. [Google Scholar] [CrossRef] [PubMed]
- Bray, F.; Ferlay, J.; Soerjomataram, I.; Siegel, R.L.; Torre, L.A.; Jemal, A. Global Cancer Statistics 2018: GLOBOCAN Estimates of Incidence and Mortality Worldwide for 36 Cancers in 185 Countries. CA A Cancer J. Clin. 2018, 68, 394–424. [Google Scholar] [CrossRef] [PubMed]
- Mamsa, S.S.A.; Meloni, B.P. Arginine and Arginine-Rich Peptides as Modulators of Protein Aggregation and Cytotoxicity Associated With Alzheimer’s Disease. Front. Mol. Neurosci. 2021, 14, 759729. [Google Scholar] [CrossRef]
- Zhang, Y.; Xu, L.; Chang, Y.; Li, Y.; Butler, W.; Jin, E.; Wang, A.; Tao, Y.; Chen, X.; Liang, C.; et al. Therapeutic Potential of ReACp53 Targeting Mutant P53 Protein in CRPC. Prostate Cancer Prostatic. Dis. 2020, 23, 160–171. [Google Scholar] [CrossRef]
- Neal, A.; Lai, T.; Singh, T.; Rahseparian, N.; Grogan, T.; Elashoff, D.; Scott, P.; Pellegrini, M.; Memarzadeh, S. Combining ReACp53 with Carboplatin to Target High-Grade Serous Ovarian Cancers. Cancers 2021, 13, 5908. [Google Scholar] [CrossRef] [PubMed]
- Van Schependom, J.; D’haeseleer, M. Advances in Neurodegenerative Diseases. J. Clin. Med. 2023, 12, 1709. [Google Scholar] [CrossRef]
- Kastenhuber, E.R.; Lowe, S.W. Putting P53 in Context. Cell 2017, 170, 1062–1078. [Google Scholar] [CrossRef]
- Fosgerau, K.; Hoffmann, T. Peptide Therapeutics: Current Status and Future Directions. Drug Discov. Today 2015, 20, 122–128. [Google Scholar] [CrossRef]
- Tsomaia, N. Peptide Therapeutics: Targeting the Undruggable Space. Eur. J. Med. Chem. 2015, 94, 459–470. [Google Scholar] [CrossRef]
- Edwards, A.B.; Mastaglia, F.L.; Knuckey, N.W.; Meloni, B.P. Neuroprotective Cationic Arginine-Rich Peptides (CARPs): An Assessment of Their Clinical Safety. Drug Saf. 2020, 43, 957–969. [Google Scholar] [CrossRef]
- Veloria, J.R.; Chen, L.; Li, L.; Breen, G.A.M.; Lee, J.; Goux, W.J. Novel Cell-Penetrating-Amyloid Peptide Conjugates Preferentially Kill Cancer Cells. MedChemComm 2017, 9, 121. [Google Scholar] [CrossRef] [PubMed]
- Galzitskaya, O.V.; Kurpe, S.R.; Panfilov, A.V.; Glyakina, A.V.; Grishin, S.Y.; Kochetov, A.P.; Deryusheva, E.I.; Machulin, A.V.; Kravchenko, S.V.; Domnin, P.A.; et al. Amyloidogenic Peptides: New Class of Antimicrobial Peptides with the Novel Mechanism of Activity. Int. J. Mol. Sci. 2022, 23, 5463. [Google Scholar] [CrossRef] [PubMed]
- Sengupta, J.; Agrawal, R.K.; Frank, J. Visualization of Protein S1 within the 30S Ribosomal Subunit and Its Interaction with Messenger RNA. Proc. Natl. Acad. Sci. USA 2001, 98, 11991–11996. [Google Scholar] [CrossRef] [PubMed]
Peptide | Sequence | Target | Refs. |
---|---|---|---|
Mouse PrP1–28 (mPrP1–28) | MANLGYWLLALFVTMWTDVGLCKKRPKP | PrP | [138] |
Bovine PrP1–30 (bPrP1–30) | MVKSKIGSWILVLFVAMWSDVGLCKKRPKP | PrP | [138] |
NCAM11–19–PrP23–28 (NCAM1–PrP) | MLRTKDLIWTLFFLGTAVSKKRPKP-NH2 | PrP | [149] |
NCAM11–19–PrP23–28 (NCAM1–PrP) | MLRTKDLIWTLFFLGTAVSKKRPKP-NH2 | Aβ | [150] |
NCAM11–19–K–Aβ16–20 (NCAM1–Aβ) | MLRTKDLIWTLFFLGTAVSKKLVFF-NH2 | Aβ | [150] |
RD2 | ptlhthnrrrrr-NH2 | Aβ | [151] |
Retro-inverso–OR2 (RI–OR2) | Ac-rGffvlkGr-NH2 | Aβ | [152] |
Retro-inverso–OR2–TAT (RI–OR2–TAT) | Ac-rGffvlkGrrrrqrrkkrGy-NH2 | Aβ | [153] |
Aβ1–6A2VTAT(D) | dvefrhgggggrkkrrqrrr | Aβ | [154] |
Retro-inverso–AG03 (RI–AG03) | Ac-rrrrrrrrGpkyk(ac)iqvGr-NH2 | Tau | [155] |
MMD3 | dplkarhtsvwy | Tau | [156] |
MMD3rev | ywvsthraklpd | Tau | [156] |
7H | HHHHHHH | mHTT | [157] |
7H | HHHHHHH | Tau | [158] |
TAT–7H | YGRKKRRQRRRHHHHHHH | Tau | [158] |
β-synuclein36–45 | GVLYVGSKTR | α-syn | [159] |
Retro-inverso–β-synuclein36–45 (RI–β-syn36–45) | rtksgvylvg | α-syn | [159] |
CP-2 | IJwHsK | Aβ | [160] |
CP-2 | IJwHsK | α-syn | [161] |
SUMO1 (15–55) | DKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQ | α-syn | [162] |
Polyarginine (and its analog polyornithine) | Rn | Mutant p53 | [163] |
ReACp53 | (R9)RPILTRITLE | Mutant p53 | [164] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Kalmouni, M.; Oh, Y.; Alata, W.; Magzoub, M. Designed Cell-Penetrating Peptide Constructs for Inhibition of Pathogenic Protein Self-Assembly. Pharmaceutics 2024, 16, 1443. https://doi.org/10.3390/pharmaceutics16111443
Kalmouni M, Oh Y, Alata W, Magzoub M. Designed Cell-Penetrating Peptide Constructs for Inhibition of Pathogenic Protein Self-Assembly. Pharmaceutics. 2024; 16(11):1443. https://doi.org/10.3390/pharmaceutics16111443
Chicago/Turabian StyleKalmouni, Mona, Yujeong Oh, Wael Alata, and Mazin Magzoub. 2024. "Designed Cell-Penetrating Peptide Constructs for Inhibition of Pathogenic Protein Self-Assembly" Pharmaceutics 16, no. 11: 1443. https://doi.org/10.3390/pharmaceutics16111443
APA StyleKalmouni, M., Oh, Y., Alata, W., & Magzoub, M. (2024). Designed Cell-Penetrating Peptide Constructs for Inhibition of Pathogenic Protein Self-Assembly. Pharmaceutics, 16(11), 1443. https://doi.org/10.3390/pharmaceutics16111443