Next Article in Journal
Imaging of the Effect of Alcohol-Containing Media on the Performance of Hypromellose Hydrophilic Matrix Tablets: Comparison of Direct Compression and Regular Grades of Polymer
Next Article in Special Issue
Efficient Non-Viral Gene Modification of Mesenchymal Stromal Cells from Umbilical Cord Wharton’s Jelly with Polyethylenimine
Previous Article in Journal
Franz Cell Diffusion Testing and Quantitative Confocal Raman Spectroscopy: In Vitro-In Vivo Correlation
Previous Article in Special Issue
Development of Theranostic Cationic Liposomes Designed for Image-Guided Delivery of Nucleic Acid
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Non-Viral Targeted Nucleic Acid Delivery: Apply Sequences for Optimization

Pharmaceutical Biotechnology, Center for System-based Drug Research, Center for NanoScience (CeNS), Ludwig-Maximilians-Universität, D-81377 Munich, Germany
*
Author to whom correspondence should be addressed.
Pharmaceutics 2020, 12(9), 888; https://doi.org/10.3390/pharmaceutics12090888
Submission received: 26 July 2020 / Revised: 9 September 2020 / Accepted: 15 September 2020 / Published: 18 September 2020
(This article belongs to the Special Issue Gene Delivery Vectors and Physical Methods: Present and Future Trends)

Abstract

In nature, genomes have been optimized by the evolution of their nucleic acid sequences. The design of peptide-like carriers as synthetic sequences provides a strategy for optimizing multifunctional targeted nucleic acid delivery in an iterative process. The optimization of sequence-defined nanocarriers differs for different nucleic acid cargos as well as their specific applications. Supramolecular self-assembly enriched the development of a virus-inspired non-viral nucleic acid delivery system. Incorporation of DNA barcodes presents a complementary approach of applying sequences for nanocarrier optimization. This strategy may greatly help to identify nucleic acid carriers that can overcome pharmacological barriers and facilitate targeted delivery in vivo. Barcode sequences enable simultaneous evaluation of multiple nucleic acid nanocarriers in a single test organism for in vivo biodistribution as well as in vivo bioactivity.

1. Introduction

Nucleic acids, as plasmid DNA (pDNA), small interfering RNA (siRNA), micro RNA (miRNA), messenger RNA (mRNA), antisense oligonucleotides (ASOs) and clustered regularly interspaced short palindromic repeat (CRISPR)-associated nuclease 9 (Cas9)/single guide RNA (sgRNA) ribonucleoprotein (RNP) system have been used as therapeutic macromolecules for the treatment of severe and life-threatening diseases at the genomic level, such as for cancer or monogenetic defects [1,2,3,4,5,6,7,8,9]. Over the past few years, the number of human clinical trials for gene therapy has greatly increased [10]. More and more gene therapy-based products have been approved by the U.S. Food and Drug Administration (FDA), European Medicines Agency (EMA) and the China Medical Products Administration (NMPA, formerly China Food and Drug Administration-CFDA).
As compared with drugs of low molecular weight, therapeutic delivery of nucleic acids is far more complicated [11]. First, therapeutic nucleic acids are mostly negatively charged macromolecules, which prevents direct diffusion across the cellular lipid membranes. Second, naked nucleic acids are unstable in the bloodstream and will be rapidly degraded by nucleases and cleared by kidney after intravenously administration [12]. Appropriate delivery systems shall be used to stabilize and protect the nucleic acids to realize efficient cargo accumulation in targeted sites. Once internalized into the target cells commonly by the process of endocytosis, delivery systems shall promote escape from the endosome into the cytosol where they have to release their nucleic acid cargoes in bioactive form. Finally, nucleic acids need to reach their specific subcellular sites for therapeutic intervention. Different macromolecular cargos act at different intracellular target sites (Table 1); pDNA and Cas9/sgRNA need to function in the cell nucleus, whereas siRNA and mRNA act in the cytosol. This may require carriers with different functional domains for effective delivery. In addition, carriers are required to alter their biophysical properties in a dynamic mode (pH-, enzyme-, or redox-sensitive) during different phases of extra- and intracellular delivery [13]. Furthermore, different treatment modes (systemic, regional and local) as well as different target organs and cell types have different requirements for carriers.
Optimized by natural selection and evolution, viruses with diverse functional microdomains are the most potent and efficient carriers for nucleic acids. Various virus-based delivery systems have been developed and have been applied in more than half of the clinical gene therapy trials worldwide in the past few decades [10]. Despite their demonstrated high transfection efficiency, their immunogenicity, limited cargo-loading capacity, restricted tissue tropism and expensive production limit the application. Therefore, non-viral synthetic delivery systems have been developed as alternative [14]. Such synthetic carriers can be virus-inspired and contain different domains to mimic the efficient, dynamic virus-based infection process [15].
A series of different strategies are followed for synthetic nucleic acid delivery systems, including lipid-based, polymer-based or other nanomaterial-based formulations [12,16,17,18,19,20,21,22,23,24]. As outlined in the following section, a significant variety of sequence-defined artificial polymers was generated, with the aim to improve nucleic acid delivery and their bioactivity. Functional building blocks such as shielding domains, targeting ligands, hydrophobic domain and endosomal buffering agents can be incorporated to overcome the extra- and intracellular pharmacological barriers for better systemic application.

2. Sequence-Defined Macromolecular Carriers

Like natural viruses, non-viral biomimetic nucleic acid delivery systems shall be responsive to the changing biological environment by introducing different functional subunits. All design elements including the macromolecule size and overall charge, number, sequence and topology (linear, branched, comb, hyperbranched or dendritic structure, and attachment sites for additional functional groups) of subunits play a crucial role in the final transfer efficiency. The precise synthesis of such complex multifunctional macromolecules as defined sequences is essential, not only for pharmaceutical reasons of reproducible production, but also for identification of clear relations between the chemical structure and biological activity.
With the progress of macromolecular chemistry, precise sequence-defined artificial polymers can be generated and optimized to meet the requirement for specific delivery [25,26,27]. On the one hand, improved technologies such as reversible addition-fragmentation chain transfer (RAFT) [28] enable synthesis of multi-block copolymers with higher precision, enabling the evaluation of carriers with different numbers and sizes of bioactive domains [29,30,31]. This encouraging polymer direction is an important field on its own and goes beyond the scope of the current review. On the other hand, macromolecules can be assembled in a precise sequence by solid-phase-supported synthesis (SPS).
As a focus of the current section, sequence-defined peptide carriers and peptide-like artificial macromolecular structures can be designed benefiting from the progress of SPS. In the design process, artificial functional units for the specific delivery process based on artificial amino acids and lipids have to be identified. Then these multiple components are step-by-step assembled into macromolecules with a defined-sequence, and their nucleic acid delivery ability is evaluated. Afterwards, further improvements are made to optimize the delivery systems on the basis of the structure-activity relations. Initial pioneering work identified the required number of cationic amino acids as lysine, arginine or ornithine in precise defined macromolecular structures [32]. The incorporation of cysteines improved the polyplexes stability by disulfide cross-linking, and the incorporation of endosomal-buffering histidine [33] or membrane-destabilizing peptides [34,35] enhanced nucleic acid delivery efficiency by improving their endosomal escape capacity.

2.1. Lysine-Based Sequence-Defined Peptides

Lysine has drawn significant interest for the design of sequence-defined peptides as carriers for nucleic acids due to its cationic nature and the ability to provide multiple coupling sites for different topologies [36]. It was found that a minimum of 6-8 cationic amino acids is required to compact pDNA into polyplexes active in gene delivery [32,37]. The DNA binding and compaction ability increases with the number of cationic groups [32]. The introduction of cysteines into poly-lysine peptides increased pDNA binding through disulfide cross-linking [38], enabling the formation of stable polyplexes by shorter peptides consisting of only six cationic lysines [39]. Meanwhile, the cross-linked polyplexes exhibited significantly higher gene expression in vitro as compared to the uncross-linked polyplexes, with peptides containing two cysteines mediating maximal gene expression [38]. Incorporation of histidine for enhanced endosomal buffering further improved the in vitro gene expression in the absence of lysosomatropic chloroquine [39].
Direct comparison of linear, dendritic and hyperbranched poly(L)lysine (PLL) found that branching was beneficial for transfection, yet displayed increased cytotoxicity as well as reduced enzymatic biodegradability [40]. PLL dendrimer combined the easily biodegradation properties of linear PLL with high transfection efficiency of branched PLL. The transfection efficiency was largely related with the generations, with the sixth generation (KG6) exhibiting high level of pDNA transfection efficiency in cells without significant cytotoxicity [36]. KG6/pDNA exhibited a longer blood circulation with more pDNA distribute in tumor tissues as compared with the DOTAP/Chol system in tumor bearing mice via intravenous administration [41]. In addition, PEGylated KG6 showed better systemic retention, lower organ distribution and effective accumulation in tumor sites [42,43]. By substituting the cationic terminal groups for arginines (R) to interact with the lipid-membrane and facilitate pDNA release, KGR6 exhibited a comparable pDNA compaction ability with significantly higher transfection efficiency than that of KG6 [44].
Mixson and coworkers [45,46,47,48,49,50] developed a series of linear and branched histidine-lysine (HK) peptides containing lysine (K) as the nucleic acid binding domains and histidine (H) as endosomal buffering domains for pDNA and siRNA delivery (Table 2). The optimized parameters are the ratio (e.g., H-K, H2-K and H3-K), degree of branching (e.g., linear, 4- or 8-branches), w/o histidine-enrich tails depended on nucleic acid type and the target cell lines [45,46,47]. Initial studies found that HK peptides with less than four branches were ineffective for nucleic acid delivery, unless used in combination with cationic carriers as liposomes [45,51]. The transfection efficiency was determined by the target cell types: a branched HK peptide was more effective than a linear HK peptide in transformed malignant cells [52], where the degree of branching was positively related with transfection efficiency; a linear HK peptide was superior to a branched HK peptide in primary cells [45], where the degree of branching was inversely related with transfection efficiency. The difference of the optimal HK peptides for different cells types was found to be closely correlated with the pH of endocytic vesicles, which was above 6.0 in transformed malignant cells and highly acidic with a pH of below 5.0 in primary cells [45]. By altering the percentage of cationizable histidines, the endosomal pH of a cell may determine the amount of nucleic acid released from the HK peptides. Addition of a histidine-enriched tail to a 4-branched H2K4b peptides with a repeating amino-acid sequence of -HHK- significantly increased the pDNA transfection efficiency [46]. While the effective 4-branched H2K4b peptides were ineffective for siRNA mediated gene silencing, 4-branched H3K4b peptides with the histidine-enriched repeat pattern of -HHHK- on the terminals exhibited more effectively augmented uptake of siRNA than H2K4b peptides [47]. Eight-branched H3K8b peptides with histidine-enriched domains (H8) and 8-terminal branches with the repeating -HHHK- sequence were found to be more effective as carriers of siRNA in comparison with H3K4b [47]. Application of HK peptides via intratumoral administration of Raf-1 siRNA to MDA-MB-435 tumor-bearing mice showed that siRNA nanoplexes formed by highly branched H3K8b were not particularly effective, yet the less branched H2K4b and H3K4b peptide were found to be the most effective carriers [48]. Meanwhile, 4-branched H3K(+H)4b peptide with an additional histidine for a better endosomal escape not only exhibited comparable gene silencing effect as compared with H3K8b for in vitro Raf-1 siRNA transfection, but also good antitumoral activity comparable with H3K4b for intravenous administration of Raf-1 siRNA nanoplexes to MDA-MB-435 tumor-bearing mice [53]. Further incorporating of H3K(+H)4b with cRGD as the target ligand via a polyethylene glycol (PEG) spacer triggered significantly greater gene silencing levels in targeted tumor tissues of MDA-MB-435 tumor-bearing mice via systemic administration [54]. Furthermore, the group found that in vitro screening often failed to identify the most effective candidates for in vivo. As compared with the proven effective pDNA delivery system formed by H2K4b, the ineffective linear H2K peptide was found to be far more effective in pDNA transfection to tumor xenografts in vivo via intravenous administration [49].

2.2. Cell-Penetrating Peptides (CPPs)

Cell-penetrating peptides (CPPs) are able to induce membrane translocation and/or endosomal escape for the delivery of nucleic acids into the cytosol or nucleus. Artificial pH sensitive and amphiphilic CPPs, like GALA, were developed to mimic the fusogenic properties of viral peptides [55]. GALA undergoes a conformation change in the acidic endosomal environment from random coil to an α-helical structure, which would facilitate endosomal escape and the subsequent nucleic acids release into the cell cytosol [56]. The anionic properties of GALA limited its application in nucleic acid delivery [57]. Cationic KALA and RALA peptides were designed by substitution of negatively charged Glu (E) in the GALA peptide sequence with positively charged Lys (K) or Arg (R) at a similar position on the sequence backbone, respectively (Table 3) [58]. KALA and RALA peptides maintained the fusogenic amphipathic characteristics of GALA, while achieving the ability to complex nucleic acids [58]. KALA peptide undergoes conformation change already at physical pH, which may disrupt other membranes and lead to toxicity. The most promising RALA peptide with selective endosomal disruption as well as reduced toxicity exhibited comparable transfection efficiency in pDNA [58,59], siRNA [60] and mRNA [61] delivery as compared with commercial lipofectamine or gold standard carrier systems.
By modifying a stearyl group at the N-terminus of transportan 10 (TP10), Langel and coworkers developed a new generation of chemical-modified CPPs, named the ‘PepFect’ and ‘NickFect’ families, for nucleic acids delivery (Table 3). The stearyl-TP10 (PepFect3) strongly enhanced the serum stability of complexes as compared to the unmodified CPPs [62], and exhibited comparable efficient pDNA transfer as commercial vectors both in vitro and in vivo [63]. By incorporating pH-titratable trifluoromethyl-quinoline analogues to the lysine-side chain of PepFect3 for the facilitating the endosomal release of cargos, the siRNA complexes of the designed PepFect6 significantly triggered the target gene knockdown via systemic administration without observable toxicity [64]. Instead of lysines and isoleucines in PepFect3, PepFect14 incorporated ornithines and leucines in the sequence [65]. By complexing with splice-correcting oligonucleotides (SCOs), the PepFect14/SCOs efficiently delivered SCOs into mdx mouse myotubes, a Duchenne’s muscular dystrophy (DMD) cell culture model, and induced splice-correction at rates higher than commercial vectors. For further improving the cellular internalization and endosomal escape, a phosphoryl-group was incorporated to the backbone of PepFect3 to obtain the NickFect1 with lower net charges, which exhibited a significant improvement of splice-correlation as compared with PepFect3 [66]. With ornithine as a side chain instead of lysine, NickFect51 exhibited promising endosomolytic properties [67] and greater transfection efficiency in nucleic acid delivery [68]. By altering the net charges and helicity, amphipathic α-helical peptide NickFect55 delivered pDNA into tumors in mice bearing intracranial glioblastoma or subcutaneous Neuro2a/HT1080 tumors [69].

2.3. Peptides with Supramolecular Self-Assembly Domains

The development of supramolecular self-assembly has enriched the field of nucleic acid delivery. Taking advantage of the natural propensity for hydrogen bonding within the secondary structure of peptides, the rationally designed sequence-defined peptides assemble into various nanostructures [73,74,75,76,77,78,79,80] via non-covalent interactions, such as hydrogen bonds, π–π interactions, electrostatic interactions and van der Waals interactions.
Virus-like nanoparticles (VLPs) are one kind of structural viral mimicry derived from self-assembly of virus-derived peptides. Sequence-defined peptides were designed with a cationic region for nucleic acid compaction, an α-helical or β-sheet structure segment for supramolecular self-assembly and stability and a hydrophilic tail for nanoparticle dispersion. Lee and colleagues designed a short β-sheet peptide Glu-KW, with a repeat sequence of WKWE to promote β-sheet formation, a cationic K8 segment for nucleic acid binding and a carbohydrate d-glucose at the outermost part to prevent uncontrollable aggregation (Table 4). Filamentous nanoribbons assembled by Glu-KW and siRNA exhibited significant siRNA-mediated gene silencing [79]. Stupp and colleagues designed an α-helical PEGylated coiled coil peptide modified by cationic spermine segments (Figure 1A) [81]. The peptide was preassembled into mushroom aggregates, then dsRNA was encapsulated via electrostatic interactions to form filamentous virus-like nanoparticles [81]. Vries and colleagues designed a minimal viral coat polypeptide C-(GAGAGAGQ)10-K12, with an N-terminal oligolysine block for nucleic acid binding, a central silk-like sequence (GAGAGAGQ)10 for self-assembling into stiff filamentous structure and a C-terminal 407-amino acid hydrophilic random coil for dispersion (Table 4) [82]. The designed peptide co-assembled with pDNA [82] or mRNA [83] into rod-shaped VLPs, which protect the nucleic acids against enzymatic degradation and show significant transfection efficiency in cells. Chau and colleagues developed spherical virus-like nanococoons through coassembling pDNA and a short peptide K3C6SPD [80], which was consisted of an N-terminal cationic region for nucleic acid binding, a central β-sheet formation region for self-assembly and stabilization of the peptide/DNA nanococoons, and a C-terminal hydrophilic region for dispersion (Figure 1B). Further studies found that tuning the peptide sequence, such as changing side-chain hydrophobicity or β-sheet peptide length, significantly changes the stability of nanococoons, thus affecting their DNA transfection efficiency [84]. By incorporating four histidines at the N-terminus and two histidines within the central β-sheet region as pH-sensitive regions, as well as two aromatic benzylated cysteines CBzl within the central β-sheet region to promote self-assembly and inter-subunit association through π–π stacking and hydrophobic interactions, Chau et al. further designed H4K5-HCBzlCBzlH peptide, which coassembled with pDNA into spherical VLPs [85]. These VLPs displayed stimuli-responsive sequential disassembly and effective DNA transfection efficiency [85].
In addition, Stupp’s team developed a supramolecular self-assembly system based on peptide amphiphiles (PAs, Table 4), which consist of a short β-sheet forming peptide sequence linked to a hydrophobic tail [74,75,76,77]. DNA-PA nanofibers formed by DNA-PA conjugates self-assembly displayed improved binding affinity to the target protein, enhanced nuclease-resistance as well as improved capacity to block PDGF-BB activity as compared with free aptamer [86]. Hernandez-Garcia et al. synthesized P4 peptide by fusing P2 peptide for specific siRNA binding [87] and P3 peptide for structural switching from α-helix to β-sheet [88] via a spacer of two glycines [89]. siRNA-peptide nanoparticles formed with P4 via supramolecular assembly and exhibited efficient protein knockdown in glial neuronal cells without significant toxicity. This demonstrates the potential of using supramolecular systems for non-viral nucleic acid delivery [89]. Further discoveries on the important function offered by these self-assembling supramolecular nanostructures and the formed three-dimensional scaffolds will benefit the development of smart nucleic acid nanomedicines.

2.4. Lipo-Peptides

Besides using only natural amino acids, defined artificial lipo-peptides were also synthesized as nucleic acid carriers. Lu and colleagues [90,91,92] designed lipo-peptide like carriers for nucleic acid delivery, which consisted of a cationizable triethylene tetramine head, amino acid-based linkers including cysteines, histidines or lysines and two terminal hydrophobic oleic acids (Figure 2). Libraries were screened to optimize the number of protonable amines, the presence of histidines, and the unsaturated degree of fatty acid tails. Sequence-defined (1-aminoethyl) imino bis [N-(oleoyl cysteinyl histinyl-1-aminoethyl) propionamide] (EHCO) and (1-aminoethyl)iminobis[N-(oleicylcysteinyl-1-amino-ethyl)propionamide] (ECO) displayed high cellular internalization as well as reporter gene silencing upon the intracellular delivery of nucleic acids [93]. By incorporating retinylamine (Ret) to the ECO/pDNA nanoparticles via a PEG spacer for targeted delivery of pDNA into retinal pigmented epithelium (RPE), the resulting Ret-targeted ECO/pDNA nanoparticles significantly improved the electroretinographic activity of Rpe65−/− mice. The therapeutics effects lasted for at least 120 days [94]. The therapeutic potential of ECO/pDNA nanoparticles in the treatment of visual dystrophies was also confirmed by further research [95,96]. Malamas et al. [90] optimized the amphiphilic cationic lipid carriers by evaluation of the role of protonatable amine numbers and pKa of the cationic head group, the degree of unsaturation of the bis-hydrophobic tails and the presence of histidine residues as an amino acid linker. The amphiphilic cationic lipids displayed structure-dependent RNAi activity, with ECO (bis-oleic acid) and ECLn (bis-linolic acid) performing the best reporter gene knockdown. Later an ECO-based siRNA nanoformulation was applied for tumor-targeting therapeutics by incorporating an RGD peptide via a PEG spacer. Intravenous injections of RGD-targeted ECO/siβ3 nanoparticles significantly inhibited primary tumor growth and metastasis in MDA-MB-231 breast tumors bearing mice [97]. RGD-targeted ECO/siDANCR nanoparticles resulted in gene silencing of onco-lncRNAs and robust suppression of tumor progression without overt toxic side-effects in nude mice bearing triple-negative breast cancer (TNBC) xenografts [98].

2.5. Oligoaminoamines (OAAs)

Hartmann and Börner adopted SPS for the synthesis of sequence-defined oligoaminoamines (OAAs) by using completely artificial building blocks, such as protected spermine and succinic acid. Disulfide linkages or terminal PEG chains were optionally introduced at precise positions. The resulting oligomers were firstly applied for pDNA polyplexes formation [27,99,100,101]. Extending this strategy, Schaffert et al. [102,103] developed novel artificial oligo(aminoethylene) amino acids with appropriate internal t-butyloxycarbonyl (tBoc) and amino-terminal fluorenyl-methoxycarbonyl (Fmoc) protective groups. The artificial oligoamino acids (tetraethylenepentamine artificial peptide Stp, Gtp and Ptp, pentaethylene hexamine peptide Sph, triethylenetetramine artificial peptide Gtt) contain several repeats of protonatable amino ethylene motif, which mediates the proton sponge effect in the gold standard transfection agent polyethylenimine (PEI) [104,105]. By introducing lysines as branching sites and cysteines as disulfide crosslinking for polyplexes stabilization, the resulting artificial oligoamino acids were applied to establish more than 1400 sequence-defined oligoaminoamides with different sequence and architectures (linear [106,107], 2-arm [107], 3-arm [107,108], 4-arm [102] [107,109], comb [110], i-, U- and T-shape [107,108,111]) for nucleic acid delivery. Hydrophobic domains as bis(acyl)-modified lysines, or tyrosine tripeptides were optionally incorporated for hydrophobic polyplex stabilization, and histidines for endosomal buffering (Figure 3).
Due to the precision of the chemical design, it is feasible to obtain clear structure-activity relations via sequence-defined oligopeptides. Testing the length of a linear oligo(aminoethylene) amides based on Stp (containing 3-protonable nitrogens per unit) demonstrated that 30 Stp units (representing 90 protonable nitrogens) was optimum for DNA compaction, with 6-fold higher pDNA transfection efficiency and 10-fold lower cytotoxicity than the conventionally “gold standard” linear PEI (LPEI, 22 kDa) [106]. Salcher et al. [102] developed 4-arm oligomers with 2 to 5 repeats of artificial oligoamino acid building blocks, and demonstrated that the introduction of N-terminal cysteines increased the stability and transfection efficiency of pDNA polyplexes. Furthermore, the building blocks exhibited a clear rank in the order of Sph > Stp >> Gtt in terms of pDNA compaction and transfection capability. Further optimization via fine-tuning the endosomal protonation capacity [109] found that building blocks with even numbered protonable nitrogens (Sph and Gtt) exhibited significantly higher endosomal buffer capacity than structures with an odd number (Stp) analog. Yet Gtt-containing oligomers (lowest number of nitrogens) exhibited low gene transfection efficiency due to less pDNA binding capacity. Incorporation of cysteines for stabilizing disulfide crosslinking compensated for transfection efficiency. This indicates that efficient pDNA delivery needs to be combined and balanced with both buffering and stabilizing moieties. Among sequence-defined 4-arm oligomers developed by Salcher et al. [102], Stp- and Sph-based cysteine-ended oligomers exhibited similar siRNA compaction capacity, with Stp-based oligomers providing the best reporter gene silencing.
In addition to N-terminal cysteines for bioreducible stabilization, hydrophobic fatty acids were incorporated to control the hydrophobic polyplex stabilization and pH-specific lytic activity using lysine amines as the attachment site [107,111,112]. Lipo-oligomers with lysine diacylated with unsaturated C18 (oleic acids or linolic acids) mediated higher polyplex stabilization, higher lytic activity and higher transfection efficiency as compared with analogues without fatty acids or with a single fatty acid as well as with short length carbon chain fatty acids. Moreover, pH-specific lytic activity was controlled by the type of fatty acids used, while the position of the hydrophobic elements, as at the end/center/both ends of the backbone for the i-/T-/U-shape, respectively, had no significant influence. Incorporation of hydrophobic tyrosine tripeptides (Y3) [112,113] further increased the endosomal buffer capacity and serum stability via aromatic π–π stacking, resulting in enhanced pDNA polyplexes compaction as well as pDNA transfection efficiency as compared with the corresponding Y3-free oligomers.
For pDNA of larger size (5–15 kbp), it is crucial to compact it into small-sized nanoparticles by polycations and then release it in the nucleus in the bio-active form.
Incorporating c-Met-binding peptide (cMBP2) as a targeting ligand into sequence-defined 2-arm or 4-arm architectures via a precise PEG shielding domain exhibited far higher pDNA transfection efficiency in cell culture than the corresponding non-targeted groups [114,115]. Meanwhile, incorporation of alternating histidines into the cationic core for enhanced endosomal buffer capacity was found to be strongly beneficial for pDNA transfection [114,115]. However, pDNA polyplexes were not perfectly compacted by the PEG-containing carriers, resulting in a poor performance in the in vivo situation after intravenous administration. Therefore, co-formulations of a multifunctional cMBP2-containing 2-arm structure with an analogous PEG-free, well compacting 3-arm structure exhibited greatly enhanced in vivo gene expression in Huh7 tumor bearing mice [115]. This discrepancy between pDNA compaction and nanoparticle shielding was studied in detail by screening of two-arm oligoaminoamides containing 37 cationizable nitrogens and hydrophilic segments of different lengths: either PEG segments with 12, 24 or 48 oxyethylene repeats or peptidic shielding blocks composed of 4 or 8 repeats of the proline-alanine-serine sequence [116]. Interestingly, only the shorter hydrophilic segments (12 oxyethylene units or four PAS repeats) resulted in very compact 40–50 nm pDNA polyplexes, similar as 3-arm structures without a hydrophilic segment. Obviously, consistent with other reports [117,118,119,120], the balance between shielding, pDNA compaction and sufficient endosomal buffering must be considered for optimizing non-viral carriers based on hydrophilic and cationic block oligomers.
For siRNA delivery, the introduction of fatty acids (unsaturated oleic acids or linolic acids) was found especially beneficial for hydrophobic stabilization and pH-specific lytic activity. Incorporation of tyrosine tripeptides for polyplex stabilization by aromatic π–π interactions further enhanced siRNA delivery. The presence of cysteines was strictly required for siRNA polyplexes stabilization and gene silencing efficiency for the majority of structures. The stability provided by cysteine disulfide crosslinking can be partly compensated in U-shape or T-shape structures by extra hydrophobic stabilization devoted by the fatty acids.
For better mimicking the behavior of viruses in a dynamic and bioresponsive way, stimuli-responsive domains were introduced to a specific site of sequence-defined OAAs via SPS, which would mediate cleavage of chemical bonds or changes of characteristics responding to the biological microenvironment. Klein et al. [121] developed bio-degradable T-shape lipo-OAAs by introducing Fmoc-protected succinoyl-cystamine as the disulfide building block (ssbb) between cationic and lipid domains. The cytosolic glutathione (GSH) triggered favorable cytosolic siRNA release and degraded the lipo-oligomers into neutral lipids and nontoxic small hydrophilic elements. Reinhard et al. [122] precisely inserted short enzymatically cleavable (l)-arginine peptides (RR) between lipids and cationic domains of the T-shape lipo-OAAs. This resulted in endolysosomal protease cathepsin B-triggered siRNA release and reduced cytotoxicity.

3. Optimizing Carriers for Different Types of Therapeutic Nucleic Acids

On the one hand, as nucleic acids are mostly composed of an anionic phosphodiester backbone, their delivery requirements have similarities. On the other hand, the requirements differ for different nucleic acids due to their different physical properties and target sites as well as their specific applications. Therefore individual screening of nanocarriers for their optimized delivery is needed. pDNAs are large polymeric polyanions that require carriers for reversible compaction into nanostructures. Due to the much smaller size of siRNA and miRNA, their electrostatic interaction with cationic polymers is far less, resulting in limited polyplex stability. In terms of sgRNA with medium size, it is essential to interact with Cas9 protein properly for the subsequently genome editing function. For medium large sized mRNA, it is crucial to compact it into small-sized nanoparticles by polycations and then release it in the cytosol in the bioactive form.
For the successful delivery of all cargos, the formation of stable nanoformulations with proper size, zeta potential, stability and suitable protection of cargo in the bioactive form is required. Nanoformulations need to realize endosomal escape and the cargos need to be available in the cytosol (siRNA, miRNA and mRNA) or be imported into the nucleus (pDNA and Cas9/sgRNA) for efficient genetic intervention.

3.1. Stable Nanoparticle Formation Is Important for siRNA Carriers

In 2018, the first siRNA-based therapeutic product, Onpattro (Patisriran), obtained the regulatory approval for the treatment of peripheral nerve disease caused by hereditary transthyretin-mediated amyloidosis (hATTR) [123]. Onpattro encapsulates siRNA against TTR mRNA into 60-100 nm PEGylated lipid nanoparticles (LNPs). After intravenous administration, the LNPs are coated with apolipoprotein in blood circulation, which facilitates LDL receptor targeted delivery into liver hepatocytes. Subsequently in 2019, the FDA also approved Givosiran (GIVLAARI), a completely chemically modified tri-(N-acetyl-galactosamine) (GalNAc)-PEG-siRNA conjugate as therapeutic for the treatment of patients with acute hepatic porphyria (AHP) [124]. The complete chemical stabilization of siRNA is required to avoid its biodegradation. Upon subcutaneous administration, the siRNA conjugate is selectively delivered into hepatocytes via asialoglycoprotein receptor (ASGPR) mediated endocytosis. These two FDA-approved siRNA therapeutics were important breakthroughs in the field of nucleic acid therapy beyond the previous established antisense oligonucleotide drugs [125]. They open the door of the medicinal market for a series of other rationally designed siRNA therapy products. High stability (by either liposomal encapsulation or covalent attachment of stabilized siRNA) and potent receptor-mediated delivery (by either targeting the LDL receptor or the ASGPR of hepatocytes) are important reasons for their efficacy. Future siRNA drugs targeting other tissues beyond the liver remain to be developed.
siRNA delivery systems share with pDNA delivery several critical steps such as endosomal escape or the subsequent cargo release. The functional elements that are beneficial for pDNA transfection may turn out to be also efficient constitutes for siRNA mediated gene silencing. As compared with pDNA, siRNA however is a far smaller double-stranded nucleic acid with 42-46 negative charges, which contributes much less to the electrostatic stabilization of polyplexes. Strategies such as covalent conjugation of siRNA with transport carriers, chemical optimization of the polycationic carriers with terminal cysteines, tyrosine tripeptides and hydrophobic fatty acids were adopted to enhance the extracellular stability of siRNA polyplexe (see Section 2). Meanwhile, moieties for polyplex stabilization shall be moderated and balanced with the endosomal release and the final transfection efficiency. Bioreducible disulfide crosslinking of terminal cysteines to stabilize polyplexes extracellularly was identified to be crucial for siRNA transfection efficiency in many studies. Yet further stabilization of polyplexes by cysteine-arginine-cysteine (CRC) motifs led to a reduction of gene silencing efficiency [126]. As also demonstrated in studies of Mixson’s lab, the optimal pDNA carrier H2K4bT [46] was less effective for siRNA delivery. In contrast, 8-branched H3K8b peptides containing more branches for siRNA binding were found to be more effective in siRNA mediated gene silencing than H2K4bT [47] (see Section 2). By adding a lysine to each terminal branch of H3K8b peptides, their siRNA binding ability further increased. However, this triggered less effective gene silencing [47].
The incorporation of endosomal buffering histidine, which was proven as beneficial for pDNA delivery, may reduce the stability of siRNA polyplexes. The loss of stability by histidine can be compensated by other stabilizing units. Luo et al. [127] demonstrated histidine-free T-shape lipo-oligomers with a short cationic Stp backbone (13 protonatable amines) exhibited better transfection efficiency than the corresponding histidine-containing oligomers. While for T-shape lipo-oligomer with a long cationic Stp backbone (25 protonatable amines), the incorporation of histidines further increased the siRNA transfection efficiency [128]. The finding is well consistent with previous reports. Histidine-enriched H3K8b peptides containing larger cationizable oligo-lysine exhibited significantly higher gene silencing efficiency than the corresponding histidine-free peptide [47]. Histidine-free siRNA carriers such as ECO and ECLn containing a short cationizable head group performed better gene silencing than their corresponding histidine-containing carriers [90].

3.2. Other Nucleic Acid Cargos Including Cas9/sgRNA or PMO

Precise genome modifying nucleases, such as CRISPR-associated nuclease Cas9 have been harnessed to create a DNA double-strand break (DSB) for site-specific genome editing [129,130,131,132]. Among different intracellular delivery of genome-editing agents in the form of gene expression constructs based on DNA [23] or mRNA [132] or Cas9 protein/sgRNA RNP formulations, Cas9/sg RNPs [23,131] were considered to be the most effective tool for the genome engineering duo to their immediately genome editing process without transcription or translation and risk of spontaneous genome integration. Intracellular delivery of the Cas9 protein across the cell membrane and escape from endosome in the form of active Cas9/sgRNA RNPs is a persistent challenge.
Lu and colleagues [133] replaced 3,3′-[(2-aminoethyl)imino]bis[N-(2-aminoethyl)propenamide in previously designed ECO by 2,2′,2″-triaminotriethylamine as a novel cationizable headgroup, and optionally introduced lysine or histidine as an additional linker. ECO and iECO (isotypic ECO without additional lysine or histidine) formed stable nanoformulation with pDNA, and mediated the most efficient GFP gene editing for the intracellular delivery of pDNA expressing CRISPR/Cas9.
Kuhn et al. [134] screened an analogous T-shape lipo-oligomer library containing saturated stearic acid, mono-/bis-unsaturated and amide functionalized or hydroxylated stearic acid lipid (OHSteA) moieties for Cas9/sgRNA RNPs delivery. Tyrosine tripeptides and terminal cysteines were adopted due to their beneficial effect in polyplex stabilization found in the context of pDNA and siRNA delivery. The Cas9/sgRNA lipo-complexes formed by cationic T-shape lipo-OAA T-OHSteA and negative Cas9/sgRNA were identified to be the best-performing formulations as compared to the ones formed by oligomers containing unsaturated or saturated stearic acid without hydroxylation. T-OHSteA Cas9/sgRNA complexes exhibited smaller and more defined particle formation, enhanced cellular internalization and improved endosome escape. This resulted in an increased nuclear association and the highest CRISPR/Cas9 mediated GFP gene knock-out efficiencies in Neuro2a eGFP-Luc cells and HeLa eGFP-Luc cells.
For the small noncharged cargo phosphorodiamidate morpholino oligomer (PMO), Lächelt and colleagues screened an analogous library of T-shape lipo-OAAs containing fatty acids with different numbers of unsaturated bonds. They found lipo-OAA/PMO conjugates containing linolenic acid with three cis double bonds exhibiting the highest splice-switching effect in vitro and in vivo after intratumoral administration [135]. The superior endosomal lytic activity of linolenic acid in lipo-OAA/PMO conjugates over corresponding saturated stearic acid or unsaturated fatty acids with other numbers of double bonds was further identified to be the most possible reason.

4. Pharmacological Barriers for In Vivo Delivery

Non-viral nucleic acid delivery systems have to overcome several extra- and intracellular pharmacological barriers to realize safe and efficient gene therapy (Figure 4). Nucleic acids shall be protected by nanomaterials from enzymatic degradation, non-specific interactions, rapid renal filtration and entrapment by phagocytes. Upon reaching the targeted sites, the nanoformulations need to overcome the vascular barrier and enter the target cells by cellular uptake. Subsequently they must escape from the endosome and release the nucleic acid in the bioactive form to trigger efficient gene regulation at the target site. The major pharmacological challenges and the corresponding strategies to overcome them are described as follows.
First, the carriers must form stable nanoparticles to prevent the naked nucleic acids from being degraded in the blood by nucleases and cleared from the bloodstream. As described in the above sections, the formation of nucleic acid complexes commonly is based on electrostatic interactions between anionic nucleic acids and cationic domains of the sequence-defined polymers [47,90,102]. Additional stabilization can be donated by hydrophobic interactions by incorporated lipids [90,108], aromatic stabilization by tyrosine tripeptides [112], bioreducible disulfide crosslinking formed by cysteines [90,102] or α-helical or β-sheet structure segments for supermolecular self-assembly [79,80,81,82,83,84,85].
After intravenous administration, polyplexes interact with electrolytes, proteins or non-target cell in the serum, which might result in the dissociation of polyplexes and a loss of gene transfection. Moreover, innate immune responses caused by the binding of positive charged polyplexes with serum complement proteins, self-aggregation into larger microstructures and aggregation with erythrocytes and other blood cells would trigger adverse effects. Shielding the polyplexes with PEG, a carbohydrate or other hydrophilic polymers must reduce such undesired non-specific interactions with the bioenvironment; such measures also should prolong the circulation time in the blood stream [54,117,136,137,138]. However, PEGylation of positive charged surface reduced cell association and the following endosomal escape function of the aminoethylene-based OAA polyplexes, which was consistent with previously finding with PEGylated PEI polyplexes [118,139]. This dilemma can at least be partly compensated by incorporating target ligands for receptor-mediated internalization and histidines for enhanced endosomal buffer capacity.
Afterwards, upon proper surface shielding and thus better biodistribution, the carriers shall accumulate at specific target tissue sites. The hydrodynamic size of polyplexes plays a critical role on the biodistribution and pharmacokinetics for systemic administration. Nanoparticles with a hydrodynamic size around or below 6 nm are rapidly cleared from the blood stream by the kidney [140]. In tumor-bearing mice, larger polymers or long-term circulating nanoparticles of sizes between 20 and 400 nm can leave the blood circulation across a leaky tumor vasculature and passively accumulate in the interstitial space of tumor tissues, as described by the enhanced permeation and retention (EPR) effect [141,142]. Once accumulated at tumor sites, specific binding with target tumor cells and subsequent effective cellular internalization can be facilitated by incorporated targeting functions. For example, targeting ligands such as B6 [109,143], cRGD [143], folic acid (FolA) [109,113], methotrexate (MTX) [144], c-Met-binding peptide (cMBP2) [114,115], transferrin (Tf), AP-1, EGF receptor-binding peptide (GE11) [143] and IL-6 receptor binding I6P7 peptide [145] were attached to precise PEG shielding domains and then introduced to the surface of polyplexes by pre- or post-modification for active receptor-mediated accumulation in target tumor cells.
In case of the all-in-one formulations with targeting and shielding domains (Figure 5A), pDNA polyplexes formed by 2-arm/4-arm ligand-PEG-OAAs exhibited an average size of ~100 nm, and the histidine-incorporation in the backbone significantly improved the pDNA transfection efficiency as compared to those control groups with alanine in the backbone, or than to the corresponding non-targeted groups [140,146,147]. After intravenous injection of I6P7-PEG-Stp-histidine/pDNA polyplexes developed by Huang et al. [145], the delivered pING4 (pDNA encoding inhibitor of growth 4) was found successfully expressed in the glioma, resulting in a significantly prolonged survival time of treated orthotopic U87-bearing mice. As for much smaller siRNA, 2-arm/4-arm ligand-PEG-OAAs [140,146,147] formed multifunctional nanoplexes with an average size as small as ~8 nm. The resulting nanoplexes need to be stabilized by cysteines-based disulfide crosslinking, while siRNA needs to conjugate with an endosomolytic influenza peptide (Inf7) [148,149] to enhance the endosome escape capacity and subsequent gene silencing efficiency. Although siRNA nanoplexes were rapidly cleared by the kidney due to their small size, localized intratumoral administration exhibited superior tumor suppression and enhanced antitumoral activity via EG5 gene silencing [140,146]. To provide efficient alternatives for an all-in-one tumor targeted delivery system, non-shielding cationic OAAs were incorporated into ternary complexes to increase the average size of polyplexes to ~100 nm. Targeted combination polyplexes (TCPs) [150] were developed by coformulating siRNA with a 2-/4-arm FolA-PEG-OAAs and non-PEGylated 3-arm OAAs. DTNB (5,5′-dithio-bis(2-nitrobenzoic acid)) was reacted with one thiol-containing oligomer to activate the terminal cysteine thiol groups. The resulting TNB-modified OAAs reacted with the terminal cysteine groups of the other thiol-containing OAAs rapidly via disulfide formation. Later targeted lipo-polyplexes (TLPs) were developed [151] by first formulating siRNA with a T-shape lipo-OAA and then coformulating with a 2-arm FolA-PEG-OAAs via disulfide formation. Both the folate receptor (FR)-targeted TCPs and TLPs exhibited siRNA accumulation into a subcutaneous L1210 leukemia site and triggered a reduction of EG5 gene silencing via intravenous administration.
In addition to the all-in-one synthesis, the other option is to post-modify the cationic polyplexes core with a shielding and targeting shell at specific sites (Figure 5B,C), which allows the individual optimization of the core polyplexes and the shell ligands. Two strategies were developed for the post-modification of stable core siRNA lipo-polyplexes with targeting ligands. One was coupling cysteine ended oligomers formed NPs with maleimide- or ortho-pyridyl disulfide (OPSS) containing PEG-ligands via a cysteine-based linkage [152,153,154,155], the other was coupling with azido ended oligomers formed NPs with dibenzocyclooctyne amine (DBCO) PEG-ligands via an orthogonal cooper-free click reaction [127,156,157,158]. Nanoparticle shielding with PEG and related hydrophilic polymers results in surface charge masking, reduced unspecific biological interaction and enhanced systemic circulation [159]. However, shielding may interfere with subsequent cellular uptake and especially with endosomal escape. Therefore bioreversible attachment of shielding agents such as by endosomal labile linkers has been successfully explored [118]. Beckert et al. [160] designed 4-arm OAAs with additional lysine residues for subsequent post-modification with amine-reactive poly(N-(2-hydroxypropyl)methacrylamide) (pHPMA) by using the acid-labile linker AzMMMan. Upon intravenous administration in Neuro2A tumor bearing mice, such a bioreversible pHPMA shielding of pDNA polyplexes reduced unspecific expression in the first-pass organs such as the lung and the liver. Consistent with improved circulation and subsequent deshielding in endosomes, the shielding enhanced the gene expression in the distant tumor. Morys and colleagues post-modified core pDNA lipo-polyplexes with sequence-defined mono- or bivalent Cys(Npys)2-PEG24-GE11 via disulfide formation, the resulting post-functional lipo-polyplexes exhibited receptor-dependent internalization as well as luciferase marker gene and sodium iodide symporter (NIS) gene expression in epidermal growth factor receptor (EGFR)-overexpressing tumor cells. siRNA lipo-polyplexes modified with maleimide-gE4-FolA via disulfide formation showed FR-mediated internalization in vitro and extended persistence in L1210 tumor bearing mice [155]. Tf-conjugated siRNA lipo-polyplexes modified maleimide-PEG-Tf exhibited enhanced gene silencing in vitro and improved tumor persistence in murine Neuro2A tumor bearing mice [152].
As compared with the disulfide bonding reaction, click chemistry was highly specific and biorthogonal, without byproducts [161,162,163] or affecting the crosslinking of cysteines. FolA-conjugated siEG5 nanoparticles, designed by click-modification with DBCO-PEG-FolA, displayed extended tumor retention in L1210 tumor-bearing mice after intravenous application, with a knockdown of ~60% of target EG5 gene silencing [157]. Furthermore, EGFR-targeting lipo-polyplexes click-modified with GE11 were applied for EG5 siRNA/pretubulysin (PT) [156] co-delivery; significant combination effects were confirmed in EGFR positive tumor cell cultures. A novel dual antitumoral conjugate of EG5 siRNA with the pro-apoptotic peptide KLK (siEG5-KLK) was formulated into lipo-polyplexes, followed by DBCO-PEG-AP1 click modification for IL4 receptor mediated tumor targeting. The resulting nano-formulations showed an enhanced anti-tumor effect due to the combined effect of EG5 gene silencing induced mitotic arrest and KLK induced mitochondrial destabilization [127].
Targeting ligands as mentioned above recognize their specific receptors that are overexpressed in tumor cells with high metabolic activity and excessive proliferation, and then induce active receptor-mediated intracellular accumulation. Once accumulation of nanoparticles in endosomal vesicles of target tumor cells occurs, the upcoming intracellular hurdle is an effective endosomal escape. Sequence-defined polycations based on protonatable amino ethylene motif will promote its endosomal escape due to the proton sponge effect [164]. pH-responsive endosomolytic peptides, as Inf7 [148], can be introduced to further facilitate an endosomal escape. Influenza hemagglutinin HA2 derived peptides like Inf7 undergo conformational changes in the secondary structure in an acidic endosomal environment to an amphipathic helix. This leads to the de-stabilization of the endosomal membrane [148]. Hydrophobic domains, such as fatty acids, can be incorporated due to their endosomal pH-specific lytic activity. Amino acids as histidine, are optionally incorporated due to their endosomal buffering capacity in the acidic endosomal environment.
The events following endosomal escape are still poorly understood. Studies have shown that only quite a few internalized siRNA could be delivered into cell cytosol, with a narrow window of siRNA released from endosomes within 5–15 min after cell internalization was observed [165,166]. It has also been reported that siRNA-mediated gene silencing ability was improved by siRNA complexes with continued endosomal escape (over hours) [151] rather than a short immediate endosomal escape.
In contrast to siRNA or mRNA, pDNA has to overcome the additional hurdle of nuclear entry, which has been proved to be a real bottleneck via cell cycle studies [167,168,169,170,171]. Nuclear import takes place during cell division in proliferating cells, and by a size-dependent active manner via the nuclear pore complex (NPC) in non-proliferating cells [172]. It was reported that coupling of DNA with a short cationic peptide as a nuclear localization signal (NLS) [172,173,174,175,176,177] could enhance pDNA transfection efficiency not only by improving nuclear entry [173,178] but also by facilitating cytoplasmic transport [178]. Other options such as incorporation of chromatin-targeting peptides [179], histones [180,181], phosphorylation responsible peptides [179] or microtubule-binding peptides [182,183] were evaluated for better nuclear import. Further research for improved intranuclear delivery is still highly requested.
Beyond an endosomal escape and nuclear entry barriers, nucleic acids should be released in the bioactive form via nanoparticle disassembly caused by disassembly of non-covalent interactions or physicochemical properties and conformation changes, or bond cleavages [13,122,126]. That means, polyplexes should be dynamic for nucleic acid delivery; they should be stable during the whole process of extra- and intra-cellular delivery to protect their loaded nucleic acids, but should disassemble in the cytosol and release the cargos at their target sites of action. The target site can be the cytosol in the case of siRNA, miRNA, mRNA and standard ASO, or the nucleus in case of pDNA, RNA splicing-modulating ASOs, or Cas9/sgRNA.
Apart from stability, the size, shielding, targeting and an efficient endosomal escape, a reduction of carrier-triggered toxicity has to be considered for in vivo nucleic acid delivery. Polycations like PEI have been developed for clinical application with encouraging results, yet the high transfection efficiency goes hand in hand with N/P ratio dependent cytotoxicity. Bio-degradable domains such as the bioreducible ssbb unit, or enzymatically cleavable L-arginine peptides, can be incorporated into the sequence [121,122] to enable the degradation of the oligopeptides into less-toxic small fragments, thereby improving the biocompatibility of nanocarriers.

5. Barcoding—A New Mode to Apply Sequences for Finding In Vivo Nanocarriers

Thousands of nanocarrier systems with different structures and properties have been designed and synthesized, with the long-term aim to overcome the pharmacological barriers for in vivo delivery. Due to the laborious nature of in vivo experiments, nanoparticles usually are first evaluated in cell culture systems to select a smaller number of candidates that exhibit the best performance for further in vivo characterization. However, cell culture in vitro experiments may provide information on successful intracellular delivery and bioactivity there, but they cannot predict the efficiency of the whole in vivo delivery process [49,53,184,185]. Therefore, high throughput methods for screening and identification of promising delivery candidates for efficient in vivo delivery are of utmost importance.
A pioneering example of in vivo screening was reported by Seng Cheng and colleagues [186] who analyzed a large library of cationic lipid/pDNA formulations for efficient gene transfer to the mouse lung. By this large screen, a formulation was discovered containing cationic lipid #67, a spermine—cholesterol derivative linked in a T-shape configuration, which was >100-fold more potent in vivo than previous pDNA lipid nanoparticles. A more recent impressive example was published by Dan Anderson and colleagues [187] who generated a lipopeptide library for the formation of siRNA lipopeptide nanoparticles (103 nanomaterials). In vivo screening for hepatocyte gene silencing in mice using a very convenient blood coagulation factor VII assay identified the lead lipopeptide cKK-E12, which subsequently was also found to be highly potent for liver gene silencing in nonhuman primates.
Using standard in vivo screening for the comparison of tested substances usually requires the use of several animals per substance due to reproducibility reasons. For ethical and economic reasons, a reduction of number of the experimental animals would be preferable. A most innovative solution for this problem was developed by Dahlman and colleagues [188]. They introduced sequence information for optimizing in vivo delivery of nucleic acids in a different mode as discussed in the previous sections. Their work applied “DNA barcoding”, which is a technology previously developed for identification and selection of unique members of libraries such as chemical libraries. For example, researchers had generated DNA-encoded chemical libraries by coupling each of the numerous chemical molecules of a library to a unique nucleic acid sequence (“DNA barcode”) [189]. After high throughput screening of such a library in a functional assay, the identity of the top candidates can be easily revealed by their attached DNA barcodes. Dahlman and colleagues applied such a DNA barcode-based system for screening multiple nucleic acid carriers simultaneously in one single mice and identifying most of the suitable carrier candidates (Figure 6). Chemically distinct lipid nanoparticle (LNP) formulations were prepared by a microfluidics system, where into each nanoformulation a distinct unique DNA barcode oligonucleotide was incorporated. DNA barcodes were based on the Illumina next generation sequencing primer technology and were approximately 60 nucleotide long oligonucleotides, terminally stabilized with phosphorothioates, containing a central variable nucleotide sequence as a barcode and the ends as adapter sequences for subsequent Illumina sequencing. The different nanoformulations were pooled together and injected into a single mouse. The nucleic acid barcodes were recovered at a different time point from different tissues or cells, then Illumina deep sequencing was performed to accurately quantify the distinct barcodes and thus the biodistribution of different nanoparticles [188,190]. Careful dosing studies demonstrated that DNA barcode LNPs can be measured at a low dose, which confirms the feasibility of multiplexing hundreds of nanoparticles in a single experiment [188].
This technology enables one to address new interesting questions on the pharmacology of drug and nucleic acid delivery. For example, LNPs containing cholesterol primarily traffic to liver hepatocytes, which is similar to natural lipoproteins. When comparing the delivery of more than 100 barcoded LNPs containing different cholesterol variants and analyzing distribution into eighteen cell types of the mouse, LNPs formulated with esterified cholesterol were found to be more effective in nucleic acid delivery than LNPs formulated with regular or oxidized cholesterol [191]. LNP containing cholesteryl oleate delivered siRNA and sgRNA more efficiently to liver endothelial cells than to hepatocytes. Information like this can be applied for the rational design of tissue-targeted nanocarriers.
A biodistribution assay named the Quantitative analysis of nucleic acid therapeutics (QUANT) DNA barcoding was developed to compare the difference of nucleic acid nanoparticles delivery to multiple cell types in wild-type and Cav1 knockout mice [192]. QUANT DNA barcodes were rationally designed with a reduced secondary structure to increase DNA polymerase access, which enables digital droplet PCR (ddPCR) readouts and quantifies delivery with very high sensitivity. Direct comparing in vitro and in vivo nucleic acid delivery of 281 barcoded LNPs to endothelial cells and macrophages indicated that in vitro delivery to macrophages and endothelial cells could not predict the delivery to the same cell types in vivo [193].
Beyond monitoring biodistribution only, a novel strategy, named “Fast identification of nanoparticle delivery (FIND)”, was developed by Dahlman’s lab to quantify the functional delivery of hundreds barcoded LNPs to multiple cell types within a single mouse. Functional nucleic acids, such as siRNA, sgRNA and mRNA, were co-formulated into LNPs with a unique DNA barcode. They measured the functional Cre mRNA delivery of more than 250 LNPs to multiple cell types in vivo, and identified two LNPs that efficiently deliver siRNA, sgRNA and Cas9 mRNA to endothelial cells and mediate endothelial cell gene editing [195]. Combined with bioinformatics, the team performed in vivo directed evolution of RNA delivery, and identified one LNPs that effectively delivers siRNA and sgRNA to bone marrow endothelial cells (BMECs) in vivo [194]. Meanwhile, in vivo screening can help to reveal the relations between nanoparticle structures and activities. The tropism of BMEC was not related to the particle size, yet changed with PEG structure and the introduction of cholesterol. For example, the group found a targeting ligand-free LNP containing oxidized cholesterol delivered Cre mRNA into the liver microenvironment 5-fold more than to hepatocytes, suggesting that cholesterol chemical composition played an important role in LNP targeting [196]. By applying a siGFP/DNA-barcoded system in transgenic eGFP mice, the group found that constrained lipid nanoparticles (cLNPs) containing a conformationally constrained adamantane tail can deliver siRNA and sgRNA to splenic T cells in vivo at low doses [197], and in contrast to standard LNPs do not preferentially target hepatocytes. Based on this, the group further demonstrated cLNP containing adamantyl phospholipids can delivery Cre mRNA to liver immune cells at low doses [198]. Like reported before [188], delivery takes place in a size-independent and chemical composition-dependent manner, providing a potential alternative for further active targeting based on chemical modification and not targeting ligands.
By screening hundreds of nanoparticles simultaneously, the high throughput DNA barcode-based system helps the researcher to understand the delivery process of nanocarriers, elucidate chemical composition-activity relations and identify optimized nanoparticles for in vivo gene editing. The DNA barcode sequence may be integrated into nanoparticles without affecting their in vivo behaviors. Up to now the strategy has been successfully applied for LNP formulations, but might be further used in various nanomaterials, including sequence-defined oligopeptides. Combined with rational design, empirical screening, computational prediction and sequencing-generated large datasets, DNA barcode-based systems will accelerate the chemical evolution of nanomaterials for in vivo application.

6. Conclusions

The delivery requirements for different nucleic acids differ due to their different physical properties such as sizes, charges and due to different biological requirements such as different intracellular target sites. As nucleic acids are commonly based on anionic phosphodiester backbones, their requirements for systemic administration are similar due to the shared pharmacological barriers. However, non-viral gene delivery system optimized for one type of nucleic acid, e.g., pDNA, cannot directly be applied to another type (e.g., siRNA and PMO). Meanwhile, as discussed in the above sections, moieties such as compaction capacity, stabilization, shielding, endosomal buffering capacity and the transfection efficiency shall be combined and balanced in the optimization of specific nucleic acids delivery. The incorporation of a certain functional unit needs to be balanced with other functional units. PEGylation of polyplexes reduces the unspecific interaction in serum and prolongs the circulation time, yet it also may strongly reduce the transfection efficiency in target cells (known as PEG dilemma). Proper PEG length as well as incorporation with beneficial moieties for enhanced endosomal escape can be adopted to solve this problem. In many cases, the top-ranking nanocarriers in vitro may not perform well in vivo, while optimized nanocarriers that performed well in vivo may not rank in the top in vitro, and would be discarded during in vitro prescreening. Therefore, using the most relevant screening models to select the optimal carriers is vital for further in vivo application.
Benefited from the improved understanding of the natural evolution of viruses and recognition of specific pharmacological barriers, a rational design and synthesis of sequence-defined nanocarriers under optimized chemical conditions might be an effective strategy for optimizing nucleic acids delivery. In contrast to natural carriers, such nanocarriers can profit from a much wider space of artificial amino acids and building blocks. By incorporating bioresponsive domains at a specific site of the sequence, dynamic synthetic artificial “viruses” can enhance the availability of nucleic acid at the required site of action with increased biocompatibility.
Precisely designed oligopeptides by incorporating various functional units in a defined sequence and topology facilitate the establishment of clear structure-activity relations. The relations identified by biophysical characterization and in vitro/in vivo functional screening enable further optimization of the nanocarrier within an evolution-like process. Though gene therapy is still on its rising phase, already 3025 gene therapy clinical trials have been performed worldwide at the current stage (see http://www.abedia.com/wiley). With the development of macromolecular chemistry, supramolecular self-assembly and high throughput screening technique, more and more artificial non-viral nucleic acid products will reach the nanomedicine market in the near future.

Author Contributions

Review topic and general structure, E.W.; writing the review draft, Y.W.; discussions, revising of text and generation of final version, E.W. and Y.W. Both authors have read and agreed to the published version of the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

DFG (German Research Foundation) project-ID 201269156 SFB 1032 subproject B4; DFG-NSFC Joint Sino-German Research Project 410149116; Sino-German (CSC-DAAD) Postdoc Scholarship Program (Y.W.).

Acknowledgments

We acknowledge the financial support of our research by the German Research Foundation (DFG) project-ID 201269156-SFB1032 subproject B4, the DFG-NSFC Joint Sino-German Research Project 410149116, and the Sino-German (CSC-DAAD) Postdoc Scholarship Program for supporting the work of Y.W.

Conflicts of Interest

There are no conflicts to declare.

Abbreviations

ASGPRAsialoglycoprotein receptor
ASOsAntisense oligonucleotides
Cas9CRISPR-associated protein 9
cLNPscLNP constrained lipid nanoparticles
cMBP2c-Met-binding peptide
CPPscell-penetrating peptides
CRCCysteine–arginine–cysteine
DBCODibenzocyclooctyne amine
ddPCRdigital droplet PCR
DSBdouble-strand break
DTNB5,5′-Dithio-bis(2-nitrobenzoic acid)
ECO1-aminoethyl)iminobis[N-(oleicylcysteinyl-1-amino-ethyl)propionamide]
EG5Eglin-5
EHCO(1-aminoethyl) imino bis [N-(oleoyl cysteinyl histinyl-1-aminoethyl) propionamide]
EGFREpidermal growth factor receptor
EPREnhanced permeation and retention
ESCEnhanced stabilization chemistry
FmocFluorenyl methoxycarbonyl
FolA Folic acid
FRFolate receptor
FRETFluorescence resonance energy transfer
GSHGlutathione
INF7glutamic acid-enriched analogue of the influenza hemagglutinin membrane protein HA2
LNPsLipid nanoparticles
LPEIlinear PEI
mRNAMessager RNA
MTX Methotrexate
NISSodium iodide symporter
NLSNuclear localization signal
NPCNuclear pore complex
OAAsOligoaminoamides
OPSSortho-pyridyl disulfide
PAsPeptide amphiphiles
pDNA Plasmid DNA
PEG Polyethylene glycol
PEI Polyethylenimine
pHPMApoly(N-(2-hydroxypropyl)methacrylamide)
pING4pDNA encoding inhibitor of growth 4
PMOsPhosphorodiamidate morpholino oligonucleotides
PT Pretubulysin
RAFTReversible addition-fragmentation chain transfer
RISCRNA-induced silencing complex
RNAiRNA interference
RNPRibonucleoprotein
SCOssplice-correcting oligonucleotides
sgRNAsingle guide RNA
siRNASmall interfering RNA
StpSuccinoyltetraethylene-pentamine
SphSuccinoyl-pentaethylene hexamine
SPSSolid phase supported synthesis
SSBBDisulfide building block = succinoyl-cystamine
tBoct-butyloxycarbonyl
TCPsTargeted combinatorial polyplexes
TLPsTargeted lipopolyplexes
TNBCtriple-negative breast cancer
TfTransferrin
TfRTransferrin receptor
TTRTransthyretin

References

  1. Davis, M.E.; Zuckerman, J.E.; Choi, C.H.J.; Seligson, D.; Tolcher, A.; Alabi, C.A.; Yen, Y.; Heidel, J.D.; Ribas, A. Evidence of RNAi in humans from systemically administered siRNA via targeted nanoparticles. Nature 2010, 464, 1067–1070. [Google Scholar] [CrossRef] [PubMed]
  2. Tabernero, J.; Shapiro, G.I.; LoRusso, P.M.; Cervantes, A.; Schwartz, G.K.; Weiss, G.J.; Paz-Ares, L.; Cho, D.C.; Infante, J.R.; Alsina, M. First-in-humans trial of an RNA interference therapeutic targeting VEGF and KSP in cancer patients with liver involvement. Cancer Discov. 2013, 3, 406–417. [Google Scholar] [CrossRef] [PubMed]
  3. Adams, D.; Gonzalez-Duarte, A.; O’Riordan, W.D.; Yang, C.-C.; Ueda, M.; Kristen, A.V.; Tournev, I.; Schmidt, H.H.; Coelho, T.; Berk, J.L. Patisiran, an RNAi therapeutic, for hereditary transthyretin amyloidosis. N. Engl. J. Med. 2018, 379, 11–21. [Google Scholar] [CrossRef]
  4. Chen, Y.; Gao, D.-Y.; Huang, L. In vivo delivery of miRNAs for cancer therapy: Challenges and strategies. Adv. Drug Deliv. Rev. 2015, 81, 128–141. [Google Scholar] [CrossRef]
  5. Havens, M.A.; Hastings, M.L. Splice-switching antisense oligonucleotides as therapeutic drugs. Nucleic Acids Res. 2016, 44, 6549–6563. [Google Scholar] [CrossRef]
  6. Lu, Q.L.; Mann, C.J.; Lou, F.; Bou-Gharios, G.; Morris, G.E.; Xue, S.-A.; Fletcher, S.; Partridge, T.A.; Wilton, S.D. Functional amounts of dystrophin produced by skipping the mutated exon in the mdx dystrophic mouse. Nat. Med. 2003, 9, 1009–1014. [Google Scholar] [CrossRef]
  7. Ottesen, E.W. ISS-N1 makes the first FDA-approved drug for spinal muscular atrophy. Transl. Neurosci. 2017, 8, 1–6. [Google Scholar] [CrossRef]
  8. Levin, A.A. Treating disease at the RNA level with oligonucleotides. N. Engl. J. Med. 2019, 380, 57–70. [Google Scholar] [CrossRef]
  9. Yin, H.; Song, C.-Q.; Dorkin, J.R.; Zhu, L.J.; Li, Y.; Wu, Q.; Park, A.; Yang, J.; Suresh, S.; Bizhanova, A. Therapeutic genome editing by combined viral and non-viral delivery of CRISPR system components in vivo. Nat. Biotechnol. 2016, 34, 328–333. [Google Scholar] [CrossRef]
  10. Ginn, S.L.; Amaya, A.K.; Alexander, I.E.; Edelstein, M.; Abedi, M.R. Gene therapy clinical trials worldwide to 2017: An update. J. Gene Med. 2018, 20, e3015. [Google Scholar] [CrossRef]
  11. Durymanov, M.; Reineke, J. Non-viral delivery of nucleic acids: Insight into mechanisms of overcoming intracellular barriers. Front. Pharmacol. 2018, 9, 971. [Google Scholar] [CrossRef] [PubMed]
  12. Lächelt, U.; Wagner, E. Nucleic acid therapeutics using polyplexes: A journey of 50 years (and beyond). Chem. Rev. 2015, 115, 11043–11078. [Google Scholar] [CrossRef] [PubMed]
  13. Hager, S.; Wagner, E. Bioresponsive polyplexes–chemically programmed for nucleic acid delivery. Expert Opin. Drug Deliv. 2018, 15, 1067–1083. [Google Scholar] [CrossRef] [PubMed]
  14. Felgner, P.; Barenholz, Y.; Behr, J.; Cheng, S.; Cullis, P.; Huang, L.; Jessee, J.; Seymour, L.; Szoka, F.; Thierry, A. Nomenclature for synthetic gene delivery systems. Hum. Gene Ther. 1997, 8, 511–512. [Google Scholar] [CrossRef] [PubMed]
  15. Luo, T.; Liang, H.; Jin, R.; Nie, Y. Virus-inspired and mimetic designs in non-viral gene delivery. J. Gene Med. 2019, 21, e3090. [Google Scholar] [CrossRef]
  16. Wang, Y.; Miao, L.; Satterlee, A.; Huang, L. Delivery of oligonucleotides with lipid nanoparticles. Adv. Drug Deliv. Rev. 2015, 87, 68–80. [Google Scholar] [CrossRef]
  17. Cabral, H.; Miyata, K.; Osada, K.; Kataoka, K. Block copolymer micelles in nanomedicine applications. Chem. Rev. 2018, 118, 6844–6892. [Google Scholar] [CrossRef]
  18. Bono, N.; Ponti, F.; Mantovani, D.; Candiani, G. Non-Viral in Vitro Gene Delivery: It is Now Time to Set the Bar! Pharmaceutics 2020, 12, 183. [Google Scholar] [CrossRef]
  19. Wahane, A.; Waghmode, A.; Kapphahn, A.; Dhuri, K.; Gupta, A.; Bahal, R. Role of Lipid-Based and Polymer-Based Non-Viral Vectors in Nucleic Acid Delivery for Next-Generation Gene Therapy. Molecules 2020, 25, 2866. [Google Scholar] [CrossRef]
  20. Yu, H.; Zou, Y.; Wang, Y.; Huang, X.; Huang, G.; Sumer, B.D.; Boothman, D.A.; Gao, J. Overcoming endosomal barrier by amphotericin B-loaded dual pH-responsive PDMA-b-PDPA micelleplexes for siRNA delivery. ACS Nano 2011, 5, 9246–9255. [Google Scholar] [CrossRef]
  21. Wang, W.; Saeed, M.; Zhou, Y.; Yang, L.; Wang, D.; Yu, H. Non-viral gene delivery for cancer immunotherapy. J. Gene Med. 2019, 21, e3092. [Google Scholar] [CrossRef]
  22. Liu, C.; Wan, T.; Wang, H.; Zhang, S.; Ping, Y.; Cheng, Y. A boronic acid–rich dendrimer with robust and unprecedented efficiency for cytosolic protein delivery and CRISPR-Cas9 gene editing. Sci. Adv. 2019, 5, eaaw8922. [Google Scholar] [CrossRef] [PubMed]
  23. Zhang, Z.; Wan, T.; Chen, Y.; Chen, Y.; Sun, H.; Cao, T.; Songyang, Z.; Tang, G.; Wu, C.; Ping, Y. Cationic polymer-mediated CRISPR/Cas9 plasmid delivery for genome editing. Macromol. Rapid Commun. 2019, 40, 1800068. [Google Scholar] [CrossRef] [PubMed]
  24. Li, Y.; Bai, H.; Wang, H.; Shen, Y.; Tang, G.; Ping, Y. Reactive oxygen species (ROS)-responsive nanomedicine for RNAi-based cancer therapy. Nanoscale 2018, 10, 203–214. [Google Scholar] [CrossRef] [PubMed]
  25. Lutz, J.-F. Sequence-controlled polymerizations: The next Holy Grail in polymer science? Polym. Chem. 2010, 1, 55–62. [Google Scholar] [CrossRef]
  26. Lutz, J.-F.; Ouchi, M.; Liu, D.R.; Sawamoto, M. Sequence-controlled polymers. Science 2013, 341. [Google Scholar] [CrossRef]
  27. Hartmann, L.; Häfele, S.; Peschka-Süss, R.; Antonietti, M.; Börner, H.G. Sequence positioning of disulfide linkages to program the degradation of monodisperse poly (amidoamines). Macromolecules 2007, 40, 7771–7776. [Google Scholar] [CrossRef]
  28. Boyer, C.; Bulmus, V.; Davis, T.P.; Ladmiral, V.; Liu, J.; Perrier, S. Bioapplications of RAFT polymerization. Chem. Rev. 2009, 109, 5402–5436. [Google Scholar] [CrossRef]
  29. Jiang, X.; Lok, M.C.; Hennink, W.E. Degradable-brushed pHEMA–pDMAEMA synthesized via ATRP and click chemistry for gene delivery. Bioconj. Chem. 2007, 18, 2077–2084. [Google Scholar] [CrossRef]
  30. Cheng, Y.; Yumul, R.C.; Pun, S.H. Virus-inspired polymer for efficient in vitro and in vivo gene delivery. Angew. Chem. Int. Ed. 2016, 55, 12013–12017. [Google Scholar] [CrossRef]
  31. Nuhn, L.; Kaps, L.; Diken, M.; Schuppan, D.; Zentel, R. Reductive decationizable block copolymers for stimuli-responsive mRNA delivery. Macromol. Rapid Commun. 2016, 37, 924–933. [Google Scholar] [CrossRef] [PubMed]
  32. Plank, C.; Tang, M.X.; Wolfe, A.R.; Szoka, F.C. Branched cationic peptides for gene delivery: Role of type and number of cationic residues in formation and in vitro activity of DNA polyplexes. Hum. Gene Ther. 1999, 10, 319–332. [Google Scholar] [CrossRef] [PubMed]
  33. Read, M.L.; Singh, S.; Ahmed, Z.; Stevenson, M.; Briggs, S.S.; Oupicky, D.; Barrett, L.B.; Spice, R.; Kendall, M.; Berry, M. A versatile reducible polycation-based system for efficient delivery of a broad range of nucleic acids. Nucleic Acids Res. 2005, 33, e86. [Google Scholar] [CrossRef]
  34. Plank, C.; Zatloukal, K.; Cotten, M.; Mechtler, K.; Wagner, E. Gene transfer into hepatocytes using asialoglycoprotein receptor mediated endocytosis of DNA complexed with an artificial tetra-antennary galactose ligand. Bioconj. Chem. 1992, 3, 533–539. [Google Scholar] [CrossRef] [PubMed]
  35. Neuberg, P.; Wagner, A.; Remy, J.-S.; Kichler, A. Design and evaluation of ionizable peptide amphiphiles for siRNA delivery. Int. J. Pharm. 2019, 566, 141–148. [Google Scholar] [CrossRef]
  36. Ohsaki, M.; Okuda, T.; Wada, A.; Hirayama, T.; Niidome, T.; Aoyagi, H. In vitro gene transfection using dendritic poly(l-lysine). Bioconj. Chem. 2002, 13, 510–517. [Google Scholar] [CrossRef] [PubMed]
  37. Wadhwa, M.S.; Collard, W.T.; Adami, R.C.; McKenzie, D.L.; Rice, K.G. Peptide-mediated gene delivery: Influence of peptide structure on gene expression. Bioconj. Chem. 1997, 8, 81–88. [Google Scholar] [CrossRef]
  38. McKenzie, D.L.; Kwok, K.Y.; Rice, K.G. A potent new class of reductively activated peptide gene delivery agents. J. Biol. Chem. 2000, 275, 9970–9977. [Google Scholar] [CrossRef]
  39. McKenzie, D.L.; Smiley, E.; Kwok, K.Y.; Rice, K.G. Low molecular weight disulfide cross-linking peptides as nonviral gene delivery carriers. Bioconj. Chem. 2000, 11, 901–909. [Google Scholar] [CrossRef]
  40. Kadlecova, Z.; Baldi, L.; Hacker, D.; Wurm, F.M.; Klok, H.-A. Comparative study on the in vitro cytotoxicity of linear, dendritic, and hyperbranched polylysine analogues. Biomacromolecules 2012, 13, 3127–3137. [Google Scholar] [CrossRef]
  41. Kawano, T.; Okuda, T.; Aoyagi, H.; Niidome, T. Long circulation of intravenously administered plasmid DNA delivered with dendritic poly(l-lysine) in the blood flow. J. Control. Release 2004, 99, 329–337. [Google Scholar] [CrossRef] [PubMed]
  42. Okuda, T.; Kawakami, S.; Akimoto, N.; Niidome, T.; Yamashita, F.; Hashida, M. PEGylated lysine dendrimers for tumor-selective targeting after intravenous injection in tumor-bearing mice. J. Control. Release 2006, 116, 330–336. [Google Scholar] [CrossRef] [PubMed]
  43. Okuda, T.; Kawakami, S.; Maeie, T.; Niidome, T.; Yamashita, F.; Hashida, M. Biodistribution characteristics of amino acid dendrimers and their PEGylated derivatives after intravenous administration. J. Control. Release 2006, 114, 69–77. [Google Scholar] [CrossRef] [PubMed]
  44. Okuda, T.; Sugiyama, A.; Niidome, T.; Aoyagi, H. Characters of dendritic poly(l-lysine) analogues with the terminal lysines replaced with arginines and histidines as gene carriers in vitro. Biomaterials 2004, 25, 537–544. [Google Scholar] [CrossRef]
  45. Chen, Q.-R.; Zhang, L.; Luther, P.W.; Mixson, A.J. Optimal transfection with the HK polymer depends on its degree of branching and the pH of endocytic vesicles. Nucleic Acids Res. 2002, 30, 1338–1345. [Google Scholar] [CrossRef]
  46. Leng, Q.; Mixson, A.J. Modified branched peptides with a histidine-rich tail enhance in vitro gene transfection. Nucleic Acids Res. 2005, 33, e40. [Google Scholar] [CrossRef]
  47. Leng, Q.; Scaria, P.; Zhu, J.; Ambulos, N.; Campbell, P.; Mixson, A.J. Highly branched HK peptides are effective carriers of siRNA. J. Gene Med. 2005, 7, 977–986. [Google Scholar] [CrossRef]
  48. Leng, Q.; Mixson, A.J. Small interfering RNA targeting Raf-1 inhibits tumor growth in vitro and in vivo. Cancer Gene Ther. 2005, 12, 682–690. [Google Scholar] [CrossRef]
  49. Leng, Q.; Chou, S.T.; Scaria, P.V.; Woodle, M.C.; Mixson, A.J. Increased tumor distribution and expression of histidine-rich plasmid polyplexes. J. Gene Med. 2014, 16, 317–328. [Google Scholar] [CrossRef]
  50. Leng, Q.; Mixson, A.J. The neuropilin-1 receptor mediates enhanced tumor delivery of H2K polyplexes. J. Gene Med. 2016, 18, 134–144. [Google Scholar] [CrossRef]
  51. Chen, Q.; Zhang, L.; Stass, S.; Mixson, A. Co-polymer of histidine and lysine markedly enhances transfection efficiency of liposomes. Gene Ther. 2000, 7, 1698–1705. [Google Scholar] [CrossRef] [PubMed]
  52. Chen, Q.-R.; Zhang, L.; Stass, S.A.; Mixson, A.J. Branched co-polymers of histidine and lysine are efficient carriers of plasmids. Nucleic Acids Res. 2001, 29, 1334–1340. [Google Scholar] [CrossRef] [PubMed]
  53. Leng, Q.; Scaria, P.; Lu, P.; Woodle, M.C.; Mixson, A.J. Systemic delivery of HK Raf-1 siRNA polyplexes inhibits MDA-MB-435 xenografts. Cancer Gene Ther. 2008, 15, 485–495. [Google Scholar] [CrossRef] [PubMed]
  54. Chou, S.-T.; Leng, Q.; Scaria, P.; Kahn, J.D.; Tricoli, L.J.; Woodle, M.; Mixson, A.J. Surface-modified HK: siRNA nanoplexes with enhanced pharmacokinetics and tumor growth inhibition. Biomacromolecules 2013, 14, 752–760. [Google Scholar] [CrossRef] [PubMed]
  55. Nishimura, Y.; Takeda, K.; Ezawa, R.; Ishii, J.; Ogino, C.; Kondo, A. A display of pH-sensitive fusogenic GALA peptide facilitates endosomal escape from a Bio-nanocapsule via an endocytic uptake pathway. J. Nanobiotechnol. 2014, 12, 11. [Google Scholar] [CrossRef] [PubMed]
  56. Cleal, K.; He, L.; Watson, P.D.; Jones, A.T. Endocytosis, intracellular traffic and fate of cell penetrating peptide based conjugates and nanoparticles. Curr. Pharm. Des. 2013, 19, 2878–2894. [Google Scholar] [CrossRef]
  57. Subbarao, N.K.; Parente, R.A.; Szoka, F.C.; Nadasdi, L.; Pongracz, K. The pH-dependent bilayer destabilization by an amphipathic peptide. Biochemistry 1987, 26, 2964–2972. [Google Scholar] [CrossRef]
  58. Wyman, T.B.; Nicol, F.; Zelphati, O.; Scaria, P.; Plank, C.; Szoka, F.C. Design, synthesis, and characterization of a cationic peptide that binds to nucleic acids and permeabilizes bilayers. Biochemistry 1997, 36, 3008–3017. [Google Scholar] [CrossRef]
  59. McCarthy, H.O.; McCaffrey, J.; McCrudden, C.M.; Zholobenko, A.; Ali, A.A.; McBride, J.W.; Massey, A.S.; Pentlavalli, S.; Chen, K.-H.; Cole, G. Development and characterization of self-assembling nanoparticles using a bio-inspired amphipathic peptide for gene delivery. J. Control. Release 2014, 189, 141–149. [Google Scholar] [CrossRef]
  60. Bennett, R.; Yakkundi, A.; McKeen, H.D.; McClements, L.; McKeogh, T.J.; McCrudden, C.M.; Arthur, K.; Robson, T.; McCarthy, H.O. RALA-mediated delivery of FKBPL nucleic acid therapeutics. Nanomedicine 2015, 10, 2989–3001. [Google Scholar] [CrossRef]
  61. Udhayakumar, V.K.; De Beuckelaer, A.; McCaffrey, J.; McCrudden, C.M.; Kirschman, J.L.; Vanover, D.; Van Hoecke, L.; Roose, K.; Deswarte, K.; De Geest, B.G. Arginine-rich peptide-based mRNA nanocomplexes efficiently instigate cytotoxic t cell immunity dependent on the amphipathic organization of the peptide. Adv. Healthc. Mater. 2017, 6, 1601412. [Google Scholar] [CrossRef] [PubMed]
  62. Mäe, M.; Andaloussi, S.E.; Lundin, P.; Oskolkov, N.; Johansson, H.J.; Guterstam, P.; Langel, Ü. A stearylated CPP for delivery of splice correcting oligonucleotides using a non-covalent co-incubation strategy. J. Control. Release 2009, 134, 221–227. [Google Scholar] [CrossRef]
  63. Lehto, T.; Simonson, O.E.; Mäger, I.; Ezzat, K.; Sork, H.; Copolovici, D.-M.; Viola, J.R.; Zaghloul, E.M.; Lundin, P.; Moreno, P.M. A peptide-based vector for efficient gene transfer in vitro and in vivo. Mol. Ther. 2011, 19, 1457–1467. [Google Scholar] [CrossRef] [PubMed]
  64. EL Andaloussi, S.; Lehto, T.; Mäger, I.; Rosenthal-Aizman, K.; Oprea, I.I.; Simonson, O.E.; Sork, H.; Ezzat, K.; Copolovici, D.M.; Kurrikoff, K. Design of a peptide-based vector, PepFect6, for efficient delivery of siRNA in cell culture and systemically in vivo. Nucleic Acids Res. 2011, 39, 3972–3987. [Google Scholar] [CrossRef]
  65. Veiman, K.L.; Mäger, I.; Ezzat, K.; Margus, H.; Lehto, T.; Langel, K.; Kurrikoff, K.; Arukuusk, P.; Suhorutšenko, J.; Padari, K.; et al. PepFect14 peptide vector for efficient gene delivery in cell cultures. Mol. Pharm. 2013, 10, 199–210. [Google Scholar] [CrossRef] [PubMed]
  66. Oskolkov, N.; Arukuusk, P.; Copolovici, D.-M.; Lindberg, S.; Margus, H.; Padari, K.; Pooga, M.; Langel, Ü. NickFects, phosphorylated derivatives of transportan 10 for cellular delivery of oligonucleotides. Int. J. Pept. Res. Ther. 2011, 17, 147. [Google Scholar] [CrossRef]
  67. Arukuusk, P.; Pärnaste, L.; Margus, H.; Eriksson, N.K.; Vasconcelos, L.; Padari, K.; Pooga, M.; Langel, U. Differential endosomal pathways for radically modified peptide vectors. Bioconj. Chem. 2013, 24, 1721–1732. [Google Scholar] [CrossRef]
  68. Arukuusk, P.; Pärnaste, L.; Oskolkov, N.; Copolovici, D.M.; Margus, H.; Padari, K.; Möll, K.; Maslovskaja, J.; Tegova, R.; Kivi, G.; et al. New generation of efficient peptide-based vectors, NickFects, for the delivery of nucleic acids. Biochim. Biophys. Acta 2013, 1828, 1365–1373. [Google Scholar] [CrossRef]
  69. Freimann, K.; Arukuusk, P.; Kurrikoff, K.; Vasconcelos, L.D.F.; Veiman, K.L.; Uusna, J.; Margus, H.; Garcia-Sosa, A.T.; Pooga, M.; Langel, Ü. Optimization of in vivo DNA delivery with NickFect peptide vectors. J. Control. Release 2016, 241, 135–143. [Google Scholar] [CrossRef]
  70. Fominaya, J.; Gasset, M.; García, R.; Roncal, F.; Pablo Albar, J.; Bernad, A. An optimized amphiphilic cationic peptide as an efficient non-viral gene delivery vector. J. Gene Med. 2000, 2, 455–464. [Google Scholar] [CrossRef]
  71. Ezzat, K.; EL Andaloussi, S.; Zaghloul, E.M.; Lehto, T.; Lindberg, S.; Moreno, P.M.; Viola, J.R.; Magdy, T.; Abdo, R.; Guterstam, P. PepFect 14, a novel cell-penetrating peptide for oligonucleotide delivery in solution and as solid formulation. Nucleic Acids Res. 2011, 39, 5284–5298. [Google Scholar] [CrossRef] [PubMed]
  72. Ezzat, K.; Zaghloul, E.M.; Andaloussi, S.E.; Lehto, T.; El-Sayed, R.; Magdy, T.; Smith, C.E.; Langel, Ü. Solid formulation of cell-penetrating peptide nanocomplexes with siRNA and their stability in simulated gastric conditions. J. Control. Release 2012, 162, 1–8. [Google Scholar] [CrossRef] [PubMed]
  73. Hamley, I.W. Peptide nanotubes. Angew. Chem. Int. Ed. 2014, 53, 6866–6881. [Google Scholar] [CrossRef] [PubMed]
  74. Hartgerink, J.D.; Beniash, E.; Stupp, S.I. Self-assembly and mineralization of peptide-amphiphile nanofibers. Science 2001, 294, 1684–1688. [Google Scholar] [CrossRef]
  75. Hartgerink, J.D.; Beniash, E.; Stupp, S.I. Peptide-amphiphile nanofibers: A versatile scaffold for the preparation of self-assembling materials. Proc. Natl. Acad. Sci. USA 2002, 99, 5133–5138. [Google Scholar] [CrossRef]
  76. Cui, H.; Webber, M.J.; Stupp, S.I. Self-assembly of peptide amphiphiles: From molecules to nanostructures to biomaterials. Biopolymers 2010, 94, 1–18. [Google Scholar] [CrossRef]
  77. Hendricks, M.P.; Sato, K.; Palmer, L.C.; Stupp, S.I. Supramolecular assembly of peptide amphiphiles. Acc. Chem. Res. 2017, 50, 2440–2448. [Google Scholar] [CrossRef]
  78. Da Silva, R.M.; Van Der Zwaag, D.; Albertazzi, L.; Lee, S.S.; Meijer, E.; Stupp, S.I. Super-resolution microscopy reveals structural diversity in molecular exchange among peptide amphiphile nanofibres. Nat. Commun. 2016, 7, 1–10. [Google Scholar] [CrossRef]
  79. Lim, Y.b.; Lee, E.; Yoon, Y.R.; Lee, M.S.; Lee, M. Filamentous artificial virus from a self-assembled discrete nanoribbon. Angew. Chem. Int. Ed. 2008, 47, 4525–4528. [Google Scholar] [CrossRef]
  80. Ni, R.; Chau, Y. Structural mimics of viruses through peptide/DNA co-assembly. J. Am. Chem. Soc. 2014, 136, 17902–17905. [Google Scholar] [CrossRef]
  81. Ruff, Y.; Moyer, T.; Newcomb, C.J.; Demeler, B.; Stupp, S.I. Precision templating with DNA of a virus-like particle with peptide nanostructures. J. Am. Chem. Soc. 2013, 135, 6211–6219. [Google Scholar] [CrossRef] [PubMed]
  82. Hernandez-Garcia, A.; Kraft, D.J.; Janssen, A.F.; Bomans, P.H.; Sommerdijk, N.A.; Thies-Weesie, D.M.; Favretto, M.E.; Brock, R.; De Wolf, F.A.; Werten, M.W. Design and self-assembly of simple coat proteins for artificial viruses. Nat. Nanotechnol. 2014, 9, 698–702. [Google Scholar] [CrossRef] [PubMed]
  83. Jekhmane, S.; De Haas, R.; Paulino da Silva Filho, O.; van Asbeck, A.H.; Favretto, M.E.; Hernandez Garcia, A.; Brock, R.; De Vries, R. Virus-like particles of mRNA with artificial minimal coat proteins: Particle formation, stability, and transfection efficiency. Nucleic Acid Ther. 2017, 27, 159–167. [Google Scholar] [CrossRef] [PubMed]
  84. Ni, R.; Chau, Y. Tuning the inter-nanofibril interaction to regulate the morphology and function of peptide/DNA co-assembled viral mimics. Angew. Chem. Int. Ed. 2017, 56, 9356–9360. [Google Scholar] [CrossRef] [PubMed]
  85. Ni, R.; Chau, Y. Nanoassembly of Oligopeptides and DNA Mimics the Sequential Disassembly of a Spherical Virus. Angew. Chem. Int. Ed. 2020, 59, 3578–3584. [Google Scholar] [CrossRef]
  86. Serrano, C.M.; Freeman, R.; Godbe, J.; Lewis, J.A.; Stupp, S.I. DNA-Peptide Amphiphile Nanofibers Enhance Aptamer Function. ACS Appl. Bio Mater. 2019, 2, 2955–2963. [Google Scholar] [CrossRef]
  87. Ryter, J.M.; Schultz, S.C. Molecular basis of double-stranded RNA-protein interactions: Structure of a dsRNA-binding domain complexed with dsRNA. EMBO J. 1998, 17, 7505–7513. [Google Scholar] [CrossRef]
  88. Wang, X.; Bergenfeld, I.; Arora, P.S.; Canary, J.W. Reversible redox reconfiguration of secondary structures in a designed peptide. Angew. Chem. Int. Ed. 2012, 124, 12265–12267. [Google Scholar] [CrossRef]
  89. Hernandez-Garcia, A.; Álvarez, Z.; Simkin, D.; Madhan, A.; Pariset, E.; Tantakitti, F.; de Vargas-Dorantes, O.J.; Lee, S.S.; Kiskinis, E.; Stupp, S.I. Peptide–siRNA Supramolecular Particles for Neural Cell Transfection. Adv. Sci. 2019, 6, 1801458. [Google Scholar] [CrossRef]
  90. Malamas, A.S.; Gujrati, M.; Kummitha, C.M.; Xu, R.; Lu, Z.R. Design and evaluation of new pH-sensitive amphiphilic cationic lipids for siRNA delivery. J. Control. Release 2013, 171, 296–307. [Google Scholar] [CrossRef]
  91. Wang, X.L.; Ramusovic, S.; Nguyen, T.; Lu, Z.R. Novel polymerizable surfactants with pH-sensitive amphiphilicity and cell membrane disruption for efficient siRNA delivery. Bioconj. Chem. 2007, 18, 2169–2177. [Google Scholar] [CrossRef]
  92. Wang, X.L.; Jensen, R.; Lu, Z.R. A novel environment-sensitive biodegradable polydisulfide with protonatable pendants for nucleic acid delivery. J. Control. Release 2007, 120, 250–258. [Google Scholar] [CrossRef]
  93. Xu, R.; Wang, X.L.; Lu, Z.R. New amphiphilic carriers forming pH-sensitive nanoparticles for nucleic acid delivery. Langmuir 2010, 26, 13874–13882. [Google Scholar] [CrossRef]
  94. Sun, D.; Sahu, B.; Gao, S.; Schur, R.M.; Vaidya, A.M.; Maeda, A.; Palczewski, K.; Lu, Z.R. Targeted Multifunctional Lipid ECO Plasmid DNA Nanoparticles as Efficient Non-viral Gene Therapy for Leber’s Congenital Amaurosis. Mol. Ther. Nucleic Acids 2017, 7, 42–52. [Google Scholar] [CrossRef] [PubMed]
  95. Sun, D.; Schur, R.M.; Sears, A.E.; Gao, S.-Q.; Sun, W.; Naderi, A.; Kern, T.; Palczewski, K.; Lu, Z.-R. Stable Retinoid Analogue Targeted Dual pH-Sensitive Smart Lipid ECO/pDNA Nanoparticles for Specific Gene Delivery in the Retinal Pigment Epithelium. ACS Appl. Bio Mater. 2020, 3, 3078–3086. [Google Scholar] [CrossRef]
  96. Sun, D.; Schur, R.M.; Sears, A.E.; Gao, S.Q.; Vaidya, A.; Sun, W.; Maeda, A.; Kern, T.; Palczewski, K.; Lu, Z.R. Non-viral Gene Therapy for Stargardt Disease with ECO/pRHO-ABCA4 Self-Assembled Nanoparticles. Mol. Ther. 2020, 28, 293–303. [Google Scholar] [CrossRef] [PubMed]
  97. Parvani, J.G.; Gujrati, M.D.; Mack, M.A.; Schiemann, W.P.; Lu, Z.R. Silencing β3 Integrin by Targeted ECO/siRNA Nanoparticles Inhibits EMT and Metastasis of Triple-Negative Breast Cancer. Cancer Res. 2015, 75, 2316–2325. [Google Scholar] [CrossRef]
  98. Vaidya, A.M.; Sun, Z.; Ayat, N.; Schilb, A.; Liu, X.; Jiang, H.; Sun, D.; Scheidt, J.; Qian, V.; He, S. Systemic delivery of tumor-targeting siRNA nanoparticles against an oncogenic LncRNA facilitates effective triple-negative breast cancer therapy. Bioconj. Chem. 2019, 30, 907–919. [Google Scholar] [CrossRef]
  99. Hartmann, L.; Krause, E.; Antonietti, M.; Börner, H.G. Solid-phase supported polymer synthesis of sequence-defined, multifunctional poly(amidoamines). Biomacromolecules 2006, 7, 1239–1244. [Google Scholar] [CrossRef]
  100. Hartmann, L.; Häfele, S.; Peschka-Süss, R.; Antonietti, M.; Börner, H.G. Tailor-made poly(amidoamine)s for controlled complexation and condensation of DNA. Chem. A Eur. J. 2008, 14, 2025–2033. [Google Scholar] [CrossRef]
  101. Hill, S.A.; Gerke, C.; Hartmann, L. Recent Developments in Solid-Phase Strategies towards Synthetic, Sequence-Defined Macromolecules. Chem. Asian J. 2018, 13, 3611–3622. [Google Scholar] [CrossRef] [PubMed]
  102. Salcher, E.E.; Kos, P.; Fröhlich, T.; Badgujar, N.; Scheible, M.; Wagner, E. Sequence-defined four-arm oligo(ethanamino)amides for pDNA and siRNA delivery: Impact of building blocks on efficacy. J. Control. Release 2012, 164, 380–386. [Google Scholar] [CrossRef] [PubMed]
  103. Schaffert, D.; Badgujar, N.; Wagner, E. Novel Fmoc-polyamino acids for solid-phase synthesis of defined polyamidoamines. Org. Lett. 2011, 13, 1586–1589. [Google Scholar] [CrossRef] [PubMed]
  104. Boussif, O.; Lezoualc’h, F.; Zanta, M.A.; Mergny, M.D.; Scherman, D.; Demeneix, B.; Behr, J.-P. A versatile vector for gene and oligonucleotide transfer into cells in culture and in vivo: Polyethylenimine. Proc. Natl. Acad. Sci. USA 1995, 92, 7297–7301. [Google Scholar] [CrossRef]
  105. Wightman, L.; Kircheis, R.; Rössler, V.; Carotta, S.; Ruzicka, R.; Kursa, M.; Wagner, E. Different behavior of branched and linear polyethylenimine for gene delivery in vitro and in vivo. J. Gene Med. 2001, 3, 362–372. [Google Scholar] [CrossRef]
  106. Scholz, C.; Kos, P.; Leclercq, L.; Jin, X.; Cottet, H.; Wagner, E. Correlation of length of linear oligo(ethanamino) amides with gene transfer and cytotoxicity. ChemMedChem 2014, 9, 2104–2110. [Google Scholar] [CrossRef]
  107. Schaffert, D.; Troiber, C.; Salcher, E.E.; Fröhlich, T.; Martin, I.; Badgujar, N.; Dohmen, C.; Edinger, D.; Kläger, R.; Maiwald, G.; et al. Solid-phase synthesis of sequence-defined T-, i-, and U-shape polymers for pDNA and siRNA delivery. Angew. Chem. Int. Ed. 2011, 50, 8986–8989. [Google Scholar] [CrossRef]
  108. Fröhlich, T.; Edinger, D.; Kläger, R.; Troiber, C.; Salcher, E.; Badgujar, N.; Martin, I.; Schaffert, D.; Cengizeroglu, A.; Hadwiger, P.; et al. Structure-activity relationships of siRNA carriers based on sequence-defined oligo (ethane amino) amides. J. Control. Release 2012, 160, 532–541. [Google Scholar] [CrossRef]
  109. Lächelt, U.; Kos, P.; Mickler, F.M.; Herrmann, A.; Salcher, E.E.; Rödl, W.; Badgujar, N.; Bräuchle, C.; Wagner, E. Fine-tuning of proton sponges by precise diaminoethanes and histidines in pDNA polyplexes. Nanomedicine 2014, 10, 35–44. [Google Scholar] [CrossRef]
  110. Scholz, C.; Kos, P.; Wagner, E. Comb-like oligoaminoethane carriers: Change in topology improves pDNA delivery. Bioconj. Chem. 2014, 25, 251–261. [Google Scholar] [CrossRef]
  111. Schaffert, D.; Troiber, C.; Wagner, E. New sequence-defined polyaminoamides with tailored endosomolytic properties for plasmid DNA delivery. Bioconj. Chem. 2012, 23, 1157–1165. [Google Scholar] [CrossRef] [PubMed]
  112. Troiber, C.; Edinger, D.; Kos, P.; Schreiner, L.; Kläger, R.; Herrmann, A.; Wagner, E. Stabilizing effect of tyrosine trimers on pDNA and siRNA polyplexes. Biomaterials 2013, 34, 1624–1633. [Google Scholar] [CrossRef] [PubMed]
  113. He, D.; Müller, K.; Krhac Levacic, A.; Kos, P.; Lächelt, U.; Wagner, E. Combinatorial Optimization of Sequence-Defined Oligo(ethanamino)amides for Folate Receptor-Targeted pDNA and siRNA Delivery. Bioconj. Chem. 2016, 27, 647–659. [Google Scholar] [CrossRef] [PubMed]
  114. Urnauer, S.; Morys, S.; Krhac Levacic, A.; Müller, A.M.; Schug, C.; Schmohl, K.A.; Schwenk, N.; Zach, C.; Carlsen, J.; Bartenstein, P.; et al. Sequence-defined cMET/HGFR-targeted Polymers as Gene Delivery Vehicles for the Theranostic Sodium Iodide Symporter (NIS) Gene. Mol. Ther. 2016, 24, 1395–1404. [Google Scholar] [CrossRef]
  115. Kos, P.; Lächelt, U.; Herrmann, A.; Mickler, F.M.; Döblinger, M.; He, D.; Krhač Levačić, A.; Morys, S.; Bräuchle, C.; Wagner, E. Histidine-rich stabilized polyplexes for cMet-directed tumor-targeted gene transfer. Nanoscale 2015, 7, 5350–5362. [Google Scholar] [CrossRef]
  116. Morys, S.; Krhac Levacic, A.; Urnauer, S.; Kempter, S.; Kern, S.; Rädler, J.O.; Spitzweg, C.; Lächelt, U.; Wagner, E. Influence of Defined Hydrophilic Blocks within Oligoaminoamide Copolymers: Compaction versus Shielding of pDNA Nanoparticles. Polymers 2017, 9, 142. [Google Scholar] [CrossRef]
  117. Hatakeyama, H.; Akita, H.; Harashima, H. A multifunctional envelope type nano device (MEND) for gene delivery to tumours based on the EPR effect: A strategy for overcoming the PEG dilemma. Adv. Drug Deliv. Rev. 2011, 63, 152–160. [Google Scholar] [CrossRef]
  118. Walker, G.F.; Fella, C.; Pelisek, J.; Fahrmeir, J.; Boeckle, S.; Ogris, M.; Wagner, E. Toward synthetic viruses: Endosomal pH-triggered deshielding of targeted polyplexes greatly enhances gene transfer in vitro and in vivo. Mol. Ther. 2005, 11, 418–425. [Google Scholar] [CrossRef]
  119. Knorr, V.; Allmendinger, L.; Walker, G.F.; Paintner, F.F.; Wagner, E. An acetal-based PEGylation reagent for pH-sensitive shielding of DNA polyplexes. Bioconj. Chem. 2007, 18, 1218–1225. [Google Scholar] [CrossRef]
  120. Williford, J.-M.; Archang, M.M.; Minn, I.; Ren, Y.; Wo, M.; Vandermark, J.; Fisher, P.B.; Pomper, M.G.; Mao, H.-Q. Critical length of PEG grafts on lPEI/DNA nanoparticles for efficient in vivo delivery. ACS Biomater. Sci. Eng. 2016, 2, 567–578. [Google Scholar] [CrossRef]
  121. Klein, P.M.; Reinhard, S.; Lee, D.-J.; Müller, K.; Ponader, D.; Hartmann, L.; Wagner, E. Precise redox-sensitive cleavage sites for improved bioactivity of siRNA lipopolyplexes. Nanoscale 2016, 8, 18098–18104. [Google Scholar] [CrossRef] [PubMed]
  122. Reinhard, S.; Wang, Y.; Dengler, S.; Wagner, E. Precise Enzymatic Cleavage Sites for Improved Bioactivity of siRNA Lipo-Polyplexes. Bioconj. Chem. 2018, 29, 3649–3657. [Google Scholar] [CrossRef] [PubMed]
  123. Hoy, S.M. Patisiran: First global approval. Drugs 2018, 78, 1625–1631. [Google Scholar] [CrossRef] [PubMed]
  124. Scott, L.J. Givosiran: First Approval. Drugs 2020, 80, 335–339. [Google Scholar] [CrossRef] [PubMed]
  125. Stein, C.A.; Castanotto, D. FDA-approved oligonucleotide therapies in 2017. Mol. Ther. 2017, 25, 1069–1075. [Google Scholar] [CrossRef] [PubMed]
  126. Klein, P.M.; Müller, K.; Gutmann, C.; Kos, P.; Levacic, A.K.; Edinger, D.; Höhn, M.; Leroux, J.-C.; Gauthier, M.A.; Wagner, E. Twin disulfides as opportunity for improving stability and transfection efficiency of oligoaminoethane polyplexes. J. Control. Release 2015, 205, 109–119. [Google Scholar] [CrossRef]
  127. Luo, J.; Höhn, M.; Reinhard, S.; Loy, D.M.; Klein, P.M.; Wagner, E. IL4-Receptor-Targeted Dual Antitumoral Apoptotic Peptide—siRNA Conjugate Lipoplexes. Adv. Funct. Mater. 2019, 29, 1900697. [Google Scholar] [CrossRef]
  128. Wang, Y.; Luo, J.; Truebenbach, I.; Reinhard, S.; Klein, P.M.; Höhn, M.; Kern, S.; Morys, S.; Loy, D.M.; Wagner, E.; et al. Double Click-Functionalized siRNA Polyplexes for Gene Silencing in Epidermal Growth Factor Receptor-Positive Tumor Cells. ACS Biomater. Sci. Eng. 2020, 6, 1074–1089. [Google Scholar] [CrossRef]
  129. Zarei, A.; Razban, V.; Hosseini, S.E.; Tabei, S.M.B. Creating cell and animal models of human disease by genome editing using CRISPR/Cas9. J. Gene Med. 2019, 21, e3082. [Google Scholar] [CrossRef]
  130. Xu, X.; Wan, T.; Xin, H.; Li, D.; Pan, H.; Wu, J.; Ping, Y. Delivery of CRISPR/Cas9 for therapeutic genome editing. J. Gene Med. 2019, 21, e3107. [Google Scholar] [CrossRef]
  131. Kang, Y.K.; Kwon, K.; Ryu, J.S.; Lee, H.N.; Park, C.; Chung, H.J. Nonviral genome editing based on a polymer-derivatized CRISPR nanocomplex for targeting bacterial pathogens and antibiotic resistance. Bioconj. Chem. 2017, 28, 957–967. [Google Scholar] [CrossRef] [PubMed]
  132. Zhang, H.-X.; Zhang, Y.; Yin, H. Genome editing with mRNA encoding ZFN, TALEN, and Cas9. Mol. Ther. 2019, 27, 735–746. [Google Scholar] [CrossRef] [PubMed]
  133. Sun, D.; Sun, Z.; Jiang, H.; Vaidya, A.M.; Xin, R.; Ayat, N.R.; Schilb, A.L.; Qiao, P.L.; Han, Z.; Naderi, A. Synthesis and evaluation of pH-sensitive multifunctional lipids for efficient delivery of CRISPR/Cas9 in gene editing. Bioconj. Chem. 2018, 30, 667–678. [Google Scholar] [CrossRef] [PubMed]
  134. Kuhn, J.; Lin, Y.; Krhac Levacic, A.; Al Danaf, N.; Peng, L.; Höhn, M.; Lamb, D.C.; Wagner, E.; Lächelt, U. Delivery of Cas9/sgRNA ribonucleoprotein complexes via hydroxystearyl oligoamino amides. Bioconj. Chem. 2020, 31, 729–742. [Google Scholar] [CrossRef]
  135. Kuhn, J.; Klein, P.M.; Al Danaf, N.; Nordin, J.Z.; Reinhard, S.; Loy, D.M.; Höhn, M.; El Andaloussi, S.; Lamb, D.C.; Wagner, E. Supramolecular Assembly of Aminoethylene-Lipopeptide PMO Conjugates into RNA Splice-Switching Nanomicelles. Adv. Funct. Mater. 2019, 29, 1906432. [Google Scholar] [CrossRef]
  136. Abuchowski, A.; McCoy, J.R.; Palczuk, N.C.; van Es, T.; Davis, F.F. Effect of covalent attachment of polyethylene glycol on immunogenicity and circulating life of bovine liver catalase. J. Biol. Chem. 1977, 252, 3582–3586. [Google Scholar]
  137. Jiang, G.; Park, K.; Kim, J.; Kim, K.S.; Oh, E.J.; Kang, H.; Han, S.E.; Oh, Y.K.; Park, T.G.; Kwang Hahn, S. Hyaluronic acid–polyethyleneimine conjugate for target specific intracellular delivery of siRNA. Biopolymers 2008, 89, 635–642. [Google Scholar] [CrossRef]
  138. Kursa, M.; Walker, G.F.; Roessler, V.; Ogris, M.; Roedl, W.; Kircheis, R.; Wagner, E. Novel shielded transferrin−polyethylene glycol−polyethylenimine/DNA complexes for systemic tumor-targeted gene transfer. Bioconj. Chem. 2003, 14, 222–231. [Google Scholar] [CrossRef]
  139. Schaffert, D.; Kiss, M.; Rödl, W.; Shir, A.; Levitzki, A.; Ogris, M.; Wagner, E. Poly(I:C)-mediated tumor growth suppression in EGF-receptor overexpressing tumors using EGF-polyethylene glycol-linear polyethylenimine as carrier. Pharm. Res. 2011, 28, 731–741. [Google Scholar] [CrossRef]
  140. Dohmen, C.; Edinger, D.; Fröhlich, T.; Schreiner, L.; Lächelt, U.; Troiber, C.; Rädler, J.; Hadwiger, P.; Vornlocher, H.P.; Wagner, E. Nanosized multifunctional polyplexes for receptor-mediated siRNA delivery. ACS Nano 2012, 6, 5198–5208. [Google Scholar] [CrossRef]
  141. Maeda, H. The enhanced permeability and retention (EPR) effect in tumor vasculature: The key role of tumor-selective macromolecular drug targeting. Adv. Enzym. Regul. 2001, 41, 189–207. [Google Scholar] [CrossRef]
  142. Sindhwani, S.; Syed, A.M.; Ngai, J.; Kingston, B.R.; Maiorino, L.; Rothschild, J.; MacMillan, P.; Zhang, Y.; Rajesh, N.U.; Hoang, T. The entry of nanoparticles into solid tumours. Nat. Mater. 2020, 19, 566–575. [Google Scholar] [CrossRef] [PubMed]
  143. Kos, P.; Lächelt, U.; He, D.; Nie, Y.; Gu, Z.; Wagner, E. Dual-targeted polyplexes based on sequence-defined peptide-PEG-oligoamino amides. J. Pharm. Sci. 2015, 104, 464–475. [Google Scholar] [CrossRef] [PubMed]
  144. Lächelt, U.; Wittmann, V.; Müller, K.; Edinger, D.; Kos, P.; Höhn, M.; Wagner, E. Synthetic polyglutamylation of dual-functional MTX ligands for enhanced combined cytotoxicity of poly(I:C) nanoplexes. Mol. Pharm. 2014, 11, 2631–2639. [Google Scholar] [CrossRef] [PubMed]
  145. Wang, S.; Reinhard, S.; Li, C.; Qian, M.; Jiang, H.; Du, Y.; Lächelt, U.; Lu, W.; Wagner, E.; Huang, R. Antitumoral Cascade-Targeting Ligand for IL-6 Receptor-Mediated Gene Delivery to Glioma. Mol. Ther. 2017, 25, 1556–1566. [Google Scholar] [CrossRef]
  146. Lee, D.J.; Kessel, E.; Edinger, D.; He, D.; Klein, P.M.; Voith von Voithenberg, L.; Lamb, D.C.; Lächelt, U.; Lehto, T.; Wagner, E. Dual antitumoral potency of EG5 siRNA nanoplexes armed with cytotoxic bifunctional glutamyl-methotrexate targeting ligand. Biomaterials 2016, 77, 98–110. [Google Scholar] [CrossRef]
  147. Dohmen, C.; Fröhlich, T.; Lächelt, U.; Röhl, I.; Vornlocher, H.P.; Hadwiger, P.; Wagner, E. Defined Folate-PEG-siRNA Conjugates for Receptor-specific Gene Silencing. Mol. Ther. Nucleic Acids 2012, 1, e7. [Google Scholar] [CrossRef]
  148. Plank, C.; Oberhauser, B.; Mechtler, K.; Koch, C.; Wagner, E. The influence of endosome-disruptive peptides on gene transfer using synthetic virus-like gene transfer systems. J. Biol. Chem. 1994, 269, 12918–12924. [Google Scholar]
  149. Mechtler, K.; Wagner, E. Gene transfer mediated by influenza virus peptides: The role of peptide sequences. New J. Chem. 1997, 21, 105–111. [Google Scholar]
  150. Lee, D.J.; He, D.; Kessel, E.; Padari, K.; Kempter, S.; Lächelt, U.; Rädler, J.O.; Pooga, M.; Wagner, E. Tumoral gene silencing by receptor-targeted combinatorial siRNA polyplexes. J. Control. Release 2016, 244, 280–291. [Google Scholar] [CrossRef]
  151. Lee, D.-J.; Kessel, E.; Lehto, T.; Liu, X.; Yoshinaga, N.; Padari, K.; Chen, Y.-C.; Kempter, S.; Uchida, S.; Rädler, J.O. Systemic delivery of folate-PEG siRNA lipopolyplexes with enhanced intracellular stability for in vivo gene silencing in leukemia. Bioconj. Chem. 2017, 28, 2393–2409. [Google Scholar] [CrossRef] [PubMed]
  152. Zhang, W.; Müller, K.; Kessel, E.; Reinhard, S.; He, D.; Klein, P.M.; Höhn, M.; Rödl, W.; Kempter, S.; Wagner, E. Targeted siRNA Delivery Using a Lipo-Oligoaminoamide Nanocore with an Influenza Peptide and Transferrin Shell. Adv. Healthc. Mater. 2016, 5, 1493–1504. [Google Scholar] [CrossRef] [PubMed]
  153. Steinborn, B.; Truebenbach, I.; Morys, S.; Lächelt, U.; Wagner, E.; Zhang, W. Epidermal growth factor receptor targeted methotrexate and small interfering RNA co-delivery. J. Gene Med. 2018, 20, e3041. [Google Scholar] [CrossRef]
  154. Müller, K.; Klein, P.M.; Heissig, P.; Roidl, A.; Wagner, E. EGF receptor targeted lipo-oligocation polyplexes for antitumoral siRNA and miRNA delivery. Nanotechnology 2016, 27, 464001. [Google Scholar] [CrossRef] [PubMed]
  155. Müller, K.; Kessel, E.; Klein, P.M.; Höhn, M.; Wagner, E. Post-PEGylation of siRNA Lipo-oligoamino Amide Polyplexes Using Tetra-glutamylated Folic Acid as Ligand for Receptor-Targeted Delivery. Mol. Pharm. 2016, 13, 2332–2345. [Google Scholar] [CrossRef] [PubMed]
  156. Truebenbach, I.; Zhang, W.; Wang, Y.; Kern, S.; Höhn, M.; Reinhard, S.; Gorges, J.; Kazmaier, U.; Wagner, E. Co-delivery of pretubulysin and siEG5 to EGFR overexpressing carcinoma cells. Int. J. Pharm. 2019, 569, 118570. [Google Scholar] [CrossRef]
  157. Klein, P.M.; Kern, S.; Lee, D.J.; Schmaus, J.; Höhn, M.; Gorges, J.; Kazmaier, U.; Wagner, E. Folate receptor-directed orthogonal click-functionalization of siRNA lipopolyplexes for tumor cell killing in vivo. Biomaterials 2018, 178, 630–642. [Google Scholar] [CrossRef]
  158. Klein, P.M.; Klinker, K.; Zhang, W.; Kern, S.; Kessel, E.; Wagner, E.; Barz, M. Efficient Shielding of Polyplexes Using Heterotelechelic Polysarcosines. Polymers 2018, 10, 689. [Google Scholar] [CrossRef]
  159. Ogris, M.; Brunner, S.; Schüller, S.; Kircheis, R.; Wagner, E. PEGylated DNA/transferrin–PEI complexes: Reduced interaction with blood components, extended circulation in blood and potential for systemic gene delivery. Gene Ther. 1999, 6, 595–605. [Google Scholar] [CrossRef]
  160. Beckert, L.; Kostka, L.; Kessel, E.; Levacic, A.K.; Kostkova, H.; Etrych, T.; Lächelt, U.; Wagner, E. Acid-labile pHPMA modification of four-arm oligoaminoamide pDNA polyplexes balances shielding and gene transfer activity in vitro and in vivo. Eur. J. Pharm. Biopharm. 2016, 105, 85–96. [Google Scholar] [CrossRef]
  161. Rostovtsev, V.V.; Green, L.G.; Fokin, V.V.; Sharpless, K.B. A stepwise huisgen cycloaddition process: Copper(I)-catalyzed regioselective “ligation” of azides and terminal alkynes. Angew. Chem. 2002, 41, 2596–2599. [Google Scholar] [CrossRef]
  162. Chang, P.V.; Prescher, J.A.; Sletten, E.M.; Baskin, J.M.; Miller, I.A.; Agard, N.J.; Lo, A.; Bertozzi, C.R. Copper-free click chemistry in living animals. Proc. Natl. Acad. Sci. USA 2010, 107, 1821–1826. [Google Scholar] [CrossRef] [PubMed]
  163. Baskin, J.M.; Prescher, J.A.; Laughlin, S.T.; Agard, N.J.; Chang, P.V.; Miller, I.A.; Lo, A.; Codelli, J.A.; Bertozzi, C.R. Copper-free click chemistry for dynamic in vivo imaging. Proc. Natl. Acad. Sci. USA 2007, 104, 16793–16797. [Google Scholar] [CrossRef] [PubMed]
  164. Behr, J.-P. The proton sponge: A trick to enter cells the viruses did not exploit. Chim. Int. J. Chem. 1997, 51, 34–36. [Google Scholar]
  165. Gilleron, J.; Querbes, W.; Zeigerer, A.; Borodovsky, A.; Marsico, G.; Schubert, U.; Manygoats, K.; Seifert, S.; Andree, C.; Stöter, M. Image-based analysis of lipid nanoparticle–mediated siRNA delivery, intracellular trafficking and endosomal escape. Nat. Biotechnol. 2013, 31, 638–646. [Google Scholar] [CrossRef]
  166. Wittrup, A.; Ai, A.; Liu, X.; Hamar, P.; Trifonova, R.; Charisse, K.; Manoharan, M.; Kirchhausen, T.; Lieberman, J. Visualizing lipid-formulated siRNA release from endosomes and target gene knockdown. Nat. Biotechnol. 2015, 33, 870–876. [Google Scholar] [CrossRef]
  167. Brunner, S.; Sauer, T.; Carotta, S.E.A.; Cotten, M.; Saltik, M.; Wagner, E. Cell cycle dependence of gene transfer by lipoplex, polyplex and recombinant adenovirus. Gene Ther. 2000, 7, 401–407. [Google Scholar] [CrossRef]
  168. Brunner, S.; Fürtbauer, E.; Sauer, T.; Kursa, M.; Wagner, E. Overcoming the nuclear barrier: Cell cycle independent nonviral gene transfer with linear polyethylenimine or electroporation. Mol. Ther. 2002, 5, 80–86. [Google Scholar] [CrossRef]
  169. Grosse, S.; Thévenot, G.; Monsigny, M.; Fajac, I. Which mechanism for nuclear import of plasmid DNA complexed with polyethylenimine derivatives? J. Gene Med. 2006, 8, 845–851. [Google Scholar] [CrossRef]
  170. Grandinetti, G.; Reineke, T.M. Exploring the mechanism of plasmid DNA nuclear internalization with polymer-based vehicles. Mol. Pharm. 2012, 9, 2256–2267. [Google Scholar] [CrossRef] [PubMed]
  171. Pack, D.W.; Hoffman, A.S.; Pun, S.; Stayton, P.S. Design and development of polymers for gene delivery. Nat. Rev. Drug Discov. 2005, 4, 581–593. [Google Scholar] [CrossRef] [PubMed]
  172. Subramanian, A.; Ranganathan, P.; Diamond, S.L. Nuclear targeting peptide scaffolds for lipofection of nondividing mammalian cells. Nat. Biotechnol. 1999, 17, 873–877. [Google Scholar] [CrossRef] [PubMed]
  173. Brandén, L.J.; Mohamed, A.J.; Smith, C.E. A peptide nucleic acid–nuclear localization signal fusion that mediates nuclear transport of DNA. Nat. Biotechnol. 1999, 17, 784–787. [Google Scholar] [CrossRef]
  174. Munkonge, F.M.; Dean, D.A.; Hillery, E.; Griesenbach, U.; Alton, E.W. Emerging significance of plasmid DNA nuclear import in gene therapy. Adv. Drug Deliv. Rev. 2003, 55, 749–760. [Google Scholar] [CrossRef]
  175. Ciolina, C.; Byk, G.; Blanche, F.; Thuillier, V.; Scherman, D.; Wils, P. Coupling of nuclear localization signals to plasmid DNA and specific interaction of the conjugates with importin α. Bioconj. Chem. 1999, 10, 49–55. [Google Scholar] [CrossRef]
  176. Cartier, R.; Reszka, R. Utilization of synthetic peptides containing nuclear localization signals for nonviral gene transfer systems. Gene Ther. 2002, 9, 157–167. [Google Scholar] [CrossRef]
  177. Bremner, K.H.; Seymour, L.W.; Logan, A.; Read, M.L. Factors influencing the ability of nuclear localization sequence peptides to enhance nonviral gene delivery. Bioconj. Chem. 2004, 15, 152–161. [Google Scholar] [CrossRef]
  178. Mesika, A.; Kiss, V.; Brumfeld, V.; Ghosh, G.; Reich, Z. Enhanced intracellular mobility and nuclear accumulation of DNA plasmids associated with a karyophilic protein. Hum. Gene Ther. 2005, 16, 200–208. [Google Scholar] [CrossRef]
  179. Remaut, K.; Symens, N.; Lucas, B.; Demeester, J.; De Smedt, S. Cell division responsive peptides for optimized plasmid DNA delivery: The mitotic window of opportunity? J. Control. Release 2014, 179, 1–9. [Google Scholar] [CrossRef]
  180. Wagstaff, K.M.; Glover, D.J.; Tremethick, D.J.; Jans, D.A. Histone-mediated transduction as an efficient means for gene delivery. Mol. Ther. 2007, 15, 721–731. [Google Scholar] [CrossRef]
  181. Fritz, J.D.; Herweijer, H.; Zhang, G.; Wolff, J.A. Gene transfer into mammalian cells using histone-condensed plasmid DNA. Hum. Gene Ther. 1996, 7, 1395–1404. [Google Scholar] [CrossRef] [PubMed]
  182. Pigeon, L.; Gonçalves, C.; Gosset, D.; Pichon, C.; Midoux, P. An E3-14.7 K Peptide that Promotes Microtubules-Mediated Transport of Plasmid DNA Increases Polyplexes Transfection Efficiency. Small 2013, 9, 3845–3851. [Google Scholar] [CrossRef] [PubMed]
  183. Midoux, P.; Pigeon, L.; Gonçalves, C.; Pichon, C. Peptides mediating DNA transport on microtubules and their impact on non-viral gene transfer efficiency. Biosci. Rep. 2017, 37. [Google Scholar] [CrossRef] [PubMed]
  184. Chou, S.-T.; Leng, Q.; Scaria, P.; Woodle, M.; Mixson, A.J. Selective modification of HK peptides enhances siRNA silencing of tumor targets in vivo. Cancer Gene Ther. 2011, 18, 707–716. [Google Scholar] [CrossRef]
  185. Love, K.T.; Mahon, K.P.; Levins, C.G.; Whitehead, K.A.; Querbes, W.; Dorkin, J.R.; Qin, J.; Cantley, W.; Qin, L.L.; Racie, T. Lipid-like materials for low-dose, in vivo gene silencing. Proc. Natl. Acad. Sci. USA 2010, 107, 1864–1869. [Google Scholar] [CrossRef]
  186. Lee, E.R.; Marshall, J.; Siegel, C.S.; Jiang, C.; Yew, N.S.; Nichols, M.R.; Nietupski, J.B.; Ziegler, R.J.; Lane, M.B.; Wang, K.X. Detailed analysis of structures and formulations of cationic lipids for efficient gene transfer to the lung. Hum. Gene Ther. 1996, 7, 1701–1717. [Google Scholar] [CrossRef]
  187. Dong, Y.; Love, K.T.; Dorkin, J.R.; Sirirungruang, S.; Zhang, Y.; Chen, D.; Bogorad, R.L.; Yin, H.; Chen, Y.; Vegas, A.J. Lipopeptide nanoparticles for potent and selective siRNA delivery in rodents and nonhuman primates. Proc. Natl. Acad. Sci. USA 2014, 111, 3955–3960. [Google Scholar] [CrossRef]
  188. Dahlman, J.E.; Kauffman, K.J.; Xing, Y.; Shaw, T.E.; Mir, F.F.; Dlott, C.C.; Langer, R.; Anderson, D.G.; Wang, E.T. Barcoded nanoparticles for high throughput in vivo discovery of targeted therapeutics. Proc. Natl. Acad. Sci. USA 2017, 114, 2060–2065. [Google Scholar] [CrossRef]
  189. Neri, D.; Lerner, R.A. DNA-encoded chemical libraries: A selection system based on endowing organic compounds with amplifiable information. Annu. Rev. Biochem. 2018, 87, 479–502. [Google Scholar] [CrossRef]
  190. Lokugamage, M.P.; Sago, C.D.; Dahlman, J.E. Testing thousands of nanoparticles in vivo using DNA barcodes. Curr. Opin. Biomed. Eng. 2018, 7, 1–8. [Google Scholar] [CrossRef]
  191. Sago, C.D.; Lokugamage, M.P.; Lando, G.N.; Djeddar, N.; Shah, N.N.; Syed, C.; Bryksin, A.V.; Dahlman, J.E. Modifying a commonly expressed endocytic receptor retargets nanoparticles in vivo. Nano Lett. 2018, 18, 7590–7600. [Google Scholar] [CrossRef] [PubMed]
  192. Paunovska, K.; Sago, C.D.; Monaco, C.M.; Hudson, W.H.; Castro, M.G.; Rudoltz, T.G.; Kalathoor, S.; Vanover, D.A.; Santangelo, P.J.; Ahmed, R. A direct comparison of in vitro and in vivo nucleic acid delivery mediated by hundreds of nanoparticles reveals a weak correlation. Nano Lett. 2018, 18, 2148–2157. [Google Scholar] [CrossRef]
  193. Sago, C.D.; Lokugamage, M.P.; Islam, F.Z.; Krupczak, B.R.; Sato, M.; Dahlman, J.E. Nanoparticles that deliver RNA to bone marrow identified by in vivo directed evolution. J. Am. Chem. Soc. 2018, 140, 17095–17105. [Google Scholar] [CrossRef] [PubMed]
  194. Paunovska, K.; Gil, C.J.; Lokugamage, M.P.; Sago, C.D.; Sato, M.; Lando, G.N.; Gamboa Castro, M.; Bryksin, A.V.; Dahlman, J.E. Analyzing 2000 in vivo drug delivery data points reveals cholesterol structure impacts nanoparticle delivery. ACS Nano 2018, 12, 8341–8349. [Google Scholar] [CrossRef] [PubMed]
  195. Sago, C.D.; Lokugamage, M.P.; Paunovska, K.; Vanover, D.A.; Monaco, C.M.; Shah, N.N.; Castro, M.G.; Anderson, S.E.; Rudoltz, T.G.; Lando, G.N. High-throughput in vivo screen of functional mRNA delivery identifies nanoparticles for endothelial cell gene editing. Proc. Natl. Acad. Sci. USA 2018, 115, E9944–E9952. [Google Scholar] [CrossRef] [PubMed]
  196. Paunovska, K.; Da Silva Sanchez, A.J.; Sago, C.D.; Gan, Z.; Lokugamage, M.P.; Islam, F.Z.; Kalathoor, S.; Krupczak, B.R.; Dahlman, J.E. Nanoparticles containing oxidized cholesterol deliver mRNA to the liver microenvironment at clinically relevant doses. Adv. Mater. 2019, 31, 1807748. [Google Scholar] [CrossRef] [PubMed]
  197. Lokugamage, M.P.; Sago, C.D.; Gan, Z.; Krupczak, B.R.; Dahlman, J.E. Constrained nanoparticles deliver siRNA and sgRNA to T cells in vivo without targeting ligands. Adv. Mater. 2019, 31, 1902251. [Google Scholar] [CrossRef]
  198. Gan, Z.; Lokugamage, M.P.; Hatit, M.Z.; Loughrey, D.; Paunovska, K.; Sato, M.; Cristian, A.; Dahlman, J.E. Nanoparticles containing constrained phospholipids deliver mRNA to liver immune cells in vivo without targeting ligands. Bioeng. Transl. Med. 2020, e10161. [Google Scholar] [CrossRef]
Figure 1. (A) Structure of peptides for virus-like nanoparticles formation. (A) Sp-CC-PEG, Reproduced with permission from [81], American Chemical Society, 2013. (B) K3C6SPD with the sequence of KKKC6WLVFFAQQGSPD. Reproduced with permission from [80], American Chemical Society, 2014.
Figure 1. (A) Structure of peptides for virus-like nanoparticles formation. (A) Sp-CC-PEG, Reproduced with permission from [81], American Chemical Society, 2013. (B) K3C6SPD with the sequence of KKKC6WLVFFAQQGSPD. Reproduced with permission from [80], American Chemical Society, 2014.
Pharmaceutics 12 00888 g001
Figure 2. Chemical structure of ECO, EHCO and isotypic ECO. E: Ethylenediamine; C: Cysteine; O: Oleic acid; H: Histidines.
Figure 2. Chemical structure of ECO, EHCO and isotypic ECO. E: Ethylenediamine; C: Cysteine; O: Oleic acid; H: Histidines.
Pharmaceutics 12 00888 g002
Figure 3. Functional elements for sequence-defined OAAs different topologies. ssbb: Disulfide building block = succinoyl-cystamine; OAA, artificial oligoamino acid; K: Lysine; C: Cysteine; FA: Fatty acid.
Figure 3. Functional elements for sequence-defined OAAs different topologies. ssbb: Disulfide building block = succinoyl-cystamine; OAA, artificial oligoamino acid; K: Lysine; C: Cysteine; FA: Fatty acid.
Pharmaceutics 12 00888 g003
Figure 4. Pharmacological barriers for systemically administered non-viral targeted nucleic acid delivery. (A) Production of stable nucleic acids-loaded polyplexes. (B) After intravenous injection, nanocarriers shall avoid unspecific interactions with blood components and rapid clearance, accumulating in targeting areas during circulation. (C) After the passage of fenestrated blood vessels, nanocarriers shall be internalized by target cells via an active transport process, and realize efficient endosomal escape and release the cargos in an active form for gene expression or regulation.
Figure 4. Pharmacological barriers for systemically administered non-viral targeted nucleic acid delivery. (A) Production of stable nucleic acids-loaded polyplexes. (B) After intravenous injection, nanocarriers shall avoid unspecific interactions with blood components and rapid clearance, accumulating in targeting areas during circulation. (C) After the passage of fenestrated blood vessels, nanocarriers shall be internalized by target cells via an active transport process, and realize efficient endosomal escape and release the cargos in an active form for gene expression or regulation.
Pharmaceutics 12 00888 g004
Figure 5. (A) Typical 2-arm ligand-PEG-OAA for all-in-one nano-formulations with shielding and targeting domains. (B) T-shape lipo-OAA with terminal cysteine or azide group for post-modification via disulfide-formation or orthogonal cooper-free click reaction, respectively. (C) PEG-ligands with specific attachment sites for post-modification.
Figure 5. (A) Typical 2-arm ligand-PEG-OAA for all-in-one nano-formulations with shielding and targeting domains. (B) T-shape lipo-OAA with terminal cysteine or azide group for post-modification via disulfide-formation or orthogonal cooper-free click reaction, respectively. (C) PEG-ligands with specific attachment sites for post-modification.
Pharmaceutics 12 00888 g005
Figure 6. DNA-barcoded nanoparticles for high throughput in vivo carriers. (A) Nanoparticles were formulated to carry a unique DNA barcode and then the LNPs were pooled together and administered simultaneously to mice. Tissues of interest were isolated and delivery was quantified by deep sequencing the barcodes. Reproduced with permission from [188], National Academy of Sciences, 2017. (B) “FIND” strategy to quantify functional delivery of LNPs within a single mouse. Nanoparticles were formulated to carry a distinct DNA barcode and siICAM-2 and then the LNPs were pooled together and administered to mice intravenously. After 3 days, ICAM-2Low endothelial cells were isolated and the DNA barcodes within that population were sequenced. (Reproduced with permission from [194], American Chemical Society, 2018).
Figure 6. DNA-barcoded nanoparticles for high throughput in vivo carriers. (A) Nanoparticles were formulated to carry a unique DNA barcode and then the LNPs were pooled together and administered simultaneously to mice. Tissues of interest were isolated and delivery was quantified by deep sequencing the barcodes. Reproduced with permission from [188], National Academy of Sciences, 2017. (B) “FIND” strategy to quantify functional delivery of LNPs within a single mouse. Nanoparticles were formulated to carry a distinct DNA barcode and siICAM-2 and then the LNPs were pooled together and administered to mice intravenously. After 3 days, ICAM-2Low endothelial cells were isolated and the DNA barcodes within that population were sequenced. (Reproduced with permission from [194], American Chemical Society, 2018).
Pharmaceutics 12 00888 g006
Table 1. Properties of therapeutic nucleic acids.
Table 1. Properties of therapeutic nucleic acids.
CargoPropertiesTarget SiteFunction and Mechanism
pDNACircular, large (5–15 kbp) double-stranded DNANucleus Encodes a cDNA expression cassette under the control of a strong promoter/enhancer unit
siRNAShort noncoding double-stranded RNA with 21–25 bp sequenceCytosolRNAi; unwound into single-strand bound in RISC that recognizes the complementary mRNA sequence, resulting in mRNA cleavage.
miRNAMicroRNA, short noncoding endogenous double-stranded RNACytosolRegulate gene expression post-transcriptionally by binding of mRNA and thus preventing translation of mRNA into protein
mRNASingle stranded sequence transcribed from DNA CytosolTranslated into proteins in the cytoplasm
sgRNANoncoding short RNA sequence binding Cas9 proteinNucleussgRNA guides the nuclease Cas9 to a selective target DNA sequence via complementary binding to make a DSB
ASOChemically stabilized short single-stranded antisense oligonucleotideCytosol/NucleusBind to mRNA and prevent translation, or to induce exon skipping
PMO Synthetic uncharged ASO, in which the ribosyl rings and phospodiesters in the backbone are replaced with methylenemorpholine rings and a phosphorodiamidate backbone, respectively.NucleusBind to pre-mRNA in the nucleus and alter gene splicing, resulting in the exclusion or inclusion of particular genetic fragments in the mature mRNA
pDNA: plasmid DNA; siRNA: small interfering RNA; miRNA: mRNA: messenger RNA; RISC: RNA-induced silencing complexes; sgRNA: single guide RNA; ASOs: antisense oligonucleotides; PMOs: phosphorodiamidate morpholino oligomers; DSB: double-strand break.
Table 2. Representative linear and branched HK peptides.
Table 2. Representative linear and branched HK peptides.
PeptideStructureTopologyFunctions
H2KPharmaceutics 12 00888 i001LinearIneffective in nucleic acid delivery in vitro, need to combine with cationic carriers as liposomes [45,51].
Far more effective for in vivo pDNA delivery [49].
H2K4bPharmaceutics 12 00888 i0024-branchedEffective in pDNA delivery yet infective for in vitro siRNA transfection as compared with H3K8b [47].
Far more effective for in vivo siRNA delivery [48] as compare with H3K8b.
H3K4b
H3K(+H)4b
Pharmaceutics 12 00888 i0034-branchedH3K4b exhibited better in vitro siRNA transfection than H2K4b [47].
H3K(+H)4b exhibited comparable in vitro siRNA transfection efficiency as compared with H3K8b [53].
4-branched HK peptide exhibited far more effective gene silencing effect for in vivo siRNA administration [48].
H3K8bPharmaceutics 12 00888 i0048-branchedHighly effective as carriers for siRNA in vitro transfection as compared with 4 branched H2K4b and H3K4b peptide [47].
Lower in vivo siRNA transfection efficiency as compared with 4 branched H2K4b and H3K4b peptide [48].
Linear H2K peptides with the repeating amino-acid sequence of -HHK-; H2K4b and H2K4bT peptides have four branches with the repeating sequence of -HHK-; highly-branched H3K8b peptides contain histidine-enrich domains and eight terminal branches with the repeating -HHHK- sequence.
Table 3. Sequence of cell-penetrating peptides (CPPs) for nucleic acid delivery.
Table 3. Sequence of cell-penetrating peptides (CPPs) for nucleic acid delivery.
CPPsSequencesCargos
GALAWEAALAEALAEALAEHLAEALAEALEALAADNA [58]
KALAWEAKLAKALAKALAKHLAKALAKALKACEADNA [58]
RALAWEARLARALARALARHLARALARALRACEADNA [58,59], siRNA [60], mRNA [61]
RAWARAWARALARALRALARALRALARDNA [70]
PepFect3Stearyl-AGYLLGKINLKALAALAKKIL-NH2SCOs [62], pDNA [63].
PepFect6Stearyl-AGYLLK(K(K2(tfq4)))INLKALAALAKKIL-NH2siRNA [64]
PepFect14Stearyl-AGYLLGKLLOOLAAAALOOLL-NH2SCOs [71], pDNA [65], siRNA [72]
NickFect1Stearyl-AGY(PO3)LLKTNLKALAALAKKIL-NH2SCOs [66], pDNA [63]
NickFect51(Stearyl-AGYLLG)-δ-OINLKALAALAKKIL-NH2SCOs, pDNA, siRNA [67,68]
NickFect55(Stearyl-AGYLLG)-δ-OINLKALAALAKAIL-NH2pDNA [69].
(K(K2(tfq4))) is a tetra(trifluoromethylquinoline) derivate.
Table 4. Peptide sequence of supramolecular particles for nucleic acid delivery.
Table 4. Peptide sequence of supramolecular particles for nucleic acid delivery.
NameSequences
Glu-KWGlu-GSGSGS-KKKKKKKK-GGSGGS-WKWEWKWEWKWEWG
C-Sn-BC-(GAGAGAGQ)10-K12
K3C6SPDKKKC6-WLVFFAQQGSPD
H4K5-HCBzlCBzlHHHHH-KKKK-C12LL-H-CBzlCBzl-H-LLGSPD
PAsPalA-VVVAAAEEE
P2TFVETGSGTSKQVAKRVAAEKLLTKFKT
P3SIRKLEYEIEELRLRIGGG
P4SIRKLEYEIEELRLRIGGGTFVETGSGTSKQVAKRVAAEKLLTKFKT
PalA: Palmitic acid; Glu: d-glucose.

Share and Cite

MDPI and ACS Style

Wang, Y.; Wagner, E. Non-Viral Targeted Nucleic Acid Delivery: Apply Sequences for Optimization. Pharmaceutics 2020, 12, 888. https://doi.org/10.3390/pharmaceutics12090888

AMA Style

Wang Y, Wagner E. Non-Viral Targeted Nucleic Acid Delivery: Apply Sequences for Optimization. Pharmaceutics. 2020; 12(9):888. https://doi.org/10.3390/pharmaceutics12090888

Chicago/Turabian Style

Wang, Yanfang, and Ernst Wagner. 2020. "Non-Viral Targeted Nucleic Acid Delivery: Apply Sequences for Optimization" Pharmaceutics 12, no. 9: 888. https://doi.org/10.3390/pharmaceutics12090888

APA Style

Wang, Y., & Wagner, E. (2020). Non-Viral Targeted Nucleic Acid Delivery: Apply Sequences for Optimization. Pharmaceutics, 12(9), 888. https://doi.org/10.3390/pharmaceutics12090888

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop