Identification of Highly Conserved SARS-CoV-2 Antigenic Epitopes with Wide Coverage Using Reverse Vaccinology Approach
Abstract
:1. Introduction
2. Materials and Methods
2.1. SARS-CoV-2 Genome Data Source
2.2. Antigenic Protein Prediction
2.3. Epitope Mapping
2.4. Epitope Analyses: Antigenicity, Interferon γ Induction, Toxicity, and Host Homology
2.5. Analysis of SARS-CoV-2 Mutations
2.6. Structure Prediction
3. Results
3.1. Reverse-Vaccinology Workflow Applied for the Prediction of SARS-CoV-2 Antigens
3.2. Selection and Analysis of SARS-CoV-2 Proteins as Antigens Responsive to Immune Cells
3.3. Analysis of Epitopes Selected from the Antigenic SARS-CoV-2 Proteins
3.4. Analysis of Mutational Replacements in the Selected Epitopes
3.5. Structural Prediction of Epitopes with Replacements and ORF10
4. Discussion
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
References
- Zhu, N.; Zhang, D.; Wang, W.; Li, X.; Yang, B.; Song, J.; Zhao, X.; Huang, B.; Shi, W.; Lu, R.; et al. A Novel Coronavirus from Patients with Pneumonia in China, 2019. N. Engl. J. Med. 2020, 382, 727–733. [Google Scholar] [CrossRef] [PubMed]
- Bchetnia, M.; Girard, C.; Duchaine, C.; Laprise, C. The Outbreak of the Novel Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2): A Review of the Current Global Status. J. Infect. Public Health 2020. [Google Scholar] [CrossRef] [PubMed]
- Huang, C.; Wang, Y.; Li, X.; Ren, L.; Zhao, J.; Hu, Y.; Zhang, L.; Fan, G.; Xu, J.; Gu, X.; et al. Clinical Features of Patients Infected with 2019 Novel Coronavirus in Wuhan, China. Lancet 2020, 395, 497–506. [Google Scholar] [CrossRef] [Green Version]
- Wang, C.; Liu, Z.; Chen, Z.; Huang, X.; Xu, M.; He, T.; Zhang, Z. The Establishment of Reference Sequence for SARS-CoV-2 and Variation Analysis. J. Med. Virol. 2020, 92, 667–674. [Google Scholar] [CrossRef]
- Yoshimoto, F.K. The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. Protein J. 2020, 39, 198–216. [Google Scholar] [CrossRef]
- Chen, Y.; Guo, Y.; Pan, Y.; Zhao, Z.J. Structure Analysis of the Receptor Binding of 2019-NCoV. Biochem. Biophys. Res. Commun. 2020. [Google Scholar] [CrossRef]
- Wrapp, D.; Wang, N.; Corbett, K.S.; Goldsmith, J.A.; Hsieh, C.-L.; Abiona, O.; Graham, B.S.; McLellan, J.S. Cryo-EM Structure of the 2019-NCoV Spike in the Prefusion Conformation. Science 2020, 367, 1260–1263. [Google Scholar] [CrossRef] [Green Version]
- Chan, J.F.-W.; Kok, K.-H.; Zhu, Z.; Chu, H.; To, K.K.-W.; Yuan, S.; Yuen, K.-Y. Genomic Characterization of the 2019 Novel Human-Pathogenic Coronavirus Isolated from a Patient with Atypical Pneumonia after Visiting Wuhan. Emerg. Microbes Infect. 2020, 9, 221–236. [Google Scholar] [CrossRef] [Green Version]
- Lu, R.; Zhao, X.; Li, J.; Niu, P.; Yang, B.; Wu, H.; Wang, W.; Song, H.; Huang, B.; Zhu, N.; et al. Genomic Characterisation and Epidemiology of 2019 Novel Coronavirus: Implications for Virus Origins and Receptor Binding. Lancet 2020, 395, 565–574. [Google Scholar] [CrossRef] [Green Version]
- Gao, Q.; Bao, L.; Mao, H.; Wang, L.; Xu, K.; Yang, M.; Li, Y.; Zhu, L.; Wang, N.; Lv, Z.; et al. Rapid Development of an Inactivated Vaccine for SARS-CoV-2. Microbiology 2020. [Google Scholar] [CrossRef]
- Zha, L.; Zhao, H.; Mohsen, M.O.; Hong, L.; Zhou, Y.; Li, Z.; Yao, C.; Guo, L.; Chen, H.; Liu, X.; et al. Development of a COVID-19 Vaccine Based on the Receptor Binding Domain Displayed on Virus-like Particles. Immunology 2020. [Google Scholar] [CrossRef]
- Jackson, L.A.; Anderson, E.J.; Rouphael, N.G.; Roberts, P.C.; Makhene, M.; Coler, R.N.; McCullough, M.P.; Chappell, J.D.; Denison, M.R.; Stevens, L.J.; et al. An MRNA Vaccine against SARS-CoV-2—Preliminary Report. N. Engl. J. Med. 2020. [Google Scholar] [CrossRef]
- McKay, P.F.; Hu, K.; Blakney, A.K.; Samnuan, K.; Bouton, C.R.; Rogers, P.; Polra, K.; Lin, P.J.C.; Barbosa, C.; Tam, Y.; et al. Self-Amplifying RNA SARS-CoV-2 Lipid Nanoparticle Vaccine Induces Equivalent Preclinical Antibody Titers and Viral Neutralization to Recovered COVID-19 Patients. Immunology 2020. [Google Scholar] [CrossRef]
- Zhu, F.-C.; Guan, X.-H.; Li, Y.-H.; Huang, J.-Y.; Jiang, T.; Hou, L.-H.; Li, J.-X.; Yang, B.-F.; Wang, L.; Wang, W.-J.; et al. Immunogenicity and Safety of a Recombinant Adenovirus Type-5-Vectored COVID-19 Vaccine in Healthy Adults Aged 18 Years or Older: A Randomised, Double-Blind, Placebo-Controlled, Phase 2 Trial. Lancet 2020. [Google Scholar] [CrossRef]
- Folegatti, P.M.; Ewer, K.J.; Aley, P.K.; Angus, B.; Becker, S.; Belij-Rammerstorfer, S.; Bellamy, D.; Bibi, S.; Bittaye, M.; Clutterbuck, E.A.; et al. Safety and Immunogenicity of the ChAdOx1 NCoV-19 Vaccine against SARS-CoV-2: A Preliminary Report of a Phase 1/2, Single-Blind, Randomised Controlled Trial. Lancet 2020. [Google Scholar] [CrossRef]
- Seib, K.L.; Zhao, X.; Rappuoli, R. Developing Vaccines in the Era of Genomics: A Decade of Reverse Vaccinology. Clin. Microbiol. Infect. 2012, 18, 109–116. [Google Scholar] [CrossRef] [Green Version]
- Pizza, M. Identification of Vaccine Candidates Against Serogroup B Meningococcus by Whole-Genome Sequencing. Science 2000, 287, 1816–1820. [Google Scholar] [CrossRef]
- Hisham, Y.; Ashhab, Y. Identification of Cross-Protective Potential Antigens against Pathogenic Brucella Spp. through Combining Pan-Genome Analysis with Reverse Vaccinology. J. Immunol. Res. 2018, 2018, 1–15. [Google Scholar] [CrossRef] [Green Version]
- Zheng, J.; Lin, X.; Wang, X.; Zheng, L.; Lan, S.; Jin, S.; Ou, Z.; Wu, J. In Silico Analysis of Epitope-Based Vaccine Candidates against Hepatitis B Virus Polymerase Protein. Viruses 2017, 9, 112. [Google Scholar] [CrossRef]
- Leow, C.Y.; Kazi, A.; Hisyam Ismail, C.M.K.; Chuah, C.; Lim, B.H.; Leow, C.H.; Banga Singh, K.K. Reverse Vaccinology Approach for the Identification and Characterization of Outer Membrane Proteins of Shigella Flexneri as Potential Cellular- and Antibody-Dependent Vaccine Candidates. Clin. Exp. Vaccine Res. 2020, 9, 15. [Google Scholar] [CrossRef]
- Fahimi, H.; Sadeghizadeh, M.; Mohammadipour, M. In Silico Analysis of an Envelope Domain III-Based Multivalent Fusion Protein as a Potential Dengue Vaccine Candidate. Clin. Exp. Vaccine Res. 2016, 5, 41. [Google Scholar] [CrossRef] [PubMed]
- Yuan, M.; Wu, N.C.; Zhu, X.; Lee, C.-C.D.; So, R.T.Y.; Lv, H.; Mok, C.K.P.; Wilson, I.A. A Highly Conserved Cryptic Epitope in the Receptor Binding Domains of SARS-CoV-2 and SARS-CoV. Science 2020, 368, 630–633. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sarkar, B.; Ullah, M.A.; Johora, F.T.; Taniya, M.A.; Araf, Y. Immunoinformatics-Guided Designing of Epitope-Based Subunit Vaccines against the SARS Coronavirus-2 (SARS-CoV-2). Immunobiology 2020, 225, 151955. [Google Scholar] [CrossRef] [PubMed]
- Ong, E.; Wong, M.U.; Huffman, A.; He, Y. COVID-19 Coronavirus Vaccine Design Using Reverse Vaccinology and Machine Learning. Front. Immunol. 2020, 11, 1581. [Google Scholar] [CrossRef] [PubMed]
- Baruah, V.; Bose, S. Immunoinformatics-aided Identification of T Cell and B Cell Epitopes in the Surface Glycoprotein of 2019-nCoV. J. Med. Virol. 2020, 92, 495–500. [Google Scholar] [CrossRef] [Green Version]
- Grifoni, A.; Sidney, J.; Zhang, Y.; Scheuermann, R.H.; Peters, B.; Sette, A. A Sequence Homology and Bioinformatic Approach Can Predict Candidate Targets for Immune Responses to SARS-CoV-2. Cell Host Microbe 2020, 27, 671–680.e2. [Google Scholar] [CrossRef]
- Ranga, V.; Niemelä, E.; Tamirat, M.Z.; Eriksson, J.E.; Airenne, T.T.; Johnson, M.S. Immunogenic SARS-CoV-2 Epitopes: In Silico Study Towards Better Understanding of COVID-19 Disease-Paving the Way for Vaccine Development. Vaccines 2020, 8, 408. [Google Scholar] [CrossRef]
- Wang, D.; Mai, J.; Zhou, W.; Yu, W.; Zhan, Y.; Wang, N.; Epstein, N.D.; Yang, Y. Immunoinformatic Analysis of T- and B-Cell Epitopes for SARS-CoV-2 Vaccine Design. Vaccines 2020, 8, 355. [Google Scholar] [CrossRef]
- Bhattacharya, M.; Sharma, A.R.; Patra, P.; Ghosh, P.; Sharma, G.; Patra, B.C.; Lee, S.; Chakraborty, C. Development of Epitope-based Peptide Vaccine against Novel Coronavirus 2019 (SARS-COV-2): Immunoinformatics Approach. J. Med. Virol. 2020, 92, 618–631. [Google Scholar] [CrossRef] [Green Version]
- Kiyotani, K.; Toyoshima, Y.; Nemoto, K.; Nakamura, Y. Bioinformatic Prediction of Potential T Cell Epitopes for SARS-Cov-2. J. Hum. Genet 2020, 65, 569–575. [Google Scholar] [CrossRef]
- Coish, J.M.; MacNeil, A.J. Out of the Frying Pan and into the Fire? Due Diligence Warranted for ADE in COVID-19. Microbes Infect. 2020. [Google Scholar] [CrossRef]
- Iwasaki, A.; Yang, Y. The Potential Danger of Suboptimal Antibody Responses in COVID-19. Nat. Rev. Immunol. 2020, 20, 339–341. [Google Scholar] [CrossRef] [Green Version]
- Morens, D.M. Antibody-Dependent Enhancement of Infection and the Pathogenesis of Viral Disease. Clin. Infect. Dis. 1994, 19, 500–512. [Google Scholar] [CrossRef]
- Cheng, J.; Randall, A.Z.; Sweredoski, M.J.; Baldi, P. SCRATCH: A Protein Structure and Structural Feature Prediction Server. Nucleic Acids Res. 2005, 33, W72–W76. [Google Scholar] [CrossRef] [Green Version]
- Doytchinova, I.A.; Flower, D.R. VaxiJen: A Server for Prediction of Protective Antigens, Tumour Antigens and Subunit Vaccines. BMC Bioinform. 2007, 8, 4. [Google Scholar] [CrossRef] [Green Version]
- Fleri, W.; Paul, S.; Dhanda, S.K.; Mahajan, S.; Xu, X.; Peters, B.; Sette, A. The Immune Epitope Database and Analysis Resource in Epitope Discovery and Synthetic Vaccine Design. Front. Immunol. 2017, 8. [Google Scholar] [CrossRef] [Green Version]
- Dhanda, S.K.; Vir, P.; Raghava, G.P.S. Designing of Interferon-Gamma Inducing MHC Class-II Binders. Biol. Direct 2013, 8, 30. [Google Scholar] [CrossRef] [Green Version]
- Gupta, S.; Kapoor, P.; Chaudhary, K.; Gautam, A.; Kumar, R.; Open Source Drug Discovery Consortium; Raghava, G.P.S. In Silico Approach for Predicting Toxicity of Peptides and Proteins. PLoS ONE 2013, 8, e73957. [Google Scholar] [CrossRef] [Green Version]
- Carty, M.; Bowie, A.G. Recent Insights into the Role of Toll-like Receptors in Viral Infection: Toll-like Receptors and Viruses. Clin. Exp. Immunol. 2010, 161, 397–406. [Google Scholar] [CrossRef]
- Lester, S.N.; Li, K. Toll-Like Receptors in Antiviral Innate Immunity. J. Mol. Biol. 2014, 426, 1246–1264. [Google Scholar] [CrossRef]
- Zhou, P.; Jin, B.; Li, H.; Huang, S.-Y. HPEPDOCK: A Web Server for Blind Peptide-Protein Docking Based on a Hierarchical Algorithm. Nucleic Acids Res. 2018, 46, W443–W450. [Google Scholar] [CrossRef]
- Shanmugam, A.; Rajoria, S.; George, A.L.; Mittelman, A.; Suriano, R.; Tiwari, R.K. Synthetic Toll like Receptor-4 (TLR-4) Agonist Peptides as a Novel Class of Adjuvants. PLoS ONE 2012, 7, e30839. [Google Scholar] [CrossRef] [Green Version]
- Singer, J.; Gifford, R.; Cotten, M.; Robertson, D. CoV-GLUE: A Web Application for Tracking SARS-CoV-2 Genomic Variation. Life Sci. 2020. preprints. [Google Scholar]
- Shu, Y.; McCauley, J. GISAID: Global Initiative on Sharing All Influenza Data—from Vision to Reality. Euro Surveill. 2017, 22. [Google Scholar] [CrossRef] [Green Version]
- Elbe, S.; Buckland-Merrett, G. Data, Disease and Diplomacy: GISAID’s Innovative Contribution to Global Health. Glob Chall 2017, 1, 33–46. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rost, B.; Liu, J. The PredictProtein Server. Nucleic Acids Res. 2003, 31, 3300–3304. [Google Scholar] [CrossRef] [PubMed]
- Lamiable, A.; Thévenet, P.; Rey, J.; Vavrusa, M.; Derreumaux, P.; Tufféry, P. PEP-FOLD3: Faster de Novo Structure Prediction for Linear Peptides in Solution and in Complex. Nucleic Acids Res. 2016, 44, W449–W454. [Google Scholar] [CrossRef] [Green Version]
- Blum, J.S.; Wearsch, P.A.; Cresswell, P. Pathways of Antigen Processing. Annu. Rev. Immunol. 2013, 31, 443–473. [Google Scholar] [CrossRef] [Green Version]
- Schroder, K.; Hertzog, P.J.; Ravasi, T.; Hume, D.A. Interferon-Gamma: An Overview of Signals, Mechanisms and Functions. J. Leukoc. Biol. 2004, 75, 163–189. [Google Scholar] [CrossRef]
- Ciechanover, A. The Ubiquitin-Proteasome Pathway: On Protein Death and Cell Life. Embo J. 1998, 17, 7151–7160. [Google Scholar] [CrossRef] [Green Version]
- Gao, G.; Luo, H. The Ubiquitin-Proteasome Pathway in Viral Infections. Can. J. Physiol. Pharmacol. 2006, 84, 5–14. [Google Scholar] [CrossRef] [PubMed]
- Gordon, D.E.; Jang, G.M.; Bouhaddou, M.; Xu, J.; Obernier, K.; White, K.M.; O’Meara, M.J.; Rezelj, V.V.; Guo, J.Z.; Swaney, D.L.; et al. A SARS-CoV-2 Protein Interaction Map Reveals Targets for Drug Repurposing. Nature 2020, 583, 459–468. [Google Scholar] [CrossRef] [PubMed]
- Pancer, K.; Milewska, A.; Owczarek, K.; Dabrowska, A.; Kowalski, M.; Łabaj, P.P.; Branicki, W.; Sanak, M.; Pyrc, K. The SARS-CoV-2 ORF10 Is Not Essential in Vitro or in Vivo in Humans. PLoS Pathog 2020, 16, e1008959. [Google Scholar] [CrossRef] [PubMed]
- Hassan, S.S.; Attrish, D.; Ghosh, S.; Choudhury, P.P.; Uversky, V.N.; Uhal, B.D.; Lundstrom, K.; Rezaei, N.; Aljabali, A.A.A.; Seyran, M.; et al. Notable Sequence Homology of the ORF10 Protein Introspects the Architecture of SARS-COV-2. Bioinformatics 2020. preprints. [Google Scholar]
- Thevarajan, I.; Nguyen, T.H.O.; Koutsakos, M.; Druce, J.; Caly, L.; van de Sandt, C.E.; Jia, X.; Nicholson, S.; Catton, M.; Cowie, B.; et al. Breadth of Concomitant Immune Responses Prior to Patient Recovery: A Case Report of Non-Severe COVID-19. Nat. Med. 2020, 26, 453–455. [Google Scholar] [CrossRef] [Green Version]
- Mu, J.; Xu, J.; Zhang, L.; Shu, T.; Wu, D.; Huang, M.; Ren, Y.; Li, X.; Geng, Q.; Xu, Y.; et al. SARS-CoV-2-Encoded Nucleocapsid Protein Acts as a Viral Suppressor of RNA Interference in Cells. Sci. China Life Sci. 2020. [Google Scholar] [CrossRef] [Green Version]
- Zhao, X.; Nicholls, J.M.; Chen, Y.-G. Severe Acute Respiratory Syndrome-Associated Coronavirus Nucleocapsid Protein Interacts with Smad3 and Modulates Transforming Growth Factor-Beta Signaling. J. Biol. Chem. 2008, 283, 3272–3280. [Google Scholar] [CrossRef]
- Voss, D.; Pfefferle, S.; Drosten, C.; Stevermann, L.; Traggiai, E.; Lanzavecchia, A.; Becker, S. Studies on Membrane Topology, N-Glycosylation and Functionality of SARS-CoV Membrane Protein. Virol. J. 2009, 6, 79. [Google Scholar] [CrossRef] [Green Version]
- Hoffmann, M.; Kleine-Weber, H.; Schroeder, S.; Krüger, N.; Herrler, T.; Erichsen, S.; Schiergens, T.S.; Herrler, G.; Wu, N.-H.; Nitsche, A.; et al. SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 2020, 181, 271–280.e8. [Google Scholar] [CrossRef]
- Wong, S.K.; Li, W.; Moore, M.J.; Choe, H.; Farzan, M. A 193-Amino Acid Fragment of the SARS Coronavirus S Protein Efficiently Binds Angiotensin-Converting Enzyme 2. J. Biol. Chem. 2004, 279, 3197–3201. [Google Scholar] [CrossRef] [Green Version]
- Angelini, M.M.; Neuman, B.W.; Buchmeier, M.J. Untangling Membrane Rearrangement in the Nidovirales. DNA Cell Biol. 2014, 33, 122–127. [Google Scholar] [CrossRef] [Green Version]
- Angelini, M.M.; Akhlaghpour, M.; Neuman, B.W.; Buchmeier, M.J. Severe Acute Respiratory Syndrome Coronavirus Nonstructural Proteins 3, 4, and 6 Induce Double-Membrane Vesicles. mBio 2013, 4. [Google Scholar] [CrossRef] [Green Version]
- Frieman, M.; Ratia, K.; Johnston, R.E.; Mesecar, A.D.; Baric, R.S. Severe Acute Respiratory Syndrome Coronavirus Papain-like Protease Ubiquitin-like Domain and Catalytic Domain Regulate Antagonism of IRF3 and NF-KappaB Signaling. J. Virol. 2009, 83, 6689–6705. [Google Scholar] [CrossRef] [Green Version]
- Chen, X.; Yang, X.; Zheng, Y.; Yang, Y.; Xing, Y.; Chen, Z. SARS Coronavirus Papain-like Protease Inhibits the Type I Interferon Signaling Pathway through Interaction with the STING-TRAF3-TBK1 Complex. Protein Cell 2014, 5, 369–381. [Google Scholar] [CrossRef] [Green Version]
- Cottam, E.M.; Whelband, M.C.; Wileman, T. Coronavirus NSP6 Restricts Autophagosome Expansion. Autophagy 2014, 10, 1426–1441. [Google Scholar] [CrossRef] [Green Version]
- Minakshi, R.; Padhan, K.; Rani, M.; Khan, N.; Ahmad, F.; Jameel, S. The SARS Coronavirus 3a Protein Causes Endoplasmic Reticulum Stress and Induces Ligand-Independent Downregulation of the Type 1 Interferon Receptor. PLoS ONE 2009, 4, e8342. [Google Scholar] [CrossRef]
- Siu, K.-L.; Yuen, K.-S.; Castaño-Rodriguez, C.; Ye, Z.-W.; Yeung, M.-L.; Fung, S.-Y.; Yuan, S.; Chan, C.-P.; Yuen, K.-Y.; Enjuanes, L.; et al. Severe Acute Respiratory Syndrome Coronavirus ORF3a Protein Activates the NLRP3 Inflammasome by Promoting TRAF3-Dependent Ubiquitination of ASC. Faseb J. 2019, 33, 8865–8877. [Google Scholar] [CrossRef]
- Shang, W.; Yang, Y.; Rao, Y.; Rao, X. The Outbreak of SARS-CoV-2 Pneumonia Calls for Viral Vaccines. npj Vaccines 2020, 5, 18. [Google Scholar] [CrossRef] [Green Version]
- Wang, N.; Shang, J.; Jiang, S.; Du, L. Subunit Vaccines Against Emerging Pathogenic Human Coronaviruses. Front. Microbiol. 2020, 11, 298. [Google Scholar] [CrossRef]
- WHO, D.O.N. SARS-CoV-2 Variant—United Kingdom of Great Britain and Northern Ireland; WHO: Geneva, Switzerland, 2020. [Google Scholar]
- Vilar, S.; Isom, D.G. One Year of SARS-CoV-2: How Much Has the Virus Changed? bioRxiv 2020. [Google Scholar] [CrossRef]
- Ward, D.; Higgins, M.; Phelan, J.E.; Hibberd, M.L.; Campino, S.; Clark, T.G. An Integrated in Silico Immuno-Genetic Analytical Platform Provides Insights into COVID-19 Serological and Vaccine Targets. Genome Med. 2021, 13, 4. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Wu, X.; Zhang, X.; Hou, X.; Liang, T.; Wang, D.; Teng, F.; Dai, J.; Duan, H.; Guo, S.; et al. SARS-CoV-2 Proteome Microarray for Mapping COVID-19 Antibody Interactions at Amino Acid Resolution. ACS Cent. Sci. 2020, 6, 2238–2249. [Google Scholar] [CrossRef] [PubMed]
- Alam, A.; Khan, A.; Imam, N.; Siddiqui, M.F.; Waseem, M.; Malik, M.Z.; Ishrat, R. Design of an Epitope-Based Peptide Vaccine against the SARS-CoV-2: A Vaccine-Informatics Approach. Brief Bioinform. 2020. [Google Scholar] [CrossRef]
- Dar, H.A.; Waheed, Y.; Najmi, M.H.; Ismail, S.; Hetta, H.F.; Ali, A.; Muhammad, K. Multiepitope Subunit Vaccine Design against COVID-19 Based on the Spike Protein of SARS-CoV-2: An In Silico Analysis. J. Immunol. Res. 2020, 2020, 1–15. [Google Scholar] [CrossRef] [PubMed]
- Yarmarkovich, M.; Warrington, J.M.; Farrel, A.; Maris, J.M. Identification of SARS-CoV-2 Vaccine Epitopes Predicted to Induce Long-Term Population-Scale Immunity. Cell Rep. Med. 2020, 1, 100036. [Google Scholar] [CrossRef]
- Shrock, E.; Fujimura, E.; Kula, T.; Timms, R.T.; Lee, I.-H.; Leng, Y.; Robinson, M.L.; Sie, B.M.; Li, M.Z.; Chen, Y.; et al. Viral Epitope Profiling of COVID-19 Patients Reveals Cross-Reactivity and Correlates of Severity. Science 2020, 370, eabd4250. [Google Scholar] [CrossRef]
- Tarke, A.; Sidney, J.; Kidd, C.K.; Dan, J.M.; Ramirez, S.I.; Yu, E.D.; Mateus, J.; da Silva Antunes, R.; Moore, E.; Rubiro, P.; et al. Comprehensive Analysis of T Cell Immunodominance and Immunoprevalence of SARS-CoV-2 Epitopes in COVID-19 Cases. Cell Rep. Med. 2021, 2, 100204. [Google Scholar] [CrossRef]
- Ferretti, A.P.; Kula, T.; Wang, Y.; Nguyen, D.M.V.; Weinheimer, A.; Dunlap, G.S.; Xu, Q.; Nabilsi, N.; Perullo, C.R.; Cristofaro, A.W.; et al. Unbiased Screens Show CD8+ T Cells of COVID-19 Patients Recognize Shared Epitopes in SARS-CoV-2 That Largely Reside Outside the Spike Protein. Immunity 2020, 53, 1095–1107.e3. [Google Scholar] [CrossRef]
NCBI Ref. Seq. Accession ID | Protein Name | Length (aa) | Antigeni-city Score * | Epitope Density | No. of Mutations | Mutation Density |
---|---|---|---|---|---|---|
YP_009724393.1 | Membrane glycoprotein | 222 | 0.42 | 0.032 | 564 | 0.58 |
YP_009724397.2 | Nucleocapsid phosphoprotein | 419 | 0.79 | 0.031 | 1560 | 0.85 |
YP_009724390.1 | Surface glycoprotein (spike) | 1273 | 0.65 | 0.032 | 4360 | 0.78 |
YP_009725255.1 | ORF10 | 38 | 0.45 | 0.131 | 127 | 0.77 |
NCBI Ref. Seq. Accession ID | Protein Name | Length (aa) | Antigen-icity Score * | Epitope Density (CD4+) | Epitope Density (CD8+) | Allele Coverage | No. of Mutations | Mutation Density |
---|---|---|---|---|---|---|---|---|
YP_009724389.1 | nsp3 | 1944 | 0.30 | 0.017 | 0.065 | 1.00 | 6869 | 0.81 |
YP_009724389.1 | nsp4 | 499 | 0.42 | 0.044 | 0.080 | 1.00 | 1599 | 0.73 |
YP_009724389.1 | nsp6 | 289 | 0.37 | 0.062 | 0.058 | 0.75 | 801 | 0.63 |
YP_009724390.1 | Surface glycoprotein (spike) | 1273 | 0.65 | 0.015 | 0.067 | 1.00 | 4360 | 0.78 |
YP_009724391.1 | ORF3a | 275 | 0.50 | 0.036 | 0.069 | 0.92 | 1193 | 1.00 |
YP_009725255.1 | ORF10 | 38 | 0.45 | 0.026 | 0.131 | 0.25 | 127 | 0.77 |
NCBI Ref. Seq. Accession ID | B-Cell Epitope Sequence | VaxiJen Score |
---|---|---|
YP_009724393.1 (M) | 105 RTRSMWSFNPETN 117 (epitope 1) | 1.00 |
168 ITVATSRTLSYYKLGASQRVAGDSGFAA 195 (epitope 2) | 0.53 | |
YP_009724397.2 (N) | 354 NKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADM 400 (epitope 1) | 0.52 |
177 RGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGG 215 (epitope 2) | 0.74 | |
YP_009724390.1 (Spike) | 65 FHAIHVSGTNG 75 (epitope 1) | 0.88 |
10 LVSSQCVNLTTRT 22 (epitope 2) | 1.19 | |
YP_009725255.1 (ORF10) | 28 AQVDVVNFNLT 38 | 1.34 |
NCBI Ref. Seq. Accession ID | T-Cell Epitope Sequence (Responsive T Cell) | VaxiJen Score | IFNepitope | HLA Coverage (CD8+)/ MCP*(CD4+) |
---|---|---|---|---|
(nsp3) YP_009724389.1 | 1437 TLNDLNETL 1445 (CD8) (epitope 1) | 0.75 | + | 12/12 |
2351 FSYFAVHFISNSWLM 2365 (CD4) (epitope 2) | 0.41 | + | 9.9 | |
2901 KLIEYTDFA 2909 (CD8) (epitope 3) | 1.27 | + | 12/12 | |
(nsp4) YP_009724389.1 | 3151 KHFYWFFSNYLKRRV 3165 (CD4) | 0.41 | + | 2.0 |
(nsp6) YP_009724389.1 | 3666 WLDMVDTSL 3674 (CD8) | 1.11 | + | 12/12 |
(Spike) YP_009724390.1 | 258 WTAGAAAYY 266 (CD8) | 0.63 | + | 12/12 |
(ORF3a) YP_009724391.1 | 66 KKRWQLALSKGVHFV 80 (CD4) | 0.81 | + | 4.8 |
(ORF10) YP_009725255.1 | 27 IAQVDVVNF 35 (CD8) | 0.90 | + | 12/12 |
Protein Name | Site Mutation Density | Highest Frequent Replacement | New Epitope Sequence | VaxiJen Score |
---|---|---|---|---|
Spike | 0.210 | L18F | LVSSQCVNFTTRT (Epitope 1) | 1.4 |
0.016 | R21I | LVSSQCVNLTTIT (Epitope 1) | 1.0 | |
− | L18F/R21I | LVSSQCVNFTTIT (Epitope 1) | 1.2 | |
0.024 | A262S | WTAGSAAYY (Epitope 2) | 0.60 | |
M | 0.012 | T175M | ITVATSRMLSYYKLGASQRVAGDSGFAA | 0.44 |
ORF3a | 0.026 | K75N | KKRWQLALSNGVHFV | 0.70 |
ORF10 | 0.437 | V30L | IAQLDVVNF | 0.94 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hisham, Y.; Ashhab, Y.; Hwang, S.-H.; Kim, D.-E. Identification of Highly Conserved SARS-CoV-2 Antigenic Epitopes with Wide Coverage Using Reverse Vaccinology Approach. Viruses 2021, 13, 787. https://doi.org/10.3390/v13050787
Hisham Y, Ashhab Y, Hwang S-H, Kim D-E. Identification of Highly Conserved SARS-CoV-2 Antigenic Epitopes with Wide Coverage Using Reverse Vaccinology Approach. Viruses. 2021; 13(5):787. https://doi.org/10.3390/v13050787
Chicago/Turabian StyleHisham, Yasmin, Yaqoub Ashhab, Sang-Hyun Hwang, and Dong-Eun Kim. 2021. "Identification of Highly Conserved SARS-CoV-2 Antigenic Epitopes with Wide Coverage Using Reverse Vaccinology Approach" Viruses 13, no. 5: 787. https://doi.org/10.3390/v13050787
APA StyleHisham, Y., Ashhab, Y., Hwang, S.-H., & Kim, D.-E. (2021). Identification of Highly Conserved SARS-CoV-2 Antigenic Epitopes with Wide Coverage Using Reverse Vaccinology Approach. Viruses, 13(5), 787. https://doi.org/10.3390/v13050787