Next Article in Journal
Detection and Phylogenetic Analyses of Taura Syndrome Virus from Archived Davidson’s-Fixed Paraffin-Embedded Shrimp Tissue
Next Article in Special Issue
Identification of Epidemiological Traits by Analysis of SARS−CoV−2 Sequences
Previous Article in Journal
Transmission of the Bean-Associated Cytorhabdovirus by the Whitefly Bemisia tabaci MEAM1
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Identification and Distribution of Novel Cressdnaviruses and Circular Molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula

1
Department of Zoology, University of Oxford, South Parks Road, Oxford OX1 3SZ, UK
2
The Biodesign Center for Fundamental and Applied Microbiomics, Center for Evolution and Medicine, School of Life Sciences, Arizona State University, Tempe, AZ 85287-5001, USA.
3
Faculty of Science and Technology, University of the Faroe Islands, Vestarabryggja 15, FO-100 Tórshavn, Faroe Islands
4
Department of Evolutionary Biology and Environmental Studies, University of Zurich, Winterthurerstrasse 190, 8057 Zurich, Switzerland
5
Structural Biology Research Unit, Department of Integrative Biomedical Sciences, University of Cape Town, Observatory, Cape Town 7701, South Africa
*
Authors to whom correspondence should be addressed.
Viruses 2020, 12(9), 1029; https://doi.org/10.3390/v12091029
Submission received: 3 August 2020 / Revised: 11 September 2020 / Accepted: 14 September 2020 / Published: 16 September 2020
(This article belongs to the Special Issue Viromics)

Abstract

There is growing interest in uncovering the viral diversity present in wild animal species. The remote Antarctic region is home to a wealth of uncovered microbial diversity, some of which is associated with its megafauna, including penguin species, the dominant avian biota. Penguins interface with a number of other biota in their roles as marine mesopredators and several species overlap in their ranges and habitats. To characterize the circular single-stranded viruses related to those in the phylum Cressdnaviricota from these environmental sentinel species, cloacal swabs (n = 95) were obtained from King Penguins in South Georgia, and congeneric Adélie Penguins, Chinstrap Penguins, and Gentoo Penguins across the South Shetland Islands and Antarctic Peninsula. Using a combination of high-throughput sequencing, abutting primers-based PCR recovery of circular genomic elements, cloning, and Sanger sequencing, we detected 97 novel sequences comprising 40 ssDNA viral genomes and 57 viral-like circular molecules from 45 individual penguins. We present their detection patterns, with Chinstrap Penguins harboring the highest number of new sequences. The novel Antarctic viruses identified appear to be host-specific, while one circular molecule was shared between sympatric Chinstrap and Gentoo Penguins. We also report viral genotype sharing between three adult-chick pairs, one in each Pygoscelid species. Sequence similarity network approaches coupled with Maximum likelihood phylogenies of the clusters indicate the 40 novel viral genomes do not fall within any known viral families and likely fall within the recently established phylum Cressdnaviricota based on their replication-associated protein sequences. Similarly, 83 capsid protein sequences encoded by the viruses or viral-like circular molecules identified in this study do not cluster with any of those encoded by classified viral groups. Further research is warranted to expand knowledge of the Antarctic virome and would help elucidate the importance of viral-like molecules in vertebrate host evolution.

1. Introduction

Our knowledge of global viral diversity remains limited, with only a small fraction of viruses known to affect humans and wildlife having been properly described or studied. In the case of Antarctic associated viruses, only a speck of the proverbial iceberg of viral diversity has surfaced in modern research. The Antarctic Polar Front, the marine boundary between the Antarctic and sub-Antarctic waters formed in the Eocene, has played a part in the evolutionary divergence and high levels of endemism present in the Southern Ocean [1,2]. Penguins (Order: Sphenisciformes) are diving seabird mesopredators distributed across the islands and continental landmass of the Southern Ocean who form an important part of the avian biomass in the region.
Our understanding of diversity in the vertebrate hosts of the Antarctic region remains limited, with early research using serological techniques typically focusing on well-known avian and poultry pathogenic viruses associated with influenza, Newcastle Disease, and infectious bursal disease [3,4,5,6] or distemper viruses likely transferred from sled dogs to Antarctic pinnipeds [7,8]. A small number of symptomatic events linked to viruses, such as avian pox and “puffinosis-like” disease, have also been recorded in case reports [9,10,11]. Nonetheless, our knowledge of existing Antarctic vertebrate viruses beyond these reports remained constrained until the advent of high-throughput sequencing techniques, uncovering a growing number of viral genomes in the last decade, most recently reviewed by Smeele et al. [12] and complemented with the identification of RNA viruses in penguins and their ectoparasites [13].
Recent high-throughput sequencing metagenomic analysis of soil [14,15,16], lacustrine [17,18,19,20,21,22], marine [23,24,25], and ice-associated samples [26] in Antarctica have revealed robust viral profiles of genomes with novel characteristics. With an aim to uncover further viral diversity associated with penguins south of the Polar Front, we undertook a study to investigate the diversity of DNA viruses and viral-like circular molecules in four penguin species: The Adélie Penguin (Pygoscelis adeliae), Chinstrap Penguin (P. antarcticus), Gentoo Penguin (P. papua), and King Penguin (Aptenodytes patagonicus).
King Penguins are primarily sub-Antarctic seabirds with a circumpolar distribution on islands near the Polar Front. Adélie Penguins are considered true Antarctic, ice-loving birds, breeding along the entire Antarctic coast and southern islands of the Scotia Arc. Chinstrap Penguins, on the other hand, are restricted to South Georgia and the South Sandwich Islands, South Orkney Islands, South Shetland Islands, and Western Antarctic Peninsula. The widest-ranging penguin species is the Gentoo Penguin, with a circumpolar distribution that spans 46–66° S, breeding north and south of the Polar Front on Sub-Antarctic Islands and throughout the entire Scotia Arc and down the Western Antarctic Peninsula. Some of the four species, therefore, overlap in portions of their range and provide an opportunity to investigate circular single-stranded DNA viruses related to those in the phylum Cressdnaviricota [27] across sites and in sympatric breeders. We also evaluated whether viral sequences are shared between parent-chick pairs of Pygoscelid penguins.

2. Materials and Methods

2.1. Field Sampling

Between 22 December 2015 and 17 January 2016, a total of 95 cloacal swab samples were obtained as part of gastrointestinal microbial analysis from penguins. Since we had an archived sample set, we decided to determine the associated DNA viruses from the animals where none of the animals had any obvious signs of illness/disease at the 8 sites on Deception Island, the South Shetland Islands, South Georgia, and the Antarctic Peninsula (Supplementary Table S1, Supplementary Data 1). These consisted of 17 Adélie Penguins (Pygoscelis adeliae: 9 adults, 8 chicks), 32 Chinstrap Penguins (P. antarcticus: 21 adults, 11 chicks), 26 Gentoo Penguins (P. papua: 16 adults, 10 chicks), and 20 King Penguins (Aptenodytes patagonicus: 10 adults, 10 chicks) (Figure 1). Regular flocked swabs (Eswab™, Copan®, Murrieta, CA, USA) were used, stored in 1 mL of liquid Amies medium, which was stored frozen aside from transport with cold packs to the United Kingdom. Adult and juvenile King Penguins were sampled using a 2-person handling technique as they transited within the colony. Pygoscelid penguins were sampled in transit to or from the ocean, or where applicable, while on the nest in order to confirm chick-adult parentage, minimizing disturbance as much as possible and ensuring the parents returned to their chicks.
Sampling sites are shown in Figure 1, and details are found in Supplementary Table S1 and Supplementary Data 1. All sampling carried out in the Antarctic Treaty Area was performed in accordance with United Kingdom Home Office guidelines, under permits granted by the United Kingdom Foreign and Commonwealth Office (permits S3 04/2014 and S7 03/2014) and in South Georgia under permits granted by the Government of South Georgia and the South Sandwich Islands (RAP-2015-018), with ethical approval from the University of Oxford Animal Welfare and Ethical Review Board. All samples were transported in accordance with applicable export permits and United Kingdom Department for Environment, Food, and Rural Affairs import permits.

2.2. Viral Extraction and High-Throughput Sequencing Analysis

Viral DNA was extracted from 200 µL of the swab suspension after vortexing, using the High Pure Viral Nucleic Acid Kit (Roche Diagnostics, Indianapolis, IN, USA). Following viral DNA extraction, circular DNA was preferentially amplified by rolling circle amplification (RCA) using the TempliPhi™ 100 Amplification Kit (GE Healthcare, Chicago, IL, USA). An aliquot of the resulting RCA-amplified DNA (5 µL) was pooled based on animal species per site and used to generate Illumina sequencing libraries using the Nextera DNA Flex Library Prep Kit (Illumina Inc, San Diego, CA, USA). The libraries were sequenced on an Illumina 4000 sequencer (2 × 100 bp library) and the resulting paired-end raw reads were trimmed using Trimmomatic [28] with default settings. The trimmed reads were de novo assembled using metaSPAdes v 3.12.0 [29]. All assembled contigs >500 nts were analyzed against a viral RefSeq [30] protein database using BLASTx [31]. Circular contigs were determined based on terminal redundancy. A summary of the read counts and contigs > 500 nts per sample sequenced is provided in Supplementary Table S2. The raw reads have been deposited in SRA (SRX9081836–SRX9081846).

2.3. Recovery and Sequencing of Viral Genomes and Viral-Like Circular Elements

There were 28 cressdnavirus-like contigs identified, and these were used to design abutting primer pairs (Supplementary Table S3) for the recovery of complete viral genomes by PCR. The specific primers pairs, together with KAPA HiFi HotStart DNA Polymerase (Kapa Biosystems, Wilmington, MA, USA), were used to screen and amplify the virus genomes and viral-like elements from each sample, using the thermal cycling protocol recommended by the manufacturer with an annealing temperature of 60 °C and 0.5 µL of the RCA product. The resulting amplicons were resolved on a 0.7% agarose gel, excised, purified, and cloned into pJET1.2 plasmid (ThermoFisher, Waltham, MA, USA). The recombinant plasmids were Sanger-sequenced by primer walking at Macrogen Inc. (Seoul, Korea), and contigs assembled using Geneious Prime [32].

2.4. Bioinformatic Analyses of Recovered Viral Genomes and Viral-Like Elements

The open reading frames (ORFs) in the viral genomes and viral-like elements were identified using ORFfinder (https://www.ncbi.nlm.nih.gov/orffinder/) and annotated using Geneious Prime [32]. All pairwise identities (genome-wide and protein) were determined using SDTv1.2 [33].
A dataset of the replication-associated proteins (Rep) encoded by the members of the recently established phylum Cressdnaviricota [27], i.e., alphasatellites, circoviruses, geminiviruses, genomoviruses, nanoviruses, redondoviruses, and smacoviruses was assembled with sequences available in GenBank. This dataset was clustered with a 0.9 sequence identity cut-off using CD-HIT [34] and a representative from each cluster was used to build a Rep-CRESS dataset together with all the Rep sequences of unclassified CRESS DNA viruses and plasmids analyzed in Kazlauskas et al. [35]. The Rep-CRESS dataset, together with 54 Reps from this study, was used to generate a sequence similarity network (SSN) analysis using EST-EFI [36,37] with a minimum similarity score of 60. The SSN was visualized in an organic layout with Cytoscape V3.7.1 [38].
Similarly, a capsid protein (CP) dataset of the CPs encoded by circoviruses, geminiviruses, genomoviruses, nanoviruses, redondoviruses, and smacoviruses was assembled and clustered with a 0.9 sequence identity cut-off using CD-HIT [34]. Representative sequences from each cluster were assembled together with the RNA virus CP sequences (since they have similarities to some CRESS DNA virus CPs) of tombusviruses (n = 54; derived from RefSeq), albetoviruses (n = 3; derived from RefSeq), all CPs of unclassified CRESS DNA viruses, and 84 CPs from this study to build a CP-CRESS-albeto-tombus dataset. The CP-CRESS-albeto-tombus dataset was used to generate a sequence similarity network (SSN) analysis using EST-EFI [36,37] with a minimum similarity score of 10. The SSN was visualized in an organic layout with Cytoscape V3.7.1 [38].
Sequences within a network cluster that included sequences from this study were extracted and aligned using MAFFT [39,40]. The alignments were trimmed using TrimAl [41] with a gappy option, and the resulting alignments were used to determine the best amino acid substitution model using ProtTest [42] and infer Maximum likelihood (ML) phylogenetic trees with aLRT branch support. All trees were mid-point rooted, and branches with <0.8 aLRT support were collapsed using TreeGraph2 [43]. The trees were visualized using iTOL v4 [44].
Species-level sequence alignments of Antarctic viruses (AntVs) and Antarctic circular molecules (AntCMs) identified in this study were used to identify any evidence of recombination using RDP4 v.4.97 [45] with default settings. Only events that were detected by 3 or more recombination detection methods implemented in RDP v4.97 with p-values < 0.05 were accepted as credible.

3. Results and Discussion

3.1. Identification of Viruses and Viral-Like Molecules from Cloacal Swabs

We identified 28 cressdnavirus-like contigs >500 nts from the de novo assembled sequences from pooled samples per species per site that had similarity to viral sequences. In addition, we identified 24 bacteriophage-like contigs (8 inovirus-like, 11 microvirus-like, 1 mycovirus-like, podovirus-like, and 3 siphovirus-like). For the purpose of this study, we focused on the likely eukaryotic viruses that were most closely related to those in the phylum Cressdnaviricota. Using abutting primers designed from the de novo assembled contigs, we amplified, cloned, and Sanger-sequenced 40 viral genomes (with detectable Rep and CP-coding ORFs) and 57 viral-like elements. The 40 viral genomes (2322–2729 nts; GenBank accession numbers MT196222–MT196223, MT196247–MT196250, MT196252–MT196253, MT196261, MT196279, MT196289–MT196318) did not fall within any known viral families, and based on their Rep sequences, would be part of the expanding unclassified circular Rep-encoding single-stranded (CRESS) DNA viruses within the recently established phylum Cressdnaviricota [27]. The phylum Cressdnaviricota includes seven viral families (Bacilladnaviridae, Circoviridae, Geminiviridae, Genomoviridae, Nanoviridae, Redondoviridae and Smacoviridae), the Reps of the satellite nucleic acids in the family Alphasatellitidae, and a suite of viral groups that have been loosely labeled CRESS DNA viruses. Within these named viral families in the order Cressdnaviricota, only two Penguin circovirus genomes (family Circoviridae) had previously been recovered from this same sample set, found in a Chinstrap Penguin and an Adélie Penguin [46]. CRESS DNA viruses that cannot be classified into the eight families above have been identified primarily through viral metagenomic approaches from a variety of samples, including animal tissues, as highlighted in the recent report by Tisza et al. [47], fecal samples [48,49,50] and environmental samples including plant leaves [51], soil [52], wastewater [53,54,55], seawater [56], freshwater [57], and sea spray [58]. In Antarctica, CRESS DNA viruses have been identified from cryoconite samples from the dry valley [26], Adélie and Chinstrap penguin fecal and cloacal swab samples [46,59], lake samples [17], and a pond sample [22].
Of 57 circular viral-like elements identified in this study, one viral-like element (1982 nts; MT196283) encodes a CP and a partial Rep (missing the N terminus, which is the endonuclease domain) and two additional unknown proteins, while eight (1243–2181 nts; MT196267–MT196271, MT196283, MT196286–MT196287) encode only a Rep. Six of the circular viral-like elements (2646–4800 nt; MT196226, MT196234-MT196236, MT196251, MT196288) encode Reps more similar to plasmid Reps. Finally, 43 viral-like elements (1759–2274 nts; MT196224–MT196225, MT196227–MT196233, MT196235–MT196254, MT19660, MT196262–MT196266, MT196272–MT196278, MT196280–MT196282, MT196284–MT196285) encode a CP and an unknown protein (Figure 2).
For the purpose of this study, we adopted an 80% genome-wide pairwise identity cutoff (similar to other CRESS DNA viruses) as a putative species demarcation cutoff and 98% identity for genotypes (Supplementary Data 2). Thus, 40 viral genomes represent 6 tentative species (labeled as Antarctic viruses, AntV 1–6) and 12 genotypes (Table 1). The circular molecules (labeled as Antarctic circular molecules, AntCM 1–12) can be split into 12 species and 15 genotypes (Table 1).
A preliminary BLASTn based analysis revealed that only AntCM3, -4, -5, -6, -7, -9, 10 and -12 have hits with >20% sequence coverage to viral-like sequences identified in sea water samples from Saanich Inlet (BC, Canada) [56], fish and abalone tissue [47]. The results of this are summarized in Table 2. JX904537 does not have annotated ORFs thus, is not included in the coding sequence analysis in this study.

3.2. Distribution of Viruses and Viral-Like Molecules across Sampling Sites and Penguin Species

Of 95 swab samples tested in this study, the 97 viral genomes and circular molecules were recovered from 45 individuals (2/17 Adélie Penguins, 24/32 Chinstrap Penguin, 6/26 Gentoo Penguins, and 13/20 King Penguins) with at least one AntV or AntCM (Table 1; Figure 2).
The 40 AntVs were recovered across the four penguin species (Table 1). From the 57 AntCMs recovered, 8 sequences that encode Reps were recovered only from Chinstrap Penguins while the other 49 sequences were recovered from Chinstrap Penguins and one Gentoo Penguin (Table 1; Figure 2).
AntCMs (12 species/15 genotypes) were found in 19/32 individual Chinstrap Penguins sampled and in a single Gentoo Penguin (Table 1; Figure 2). Seven AntCM genotypes were found in multiple individuals, with three genotypes shared across the two Chinstrap colonies sampled in the South Shetland Islands. AntCV6 genotype I was found in 100% (n = 10) of Chinstrap Penguins shared between Chinstrap Penguin parents and their chicks at Baily Head, Deception Island. One set of AntCM genotypes with a bacterial rep (AntCM8 genotype I and AntCM8 genotype II) at the edge of the species threshold (78.8–79.1% genome-wide identity) were found at two sites 290 km apart (Booth Island, Western Antarctic Peninsula and Deception Island, South Shetland Islands). AntCM8 genotype II was unique in this study as being the only genotype found in two distinct host species: An adult Gentoo Penguin and two adult Chinstrap Penguins nesting at the same colony on Booth Island, with >99.9% shared genome-wide identity. One of these adult Chinstrap Penguins was recently found also to carry a penguin circovirus [46]. Three species (each as a single genotype) of Antarctic circular molecules that encode Reps (AntCM10–12) were identified in this sample set, all from a single Chinstrap colony in the South Shetland Islands, where two genotypes, those which only contain a rep gene (rep: 963–1335 nts), were found in multiple individuals. The other genotype, AntCM11, found in a single Chinstrap Penguin, contained a cp gene (960 nts), an unknown ORF, and a partial rep (459 nts).
Among the AntVs (6 species/12 genotypes), each genotype was only detected in a single host species, with five only found in Chinstrap Penguins, one in Adélie Penguins, one in Gentoo Penguins, and five in King Penguins. Each Antarctic virus sequence was only found at a single site, though 8/12 genotypes were found in multiple individuals at those sites (Figure 2). AntV3 has five genotypes, two of which (genotype III and IV) were only found in King Penguins from South Georgia, sharing 82.5–94.5% genome-wide identity with the three genotypes (genotype I, II and V) found only in Chinstrap Penguins from Deception Island (Supplementary Data 1), sites separated by approximately ~1700 km of the Southern Ocean (Figure 1, Supplementary Table S1). This suggests that this virus is broadly distributed across the Scotia Arc.
Cases of parent-chick viral genotype sharing were found in each Pygoscelid species. AntV1 genotype II was found in one Chinstrap Penguin adult/chick pair at Georges Point (Western Antarctic Peninsula), whereas AntV6 was shared in one Adélie Penguin adult/chick pair on Booth Island (Western Antarctic Peninsula). AntV2 was identified in five Gentoo Penguin individuals from Yankee Harbor in the South Shetland Islands, including an adult/chick pair (Figure 2, Table 1, and Supplementary Data 1). King Penguin chicks had already fledged during sampling, thus parentage could not be determined in this sample set. In those cases where penguin parents and their chicks both share the same viruses, future studies have to be conducted to observe if those were vertically or horizontally transmitted.
Co-occurrence of these novel AntVs and AntCMs was noted in 14/32 Chinstrap Penguins (2–6 sequences per individual), while 11/20 King Penguins carried two or more viral sequences (maximum of 3 sequences in one chick) (Figure 2, Supplementary Table S1). At this time, we are unable to discern whether the presence or co-occurrence of one or more AntVs or AntCMs indicates that these infect penguins, cause decreased fitness in the hosts, or are penguin-associated through trophic transfer.

3.3. Analyses of the Replication-Associated Protein

The hallmarks of the Rep protein are the endonuclease and helicase domains that are involved in the initiation of replication in ssDNA viruses, and to some extent, in bacterial plasmids (reviewed in Kazlauskas et al. [35] and Rosario et al. [60]). The Reps encoded by the AntVs (n = 40) have the rolling circle replication (RCR) endonuclease domain and the super family 3 (SF3) helicase motifs (Table 3). Thirteen of the 14 and AntCMs also have the RCR domain and SF3 motifs. AntCM11, which has a partial Rep, is missing the RCR domain and the Arg finger domain (Table 3).
Since we identified six AntCMs with Reps that are most closely related to those of plasmids, we included a suite of plasmids grouped by Kazlauskas et al. [35] for clustering the Reps using a sequence similarity network (SSN) based approach. We have found in the past [26,61,62] that an SSN analysis using EST-EFI [36,37] with a network threshold of 60 allows for reasonable family level clusters for families in the phylum Cressdnaviricota [27]. Based on the sequence similarity network analysis of the Rep amino acid sequences (Figure 3), none of the AntV Reps cluster with known viral sequences. A vast majority of the AntV Reps (n = 33) are part of a large cluster of Reps (n = 213). The 33 AntV Reps within this cluster are distributed within 3 clades in the ML phylogenetic tree (RtREV+I+G+F amino acid substitution model; Figure 3). One of the clades (Clade I in Figure 3) includes Reps of AntCM10. The second clade (Clade II in Figure 3) includes Reps of AntV6. The Reps of AntV3, -4 and -5 are represented in Clade III (Figure 3), forming a well-supported clade and share >72% amino acid identity. The Reps of AntCV3, -4 and-5 share < 60% amino acid identity with other Reps in this cluster. AntCV2 Reps, which share 100% amino acid identity, cluster with a Rep of Copepod LaCopCV (JF912805) sampled in Tampa Bay (Florida, USA) [63] sharing 46.8% amino acid identity. AntCV1 Reps cluster together: Those that are genotype I share 94.4–94.7% amino acid identity with genotype II (Figure 3). AntCM12 Reps cluster together sharing >97.3% amino acid identity. The AntCM11 with a partial Rep is a singleton sharing 44.1% amino acid identity to a Rep of a virus (MN928918) from a cloacal swab of an Indian blue peafowl (Pavo cristatus).
The plasmid-like Reps of AntCM1, -2 and -8 do not cluster with the plasmids (pCRESS) grouped by [35] and form two clusters, one of two Reps (AntCM1 and -2) sharing 44% pairwise amino acid identity and one of four Reps with AntCM8 genotype I Reps sharing 100% identity and collectively they share 59.6% identity with that of AntCM8 genotype II (Figure 3).

3.4. Analyses of the Capsid Protein

In general, for viruses in the phylum Cressdnaviricota, the CPs are more diverse than the Reps. Furthermore, the CPs of geminiviruses share homology to those of albetoviruses (linear ssRNA(+) genomes) [65], and a group of unclassified cressdnavirues have CPs that are homologous to those of tombusviruses (linear ssRNA(+) genomes) [64,66,67,68].
The SSN analysis of the CPs reveals that AntCM11 CP clusters with those of smacoviruses and smacovirus-like CPs (n = 175) sharing < 33% identity (Figure 4). In a ML phylogenetic tree (amino acid substitution model LG+I+G+F), AntCM11 CP is part of a well-supported clade (Clade I, Figure 4). The remaining 83 CPs identified in this study cluster with none of the classified viral groups.
The CPs of AntCM3, -4 and -9 are part of a cluster of 57 CPs sharing 46–57% amino acid identity. In the ML phylogenetic tree (amino acid substitution model rtRev+I+G+F) these CPs are part of a well-supported clade (clade II; Figure 4). The CP of AntCM3 is most closely related (sharing 76–79% amino acid identity) to that of MH648984 identified in a seabass tissue [47]. AntCM4 CP shares ~49% amino acid identity with the CP of MH649117 from a seabass tissue, whereas AntCM9 shares 69–77% amino acid identity with MH648943 (seabass tissue), MH616644 (red snapper tissue) and KX246262 (sea cucumber sample) [47,69].
The CPs of AntV3, -4, -5 and -6 are part of a cluster of 77 CPs but the CPs of AntV6 (Clade III) are part of a distinct clade in the ML phylogenetic tree (amino acid substitution model LG+I+G+F) that is different from the one of AntV3, -4 and -5 (Figure 4). AntCV6 CPs share ~40% amino acid identity with the CP of MH616953 from rainbow trout tissue [47]. The CPs of AntV3, -4, and -5 share >61% amino acid identity and less that 40% identity with other CPs within the cluster.
The CPs of AntCM5, -6 and -7 are part of the same cluster composed of 108 CPs and form two distinct clades in the ML phylogenetic tree (amino acid substitution model LG+I+G+F) with AntCM5 and -6 CPs being part of the same clade (clade V; Figure 4) sharing ~40% amino acid identity. AntCM5 CP shares the highest amino acid identity (~73%) with the CPs of MH510272 and MH617705 both from seabass tissue [47]. On the other hand, the CPs of AntCM6 share the highest amino acid identity (~46%) with the CPs of MH617236 and MH617624 identified in abalone and red snapper tissue, respectively [47]. When compared to other CPs in this cluster, CPs of AntCM7 are part of a smaller clade (clade VI; Figure 4), sharing the highest amino acid identity of 77.6% with the CP of MH616694 and MH617624 of a viral sequence identified in abalone tissue [47].
AntV1 and -2 CPs form distinct clusters, each sharing 99.3–99.8 and 100% pairwise identity, respectively (Figure 4). The CPs of AntV2 (from translation using the ciliate translation table) share the highest identity (35%) with CP-like element MK012509 from crucian carp tissue, whereas those of AntCV1 share ~27% with a CP-like element of MH648877 from seabass tissue [47]. Although the CPs from this study have a high degree of sequence diversity, it is interesting to note they are more closely related to other CPs of viruses identified in the marine ecosystem in which penguins play important roles.

3.5. Recombination Analysis

The AntVs and AntCMs were aligned using MAFFT [39] at a species level, and these were used to identify evidence of recombination using RDP4 v.4.97 [45]. We identified evidence of recombination in genomes of AntV3 and -4, and AntCM3 (Figure 5). For AntV3, two recombination events were identified, one spanning ~46% of the genome, with genotype I being the recombinant, with the recombinant region derived from genotypes III and IV. The AntV3 genotype III has a 198 nts recombinant region from the non-coding region of an unknown/unsampled viral sequence. Five variants of AntV4 genotype II have a ~290 nts recombinant region in the non-coding region derived from AntV4 genotype I. AntCM3 genotype II has two recombinant regions, both derived from genotype III and in total they account for 46% of the sequence. The second smaller recombinant region of ~180 nts is found in two AntCM3 genotype I variants as well (Figure 5). Evidence of recombination between these viruses and circular molecules indicates host commonality.

4. Concluding Remarks

The overall knowledge of penguin-associated viruses is limited, and thus it is not surprising that penguin disease understanding also remains limited to observations of mass mortality events, case reports, and veterinary knowledge obtained from captive animals, reviewed in Smeele et al. [12], Barbosa and Palacios [70], Clarke and Kerry [71], Woods et al. [72], and Grimaldi et al. [73]. Advances in high-throughput sequencing have shown that penguins are associated with a number of (pathogenic or non-pathogenic) viruses not previously detected through serological means [59,74,75,76,77,78,79,80,81]. Studies such as these to directly detect nucleic acid presence in animal hosts add to our baseline knowledge, which still remains constrained by sampling effort.
In this study, the viruses and circular molecules that we identify are novel, and thus we are unable to distinguish whether penguins serve as the hosts for replication of these viruses, as they may enter the penguin gastrointestinal tract through prey consumption, indirectly through the consumption of phytoplankton or zooplankton by penguin prey, or through ingestion of ocean water. Based on the CP network analysis, it does appear that some of the CPs identified in this study have homologs in sequences derived from various marine fish. Further investigation into viral presence in other mesopredators, such as flying seabirds and pinnipeds, along with cetaceans, may help elucidate whether relationships exist among these molecules. Coupled with long-term monitoring studies of individual animals and sites in the rapidly changing Antarctic, detection of potential disease-causing agents will inform conservation management and biosecurity.

Supplementary Materials

The following are available online at https://www.mdpi.com/1999-4915/12/9/1029/s1, Supplementary Table S1. Sampling site details and coordinates for four penguin species, along with cloacal swabs obtained in terms of total numbers of individuals, and breakdown by adults and chicks; Supplementary Table S2: Summary of the reads from the HTS; Supplementary Table S3: Summary of AntV and AntCM sequences identified in this study together with the sampling date, location, host, and the primer pairs used to recover the sequences. Supplementary Data 1: Details of cloacal swab samples of the four penguin species. Supplementary Data 2: Pairwise identity matrix for determination of AntV and AntCM species and genotypes.

Author Contributions

Conceptualization, H.L., A.D., T.H., A.L.S., A.V.; methodology, H.L., R.S.F., C.H., C.S., K.S., S.K., A.D., C.E.B., T.H., A.L.S., A.V.; validation, H.L., R.S.F., C.H., C.S., K.S., S.K., A.V.; formal analysis, H.L., R.S.F., C.H., C.S., K.S., S.K., A.D., C.E.B., T.H., A.L.S., A.V.; investigation, H.L., R.S.F., C.H., C.S., K.S., S.K., A.D., C.E.B., T.H., A.L.S., A.V.; resources, T.H., A.L.S., A.V.; data curation, H.L., R.S.F., A.V.; writing—original draft preparation, H.L., A.L.S., A.V.; writing—review and editing, H.L., R.S.F., C.H., C.S., K.S., S.K., A.D., C.E.B., T.H., A.L.S., A.V.; visualization, H.L., A.D., A.V.; supervision, H.L., T.H., A.L.S., A.V.; project administration, H.L., T.H., A.L.S., A.V.; funding acquisition, H.L., T.H., A.L.S., A.V. All authors have read and agreed to the published version of the manuscript.

Funding

We thank Quark Expeditions for logistical and financial support provided the Penguin Watch project at the University of Oxford, much of the sampling was carried out under Darwin Funding (DPLUS002) awarded to TH. The molecular work described in this study was supported by the Center of Evolution and Medicine Venture Fund (Center of Evolution and Medicine, Arizona State University, U.S.A.) grant awarded to AV. HL’s work was supported by a University of Oxford Clarendon Fund Scholarship.

Conflicts of Interest

The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.

References

  1. Cole, T.L.; Dutoit, L.; Dussex, N.; Hart, T.; Alexander, A.; Younger, J.L.; Clucas, G.V.; Frugone, M.J.; Cherel, Y.; Cuthbert, R.; et al. Receding ice drove parallel expansions in Southern Ocean penguins. Proc. Natl. Acad. Sci. USA 2019, 166, 26690–26696. [Google Scholar] [CrossRef] [Scilit]
  2. Gavryushkina, A.; Heath, T.A.; Ksepka, D.T.; Stadler, T.; Welch, D.; Drummond, A.J. Bayesian Total-Evidence Dating Reveals the Recent Crown Radiation of Penguins. Syst. Biol. 2017, 66, 57–73. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Gardner, H.; Kerry, K.; Riddle, M.; Brouwer, S.; Gleeson, L. Poultry virus infection in Antarctic penguins. Nature 1997, 387, 245. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Watts, J.M.; Miller, G.D.; Shellam, G.R. Infectious Bursal Disease Virus and Antarctic Birds; Springer: Berlin/Heidelberg, Germany, 2009; pp. 95–105. [Google Scholar]
  5. Morgan, I.R.; Westbury, H.A. Virological studies of Adelie Penguins (Pygoscelis adeliae) in Antarctica. Avian Dis. 1981, 25, 1019–1026. [Google Scholar] [CrossRef] [Scilit]
  6. Austin, F.J.; Webster, R.G. Evidence of ortho- and paramyxoviruses in fauna from Antarctica. J. Wildl. Dis. 1993, 29, 568–571. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Bengtson, J.L.; Boveng, P.; Franzen, U.; Have, P.; Heidejorgensen, M.P.; Harkonen, T.J. Antibodies to Canine-Distemper Virus in Antarctic Seals. Mar. Mammal Sci. 1991, 7, 85–87. [Google Scholar] [CrossRef] [Scilit]
  8. McFarlane, R.A. Health Assessment and Diseases of the Weddell seal, Leptonochotes weddelli, in Vestfold Hills, East Antarctica. In Health of Antarctic Wildlife; Kerry, K.R., Riddle, M., Eds.; Springer: Berlin/Heidelberg, Germany, 2009. [Google Scholar]
  9. Mac Donald, J.W.; Conroy, J.W.H. Virus Disease Resembling Puffinosis in the Gentoo Penguin Pygoscelis papua on Signy Island South Orkney Islands. British Antarct. Surv. Bull. 1971, 26, 80–82. [Google Scholar]
  10. Munro, G. Outbreak of Avian Pox Virus in Gentoo Penguins in the Falklands; Falklands Conservation: Stanley, Falkland Islands, 2006. [Google Scholar]
  11. Pistorius, P.A. Falkland Island Seabird Monitoring Programme. Annual Report 2008/2009; Falklands Conservation: Stanley, Falkland Islands, 2009. [Google Scholar]
  12. Smeele, Z.E.; Ainley, D.G.; Varsani, A. Viruses associated with Antarctic wildlife: From serology based detection to identification of genomes using high throughput sequencing. Virus Res. 2018, 243, 91–105. [Google Scholar] [CrossRef] [Scilit]
  13. Wille, M.; Harvey, E.; Shi, M.; Gonzalez-Acuna, D.; Holmes, E.C.; Hurt, A.C. Sustained RNA virome diversity in Antarctic penguins and their ticks. ISME J. 2020, 14, 1768–1782. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Adriaenssens, E.M.; Kramer, R.; Van Goethem, M.W.; Makhalanyane, T.P.; Hogg, I.; Cowan, D.A. Environmental drivers of viral community composition in Antarctic soils identified by viromics. Microbiome 2017, 5, 83. [Google Scholar] [CrossRef] [Scilit]
  15. Zablocki, O.; van Zyl, L.; Adriaenssens, E.M.; Rubagotti, E.; Tuffin, M.; Cary, S.C.; Cowan, D. Niche-dependent genetic diversity in Antarctic metaviromes. Bacteriophage 2014, 4, e980125. [Google Scholar] [CrossRef] [Scilit]
  16. Zablocki, O.; van Zyl, L.; Adriaenssens, E.M.; Rubagotti, E.; Tuffin, M.; Cary, S.C.; Cowan, D. High-level diversity of tailed phages, eukaryote-associated viruses, and virophage-like elements in the metaviromes of antarctic soils. Appl. Environ. Microbiol. 2014, 80, 6888–6897. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Lopez-Bueno, A.; Tamames, J.; Velazquez, D.; Moya, A.; Quesada, A.; Alcami, A. High diversity of the viral community from an Antarctic lake. Science 2009, 326, 858–861. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Yau, S.; Lauro, F.M.; DeMaere, M.Z.; Brown, M.V.; Thomas, T.; Raftery, M.J.; Andrews-Pfannkoch, C.; Lewis, M.; Hoffman, J.M.; Gibson, J.A.; et al. Virophage control of antarctic algal host-virus dynamics. Proc. Natl. Acad. Sci. USA 2011, 108, 6163–6168. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Rastrojo, A.; Alcamí, A. Chapter Two—Viruses in Polar Lake and Soil Ecosystems. In Advances in Virus Research; Malmstrom, C.M., Ed.; Academic Press: Cambridge, MA, USA, 2018; Volume 101, pp. 39–54. [Google Scholar]
  20. de Carcer, D.A.; Lopez-Bueno, A.; Alonso-Lobo, J.M.; Quesada, A.; Alcami, A. Metagenomic analysis of lacustrine viral diversity along a latitudinal transect of the Antarctic Peninsula. FEMS Microbiol. Ecol. 2016, 92, fiw074. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. Yau, S.; Seth-Pasricha, M. Viruses of Polar Aquatic Environments. Viruses 2019, 11, 189. [Google Scholar] [CrossRef] [Scilit]
  22. Zawar-Reza, P.; Arguello-Astorga, G.R.; Kraberger, S.; Julian, L.; Stainton, D.; Broady, P.A.; Varsani, A. Diverse small circular single-stranded DNA viruses identified in a freshwater pond on the McMurdo Ice Shelf (Antarctica). Infect. Genet. Evol. 2014, 26, 132–138. [Google Scholar] [CrossRef] [Scilit]
  23. Gong, Z.; Liang, Y.; Wang, M.; Jiang, Y.; Yang, Q.; Xia, J.; Zhou, X.; You, S.; Gao, C.; Wang, J.; et al. Viral Diversity and Its Relationship with Environmental Factors at the Surface and Deep Sea of Prydz Bay, Antarctica. Front. Microbiol. 2018, 9, 2981. [Google Scholar] [CrossRef] [Scilit]
  24. Brum, J.R.; Ignacio-Espinoza, J.C.; Roux, S.; Doulcier, G.; Acinas, S.G.; Alberti, A.; Chaffron, S.; Cruaud, C.; de Vargas, C.; Gasol, J.M.; et al. Ocean plankton. Patterns and ecological drivers of ocean viral communities. Science 2015, 348, 1261498. [Google Scholar] [CrossRef] [Scilit]
  25. Miranda, J.A.; Culley, A.I.; Schvarcz, C.R.; Steward, G.F. RNA viruses as major contributors to Antarctic virioplankton. Environ. Microbiol. 2016, 18, 3714–3727. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Sommers, P.; Fontenele, R.S.; Kringen, T.; Kraberger, S.; Porazinska, D.L.; Darcy, J.L.; Schmidt, S.K.; Varsani, A. Single-Stranded DNA Viruses in Antarctic Cryoconite Holes. Viruses 2019, 11, 1022. [Google Scholar] [CrossRef] [Scilit]
  27. Krupovic, M.; Varsani, A.; Kazlauskas, D.; Breitbart, M.; Delwart, E.; Rosario, K.; Yutin, N.; Wolf, Y.I.; Harrach, B.; Zerbini, F.M.; et al. Cressdnaviricota: A Virus Phylum Unifying Seven Families of Rep-Encoding Viruses with Single-Stranded, Circular DNA Genomes. J. Virol. 2020, 94. [Google Scholar] [CrossRef] [Scilit]
  28. Bolger, A.M.; Lohse, M.; Usadel, B. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 2014, 30, 2114–2120. [Google Scholar] [CrossRef] [Scilit]
  29. Bankevich, A.; Nurk, S.; Antipov, D.; Gurevich, A.A.; Dvorkin, M.; Kulikov, A.S.; Lesin, V.M.; Nikolenko, S.I.; Pham, S.; Prjibelski, A.D.; et al. SPAdes: A new genome assembly algorithm and its applications to single-cell sequencing. J. Comput. Biol. 2012, 19, 455–477. [Google Scholar] [CrossRef] [Scilit]
  30. O’Leary, N.A.; Wright, M.W.; Brister, J.R.; Ciufo, S.; McVeigh, D.H.R.; Rajput, B.; Robbertse, B.; Smith-White, B.; Ako-Adjei, D.; Astashyn, A.; et al. Reference sequence (RefSeq) database at NCBI: Current status, taxonomic expansion, and functional annotation. Nucleic Acids Res. 2016, 44, D733–D745. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  31. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
  32. Kearse, M.; Moir, R.; Wilson, A.; Stones-Havas, S.; Cheung, M.; Sturrock, S.; Buxton, S.; Cooper, A.; Markowitz, S.; Duran, C.; et al. Geneious Basic: An integrated and extendable desktop software platform for the organization and analysis of sequence data. Bioinformatics 2012, 28, 1647–1649. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Muhire, B.M.; Varsani, A.; Martin, D.P. SDT: A Virus Classification Tool Based on Pairwise Sequence Alignment and Identity Calculation. PLoS ONE 2014, 9, e108277. [Google Scholar] [CrossRef] [Scilit]
  34. Huang, Y.; Niu, B.; Gao, Y.; Fu, L.; Li, W. CD-HIT Suite: A web server for clustering and comparing biological sequences. Bioinformatics 2010, 26, 680–682. [Google Scholar] [CrossRef] [Scilit]
  35. Kazlauskas, D.; Varsani, A.; Koonin, E.V.; Krupovic, M. Multiple origins of prokaryotic and eukaryotic single-stranded DNA viruses from bacterial and archaeal plasmids. Nat. Commun. 2019, 10, 3425. [Google Scholar] [CrossRef] [Scilit]
  36. Zallot, R.; Oberg, N.O.; Gerlt, J.A. ‘Democratized’ genomic enzymology web tools for functional assignment. Curr. Opin. Chem. Biol. 2018, 47, 77–85. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Gerlt, J.A. Genomic Enzymology: Web Tools for Leveraging Protein Family Sequence-Function Space and Genome Context to Discover Novel Functions. Biochemistry 2017, 56, 4293–4308. [Google Scholar] [CrossRef] [Scilit]
  38. Shannon, P.; Markiel, A.; Ozier, O.; Baliga, N.S.; Wang, J.T.; Ramage, D.; Amin, N.; Schwikowski, B.; Ideker, T. Cytoscape: A software environment for integrated models of biomolecular interaction networks. Genome Res. 2003, 13, 2498–2504. [Google Scholar] [CrossRef] [Scilit]
  39. Katoh, K.; Standley, D.M. A simple method to control over-alignment in the MAFFT multiple sequence alignment program. Bioinformatics 2016, 32, 1933–1942. [Google Scholar] [CrossRef] [Scilit]
  40. Katoh, K.; Standley, D.M. MAFFT multiple sequence alignment software version 7: Improvements in performance and usability. Mol. Biol. Evol. 2013, 30, 772–780. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  41. Capella-Gutierrez, S.; Silla-Martinez, J.M.; Gabaldon, T. trimAl: A tool for automated alignment trimming in large-scale phylogenetic analyses. Bioinformatics 2009, 25, 1972–1973. [Google Scholar] [CrossRef] [Scilit]
  42. Darriba, D.; Taboada, G.L.; Doallo, R.; Posada, D. ProtTest 3: Fast selection of best-fit models of protein evolution. Bioinformatics 2011, 27, 1164–1165. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Stover, B.C.; Muller, K.F. TreeGraph 2: Combining and visualizing evidence from different phylogenetic analyses. BMC Bioinform. 2010, 11, 7. [Google Scholar] [CrossRef] [Scilit]
  44. Letunic, I.; Bork, P. Interactive Tree of Life (iTOL) v4: Recent updates and new developments. Nucleic Acids Res. 2019, 47, W256–W259. [Google Scholar] [CrossRef] [Scilit]
  45. Martin, D.P.; Murrell, B.; Khoosal, A.; Muhire, B. Detecting and Analyzing Genetic Recombination Using RDP4. Methods Mol. Biol. 2017, 1525, 433–460. [Google Scholar] [CrossRef] [Scilit]
  46. Levy, H.; Fiddaman, S.R.; Djurhuus, A.; Black, C.E.; Kraberger, S.; Smith, A.L.; Hart, T.; Varsani, A. Identification of Circovirus Genome in a Chinstrap Penguin (Pygoscelis antarcticus) and Adelie Penguin (Pygoscelis adeliae) on the Antarctic Peninsula. Viruses 2020, 12, 858. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Tisza, M.J.; Pastrana, D.V.; Welch, N.L.; Stewart, B.; Peretti, A.; Starrett, G.J.; Pang, Y.S.; Krishnamurthy, S.R.; Pesavento, P.A.; McDermott, D.H.; et al. Discovery of several thousand highly diverse circular DNA viruses. eLife 2020, 9. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Ng, T.F.; Zhang, W.; Sachsenroder, J.; Kondov, N.O.; da Costa, A.C.; Vega, E.; Holtz, L.R.; Wu, G.; Wang, D.; Stine, C.O.; et al. A diverse group of small circular ssDNA viral genomes in human and non-human primate stools. Virus Evol. 2015, 1, vev017. [Google Scholar] [CrossRef] [Scilit]
  49. Blinkova, O.; Victoria, J.; Li, Y.; Keele, B.F.; Sanz, C.; Ndjango, J.B.; Peeters, M.; Travis, D.; Lonsdorf, E.V.; Wilson, M.L.; et al. Novel circular DNA viruses in stool samples of wild-living chimpanzees. J. Gen. Virol. 2010, 91, 74–86. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Steel, O.; Kraberger, S.; Sikorski, A.; Young, L.M.; Catchpole, R.J.; Stevens, A.J.; Ladley, J.J.; Coray, D.S.; Stainton, D.; Dayaram, A.; et al. Circular replication-associated protein encoding DNA viruses identified in the faecal matter of various animals in New Zealand. Infect. Genet. Evol. 2016, 43, 151–164. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  51. Kraberger, S.; Farkas, K.; Bernardo, P.; Booker, C.; Arguello-Astorga, G.R.; Mesleard, F.; Martin, D.P.; Roumagnac, P.; Varsani, A. Identification of novel Bromus- and Trifolium-associated circular DNA viruses. Arch. Virol. 2015, 160, 1303–1311. [Google Scholar] [CrossRef] [Scilit]
  52. Reavy, B.; Swanson, M.M.; Cock, P.J.; Dawson, L.; Freitag, T.E.; Singh, B.K.; Torrance, L.; Mushegian, A.R.; Taliansky, M. Distinct circular single-stranded DNA viruses exist in different soil types. Appl Environ. Microbiol. 2015, 81, 3934–3945. [Google Scholar] [CrossRef] [Scilit]
  53. Phan, T.G.; Mori, D.; Deng, X.; Rajindrajith, S.; Ranawaka, U.; Fan Ng, T.F.; Bucardo-Rivera, F.; Orlandi, P.; Ahmed, K.; Delwart, E. Small circular single stranded DNA viral genomes in unexplained cases of human encephalitis, diarrhea, and in untreated sewage. Virology 2015, 482, 98–104. [Google Scholar] [CrossRef] [Scilit]
  54. Kraberger, S.; Arguello-Astorga, G.R.; Greenfield, L.G.; Galilee, C.; Law, D.; Martin, D.P.; Varsani, A. Characterisation of a diverse range of circular replication-associated protein encoding DNA viruses recovered from a sewage treatment oxidation pond. Infect. Genet. Evol. 2015, 31, 73–86. [Google Scholar] [CrossRef] [Scilit]
  55. Pearson, V.M.; Caudle, S.B.; Rokyta, D.R. Viral recombination blurs taxonomic lines: Examination of single-stranded DNA viruses in a wastewater treatment plant. Peer J. 2016, 4, e2585. [Google Scholar] [CrossRef] [Scilit]
  56. Labonte, J.M.; Suttle, C.A. Previously unknown and highly divergent ssDNA viruses populate the oceans. ISME J. 2013, 7, 2169–2177. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Dayaram, A.; Galatowitsch, M.L.; Arguello-Astorga, G.R.; van Bysterveldt, K.; Kraberger, S.; Stainton, D.; Harding, J.S.; Roumagnac, P.; Martin, D.P.; Lefeuvre, P.; et al. Diverse circular replication-associated protein encoding viruses circulating in invertebrates within a lake ecosystem. Infect. Genet. Evol. 2016, 39, 304–316. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Geoghegan, J.L.; Pirotta, V.; Harvey, E.; Smith, A.; Buchmann, J.P.; Ostrowski, M.; Eden, J.S.; Harcourt, R.; Holmes, E.C. Virological Sampling of Inaccessible Wildlife with Drones. Viruses 2018, 10, 300. [Google Scholar] [CrossRef] [Scilit]
  59. Morandini, V.; Dugger, K.M.; Ballard, G.; Elrod, M.; Schmidt, A.; Ruoppolo, V.; Lescroel, A.; Jongsomjit, D.; Massaro, M.; Pennycook, J.; et al. Identification of a Novel Adelie Penguin Circovirus at Cape Crozier (Ross Island, Antarctica). Viruses 2019, 11, 1088. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Rosario, K.; Duffy, S.; Breitbart, M. A field guide to eukaryotic circular single-stranded DNA viruses: Insights gained from metagenomics. Arch. Virol. 2012, 157, 1851–1871. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Orton, J.P.; Morales, M.; Fontenele, R.S.; Schmidlin, K.; Kraberger, S.; Leavitt, D.J.; Webster, T.H.; Wilson, M.A.; Kusumi, K.; Dolby, G.A.; et al. Virus Discovery in Desert Tortoise Fecal Samples: Novel Circular Single-Stranded DNA Viruses. Viruses 2020, 12, 143. [Google Scholar] [CrossRef] [Scilit]
  62. Fontenele, R.S.; Lacorte, C.; Lamas, N.S.; Schmidlin, K.; Varsani, A.; Ribeiro, S.G. Single Stranded DNA Viruses Associated with Capybara Faeces Sampled in Brazil. Viruses 2019, 11, 710. [Google Scholar] [CrossRef] [Scilit]
  63. Dunlap, D.S.; Ng, T.F.; Rosario, K.; Barbosa, J.G.; Greco, A.M.; Breitbart, M.; Hewson, I. Molecular and microscopic evidence of viruses in marine copepods. Proc. Natl. Acad. Sci. USA 2013, 110, 1375–1380. [Google Scholar] [CrossRef] [Scilit]
  64. de la Higuera, I.; Kasun, G.W.; Torrance, E.L.; Pratt, A.A.; Maluenda, A.; Colombet, J.; Bisseux, M.; Ravet, V.; Dayaram, A.; Stainton, D.; et al. Unveiling Crucivirus Diversity by Mining Metagenomic Data. Mbio 2020, 11, e01410–e01420. [Google Scholar] [CrossRef] [Scilit]
  65. Zhang, W.; Olson, N.H.; Baker, T.S.; Faulkner, L.; Agbandje-McKenna, M.; Boulton, M.I.; Davies, J.W.; McKenna, R. Structure of the Maize streak virus geminate particle. Virology 2001, 279, 471–477. [Google Scholar] [CrossRef] [Scilit]
  66. Diemer, G.S.; Stedman, K.M. A novel virus genome discovered in an extreme environment suggests recombination between unrelated groups of RNA and DNA viruses. Biol. Direct 2012, 7, 13. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Krupovic, M.; Zhi, N.; Li, J.; Hu, G.; Koonin, E.V.; Wong, S.; Shevchenko, S.; Zhao, K.; Young, N.S. Multiple layers of chimerism in a single-stranded DNA virus discovered by deep sequencing. Genome Biol. Evol. 2015, 7, 993–1001. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Roux, S.; Enault, F.; Bronner, G.; Vaulot, D.; Forterre, P.; Krupovic, M. Chimeric viruses blur the borders between the major groups of eukaryotic single-stranded DNA viruses. Nat. Commun. 2013, 4, 2700. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Jackson, E.W.; Bistolas, K.S.; Button, J.B.; Hewson, I. Novel Circular Single-Stranded DNA Viruses among an Asteroid, Echinoid and Holothurian (Phylum: Echinodermata). PLoS ONE 2016, 11, e0166093. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  70. Barbosa, A.; Palacios, M.J. Health of Antarctic birds: A review of their parasites, pathogens and diseases. Polar Biol. 2009, 32, 1095. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  71. Clarke, J.; Kerry, K. Diseases and parasites of penguins. Penguin Conserv. 2000, 13, 5–24. [Google Scholar]
  72. Woods, R.; Jones, H.I.; Watts, J.; Miller, G.D.; Shellam, G.R. Diseases of Antarctic Seabirds. In Health of Antarctic Wildlife: A Challenge for Science and Policy; Kerry, K.R., Riddle, M., Eds.; Springer: London, UK, 2009. [Google Scholar]
  73. Grimaldi, W.W.; Seddon, P.J.; Lyver, P.O.; Nakagawa, S.; Tompkins, D.M. Infectious diseases of Antarctic penguins: Current status and future threats. Polar Biol. 2015, 38, 591–606. [Google Scholar] [CrossRef] [Scilit]
  74. Olivares, F.; Tapia, R.; Galvez, C.; Meza, F.; Barriga, G.P.; Borras-Chavez, R.; Mena-Vasquez, J.; Medina, R.A.; Neira, V. Novel penguin Avian avulaviruses 17, 18 and 19 are widely distributed in the Antarctic Peninsula. Transbound Emerg. Dis. 2019, 66, 2227–2232. [Google Scholar] [CrossRef] [Scilit]
  75. Lee, S.Y.; Kim, J.H.; Park, Y.M.; Shin, O.S.; Kim, H.; Choi, H.G.; Song, J.W. A novel adenovirus in Chinstrap penguins (Pygoscelis antarctica) in Antarctica. Viruses 2014, 6, 2052–2061. [Google Scholar] [CrossRef] [Scilit]
  76. Lee, S.Y.; Kim, J.H.; Seo, T.K.; No, J.S.; Kim, H.; Kim, W.K.; Choi, H.G.; Kang, S.H.; Song, J.W. Genetic and Molecular Epidemiological Characterization of a Novel Adenovirus in Antarctic Penguins Collected between 2008 and 2013. PLoS ONE 2016, 11, e0157032. [Google Scholar] [CrossRef] [Scilit]
  77. Van Doorslaer, K.; Ruoppolo, V.; Schmidt, A.; Lescroel, A.; Jongsomjit, D.; Elrod, M.; Kraberger, S.; Stainton, D.; Dugger, K.M.; Ballard, G.; et al. Unique genome organization of non-mammalian papillomaviruses provides insights into the evolution of viral early proteins. Virus Evol. 2017, 3, vex027. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  78. Varsani, A.; Kraberger, S.; Jennings, S.; Porzig, E.L.; Julian, L.; Massaro, M.; Pollard, A.; Ballard, G.; Ainley, D.G. A novel papillomavirus in Adelie penguin (Pygoscelis adeliae) faeces sampled at the Cape Crozier colony, Antarctica. J. Gen. Virol. 2014, 95, 1352–1365. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  79. Varsani, A.; Porzig, E.L.; Jennings, S.; Kraberger, S.; Farkas, K.; Julian, L.; Massaro, M.; Ballard, G.; Ainley, D.G. Identification of an avian polyomavirus associated with Adelie penguins (Pygoscelis adeliae). J. Gen. Virol. 2015, 96, 851–857. [Google Scholar] [CrossRef] [Scilit]
  80. Wille, M.; Aban, M.; Wang, J.; Moore, N.; Shan, S.; Marshall, J.; Gonzalez-Acuna, D.; Vijaykrishna, D.; Butler, J.; Wang, J.; et al. Antarctic Penguins as Reservoirs of Diversity for Avian Avulaviruses. J. Virol. 2019, 93. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  81. Neira, V.; Tapia, R.; Verdugo, C.; Barriga, G.; Mor, S.; Ng, T.F.F.; Garcia, V.; Del Rio, J.; Rodrigues, P.; Briceno, C.; et al. Novel Avulaviruses in Penguins, Antarctica. Emerg. Infect. Dis. 2017, 23, 1212–1214. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Sampling sites of the four-penguin species based on their breeding colonies in South Georgia and the Antarctic Peninsula. The numbers in the pie chart indicate the number of individual samples per species.
Figure 1. Sampling sites of the four-penguin species based on their breeding colonies in South Georgia and the Antarctic Peninsula. The numbers in the pie chart indicate the number of individual samples per species.
Viruses 12 01029 g001
Figure 2. Heat map illustrating the dataset-wide detection scaled to sample size, of virus and circular molecule genotypes with the linearized genome organization shown on the right. The detection is based on the recovery of complete sequences by PCR, cloning, and Sanger sequencing. For the purpose of this study, the viruses and circular molecules have been classified as unique species based on a cutoff threshold of 80% genome-wide pairwise identity and genotypes based on 98% genome-wide pairwise identity. The penguin colony key is as follows: (first two letters) AP = Adélie Penguin, CP = Chinstrap Penguin, GP = Gentoo Penguin, and KP = King Penguin, followed by locations BOOT = Booth Island (Western Antarctic Peninsula), KINN = Kinnes Cove (Northern Antarctic Peninsula), BAIL = Baily Head (Deception Island), GEOR = Georges Point (Western Antarctic Peninsula), HALF = Half Moon Island (South Shetland Islands), MOOT = Moot Point (Western Antarctic Peninsula), YANK = Yankee Harbor (South Shetland Islands), and STA = St Andrews Bay (South Georgi).
Figure 2. Heat map illustrating the dataset-wide detection scaled to sample size, of virus and circular molecule genotypes with the linearized genome organization shown on the right. The detection is based on the recovery of complete sequences by PCR, cloning, and Sanger sequencing. For the purpose of this study, the viruses and circular molecules have been classified as unique species based on a cutoff threshold of 80% genome-wide pairwise identity and genotypes based on 98% genome-wide pairwise identity. The penguin colony key is as follows: (first two letters) AP = Adélie Penguin, CP = Chinstrap Penguin, GP = Gentoo Penguin, and KP = King Penguin, followed by locations BOOT = Booth Island (Western Antarctic Peninsula), KINN = Kinnes Cove (Northern Antarctic Peninsula), BAIL = Baily Head (Deception Island), GEOR = Georges Point (Western Antarctic Peninsula), HALF = Half Moon Island (South Shetland Islands), MOOT = Moot Point (Western Antarctic Peninsula), YANK = Yankee Harbor (South Shetland Islands), and STA = St Andrews Bay (South Georgi).
Viruses 12 01029 g002
Figure 3. Sequence similarity network (SSN) analysis and Maximum likelihood (ML) phylogenetic tree of the Rep amino acid sequences identified in this study compared with those of known viruses in classified families and plasmids identified by Kazlauskas et al. [35]. The ML phylogenetic tree based on the SSN is mid-point rooted, and branches with aLRT support < 0.8 have been collapsed. The Reps identified in this study are highlighted in green and relevant clades of the tree are shown in the expanded view. Sequences with taxa names CruV-203, -227, -319, and -320 are from metagenomic derived sequences reported in de la Higuera et al. [64] and do not have accession #s assigned. The level of branch support (>0.8) is depicted as different sized shaded circles.
Figure 3. Sequence similarity network (SSN) analysis and Maximum likelihood (ML) phylogenetic tree of the Rep amino acid sequences identified in this study compared with those of known viruses in classified families and plasmids identified by Kazlauskas et al. [35]. The ML phylogenetic tree based on the SSN is mid-point rooted, and branches with aLRT support < 0.8 have been collapsed. The Reps identified in this study are highlighted in green and relevant clades of the tree are shown in the expanded view. Sequences with taxa names CruV-203, -227, -319, and -320 are from metagenomic derived sequences reported in de la Higuera et al. [64] and do not have accession #s assigned. The level of branch support (>0.8) is depicted as different sized shaded circles.
Viruses 12 01029 g003
Figure 4. Sequence similarity network (SSN) analysis and Maximum likelihood (ML) phylogenetic tree of the CP amino acid sequences that fall within specific networks that encompass sequences identified in this study (highlighted in purple). The ML phylogenetic trees based on the SSNs are mid-point rooted, and branches with aLRT support < 0.8 have been collapsed. The level of branch support (>0.8) is depicted as different sized shaded circles.
Figure 4. Sequence similarity network (SSN) analysis and Maximum likelihood (ML) phylogenetic tree of the CP amino acid sequences that fall within specific networks that encompass sequences identified in this study (highlighted in purple). The ML phylogenetic trees based on the SSNs are mid-point rooted, and branches with aLRT support < 0.8 have been collapsed. The level of branch support (>0.8) is depicted as different sized shaded circles.
Viruses 12 01029 g004
Figure 5. Summary of the recombination detected by RDP4. The methods used to detect recombination are RDP (R) GENCONV (G), BOOTSCAN (B), MAXCHI (M), CHIMERA (C), SISCAN (S), and 3SEQ (T). The method with the highest p-value for each recombination event is bolded. For each genome, a graphic on the left indicates the recombination event with its breakpoint location within the genome. Roman numerals in parenthesis after accession numbers indicate genotype.
Figure 5. Summary of the recombination detected by RDP4. The methods used to detect recombination are RDP (R) GENCONV (G), BOOTSCAN (B), MAXCHI (M), CHIMERA (C), SISCAN (S), and 3SEQ (T). The method with the highest p-value for each recombination event is bolded. For each genome, a graphic on the left indicates the recombination event with its breakpoint location within the genome. Roman numerals in parenthesis after accession numbers indicate genotype.
Viruses 12 01029 g005
Table 1. Table of detection of viral-like circular molecules (AntCM) and viruses (AntV) across sampled host species and sites based on recovery of complete sequences by PCR, cloning, and Sanger sequencing. Total sample size n (Adults/Chicks) shown in the header, while the number of individuals in which a given genotype was detected (Adults/Chicks) shown within the table. Cases where a single individual had two sequences of a single genotype are indicated with an asterisk (*). Regions: CWAP = Central Western Antarctic Peninsula, NEAP = Northeast Antarctic Peninsula, SG = South Georgia, SH = South Shetland Islands.
Table 1. Table of detection of viral-like circular molecules (AntCM) and viruses (AntV) across sampled host species and sites based on recovery of complete sequences by PCR, cloning, and Sanger sequencing. Total sample size n (Adults/Chicks) shown in the header, while the number of individuals in which a given genotype was detected (Adults/Chicks) shown within the table. Cases where a single individual had two sequences of a single genotype are indicated with an asterisk (*). Regions: CWAP = Central Western Antarctic Peninsula, NEAP = Northeast Antarctic Peninsula, SG = South Georgia, SH = South Shetland Islands.
Penguin Species
Adélie PenguinChinstrap PenguinGentoo PenguinKing Penguin
Site, RegionKinnes Cove, NEAPBooth Is., CWAPHalf Moon Is., SHBaily Head, SHGeorges Point, CWAPBooth Is., CWAPYankee Harbor, SHGeorges Point, CWAPBooth Is., CWAPMoot Point, CWAPSt. Andrew’s Bay, SG
Viral MoleculeGenBank Accession(s)n = 14
Adults = 7
Chicks = 7
n = 3
Adults = 2
Chicks = 1
n = 10
Adults=10
Chicks = 0
n = 10
Adults = 5
Chicks = 5
n = 6
Adults = 3
Chicks = 3
n = 6
Adults = 3
Chicks = 3
n = 9
Adults = 6
Chicks = 3
n = 6
Adults = 3
Chicks = 3
n = 6
Adults = 3
Chicks = 3
n = 5
Adults = 4
Chicks = 1
n = 20
Adults = 10
Chicks = 10
AntCM_1_I MT196226 1/0
AntCM_2_I MT196251 1/0
AntCM_3_I MT196224, MT196272–MT196276 4/01/0
AntCM_3_IIMT196225 1/0
AntCM_3_IIIMT196275, MT196277–MT196278 3/0
AntCM_4_I MT196227–MT196229, MT196262–MT196266 5/03/0
AntCM_5_I MT196230–MT196233, MT196254–MT196260 7/04/0
AntCM_6_I MT196235–MT196244 5/5
AntCM_7_I MT196280–MT196282 3/0
AntCM_8_I MT196234 1/0
AntCM_8_II MT196245–MT196246, MT196288 2*/0 1/0
AntCM_9_I MT196284–MT196285 2/0
AntCM_10_I MT196286–MT196287 2/0
AntCM_11_I MT196283 1/0
AntCM_12_I MT196267–MT196271 5/0
AntV_1_I MT196247–MT196248 2/0
AntV_1_II MT196249–MT196250 1/1
AntV_2_I MT196289–MT196293 4/1
AntV_3_I MT196252 1/0
AntV_3_IIMT196253
MT196261
1*/0
1*/0
AntV_3_IIIMT196294–MT196295, MT196297–MT196299 1/4
AntV_3_IVMT196296 0/1
AntV_3_VMT196279 1/0
AntV_4_IMT1962 5/0
AntV_4_IIMT196301–MT196207 1/6
AntV_5_IMT196312–MT196218 5/2
AntV_6_IMT196222–MT196223 1/1
Table 2. Summary of the BLASTn result of the representative sequences of AntCMs and AntVs.
Table 2. Summary of the BLASTn result of the representative sequences of AntCMs and AntVs.
Virus/
Circular Molecule
Top BLASTn Hit
Accession
SourceQuery CoverE-ValueIdentity
AntCM1- ---
AntCM2- ---
AntCM3MH648984Seabass tissue86%4.00 × 10−16773.86%
AntCM4JX904537Sea water (Saanich Inlet)48%079.50%
AntCM5MH510272Seabass tissue43%4.00 × 10−8469.79%
AntCM6MH616824Abalone tissue24%2.00 × 10−4272.02%
AntCM7MH616694Abalone tissue41%3.00 × 10−11072.54%
AntCM8- ---
AntCM9JX904537Sea water (Saanich Inlet)87%088.53%
AntCM10JX904559Sea water (Saanich Inlet)53%1.00 × 10−7668.88%
AntCM11- ---
AntCM12MH649197Red snapper tissue71%8.00 × 10−17070.75%
AntV1- ---
AntV2- ---
AntV3- ---
AntV4- ---
AntV5- ---
AntV6- ---
Table 3. Summary of the rolling circle replication (RCR) endonuclease motifs (Motif I, II, II) and SF3 helicase motifs (Walker A, Walker B, and Motif C) and Arg finder motif of the Reps identified in this study.
Table 3. Summary of the rolling circle replication (RCR) endonuclease motifs (Motif I, II, II) and SF3 helicase motifs (Walker A, Walker B, and Motif C) and Arg finder motif of the Reps identified in this study.
Virus/
Circular
Molecule
GenotypeIsolateAccession #Motif IMotif IIMotif IIIWalker AWalker BMotif CArg Finger
AntV1ICPGEORsw001AdMT196247CVTINNHVQMWADQEYCFKGPAGCGKNKLTTLMHEYVFTTNAFWRRI
AntV1ICPGEORsw002AdMT196248CVTINNHVQMWADQEYCFKGPAGCGKNKLTTLMHEYVFTTNAFWRRI
AntV1IICPGEORsw003AdMT196249CVTINNHVQMWADQEYCFKGPAGCGKNKLTTLMHEYVFTTNAFWRRI
AntV1IICPGEORsw003ChMT196250CVTINNHVQMWADQEYCFKGPAGCGKNKLTTLMHEYVFTTNAFWRRI
AntV2IGPYANKsw001AdMT196289SITYNNHFQCMAAFKYCQKGVPGSGKSYQARIIEEMIVTSNAIKRRF
AntV2IGPYANKsw001ChMT196290SITYNNHFQCMAAFKYCQKGVPGSGKSYQARIIEEMIVTSNAIKRRF
AntV2IGPYANKsw002AdMT196291SITYNNHFQCMAAFKYCQKGVPGSGKSYQARIIEEMIVTSNAIKRRF
AntV2IGPYANKsw003AdMT196292SITYNNHFQCMAAFKYCQKGVPGSGKSYQARIIEEMIVTSNAIKRRF
AntV2IGPYANKsw004AdMT196293SITYNNHFQCMAAFKYCQKGVPGSGKSYQARIIEEMIVTSNAIKRRF
AntV3ICPHALFsw004AdMT196252CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IICPHALFsw005AdMT196253CFTLNNHWQGTQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IICPHALFsw005AdMT196261CFTLNNHWQGTQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IIIKPSTAsw010AdMT196294CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IIIKPSTAsw014ChMT196295CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IIIKPSTAsw016ChMT196297CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IIIKPSTAsw018ChMT196298CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IIIKPSTAsw019ChMT196299CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3IVKPSTAsw015ChMT196296CFTLNNHWQGQQAIDYCKKGETGTGKSRKLWALEEWIVTSNPLKRRF
AntV3VCPHALFsw003AdMT196279VFTINNHWQGKQAIDYCKKGATGTGKSRKLWALEEWIVTSNPLKRRF
AntV4IKPSTAsw001AdMT196300CFTINNHWQGQQAIDYCKKGGTGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IKPSTAsw002AdMT196308CFTINNHWQGQQAIDYCKKGGTGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IKPSTAsw008AdMT196309CFTINNHWQGQQAIDYCKKGGTGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IKPSTAsw009AdMT196310CFTINNHWQGQQAIDYCKKGGTGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IKPSTAsw010AdMT196311CFTINNHWQGQQAIDYCKKGGTGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw004AdMT196301CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw014ChMT196302CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw015ChMT196303CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw016ChMT196304CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw017ChMT196305CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw018ChMT196306CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV4IIKPSTAsw019ChMT196307CFTINNHWQGQQAIDYCKKGETGTGKSRKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw001AdMT196312CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw002AdMT196313CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw004AdMT196314CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw008AdMT196315CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw009AdMT196316CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw018ChMT196317CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV5IKPSTAsw020ChMT196318CFTLNNHWQGKQAIDYCKKGATGTGKSQKLWAIEEWIVTSNPLKRRF
AntV6IAPBOOTsw001AdMT196222VFTWNNHLQGQECDKYCRKGESGCGKTRAVHLLDDIIVTSQALLRRF
AntV6IAPBOOTsw001ChMT196223VFTWNNHLQGQECDKYCRKGESGCGKTRAVHLLDDIIVTSQALLRRF
AntCM1ICPBAILsw002AdMT196226IVTLPAHWQIQQAYEYVTKGPTRVGKSRNVVVLDEFWVVSNAFEARF
AntCM2ICPHALFsw001AdMT196251LLTLPAHWQLQQVYDYVTKGPTGVGKTRHIYVLDEFWIVSNAFRRRL
AntCM8ICPBAILsw001AdMT196234FLTISAHYHAAKSIKYLKKGAAGGGKSTLARVYDEFIIVSNAFKRRI
AntCM8IICPBOOTsw002AdMT196245FITISGHYHIHDVLKYIQKGVPGGGKSTLARIFDEFIIASNAFKRRI
AntCM8IICPBOOTsw002AdMT196246FITISGHYHIHDVLKYIQKGVPGGGKSTLARIFDEFIIASNAFKRRI
AntCM8IIGPBOOTsw003AdMT196288FITISGHYHIHDVLKYIQKGVPGGGKSTLARIFDEFIIASNAFKRRI
AntCM10ICPHALFsw008AdMT196286MFTINNHYQGKQAVDYVSKGKPGTGKSHQARILDDLVVTSNAINRRF
AntCM10ICPHALFsw010AdMT196287MFTINNHYQGKQAVDYVSKGKPGTGKSHQVRILDDLVVTSNAINRRF
AntCM11ICPHALFsw005AdMT196283---DYEGNKGKSWLSRIIDVPMVITN-
AntCM12ICPHALFsw003AdMT196267FITIPQHYHINAVITYIKKGKPNSGKSFMFNCWDIPIVFANLPQGRT
AntCM12ICPHALFsw004AdMT196268FITIPQHYHIPAVITYIKKGRPNSGKSFMFNCWDIPIVFANLPKGRT
AntCM12ICPHALFsw008AdMT196269FITIPQHYHIPAVITYIKKGRPNSGKSFMFNCWDIPIVFANLPKGRT
AntCM12ICPHALFsw009AdMT196270FITIPQHYHIPAVITYIKKGRPNSGKSFMFNCWDIPIVFANLPKGRT
AntCM12ICPHALFsw010AdMT196271FITIPQHYHINAVITYIKKGKPNSGKSFMFNCWDIPIVFANLPKGRT

Share and Cite

MDPI and ACS Style

Levy, H.; Fontenele, R.S.; Harding, C.; Suazo, C.; Kraberger, S.; Schmidlin, K.; Djurhuus, A.; Black, C.E.; Hart, T.; Smith, A.L.; et al. Identification and Distribution of Novel Cressdnaviruses and Circular Molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula. Viruses 2020, 12, 1029. https://doi.org/10.3390/v12091029

AMA Style

Levy H, Fontenele RS, Harding C, Suazo C, Kraberger S, Schmidlin K, Djurhuus A, Black CE, Hart T, Smith AL, et al. Identification and Distribution of Novel Cressdnaviruses and Circular Molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula. Viruses. 2020; 12(9):1029. https://doi.org/10.3390/v12091029

Chicago/Turabian Style

Levy, Hila, Rafaela S. Fontenele, Ciara Harding, Crystal Suazo, Simona Kraberger, Kara Schmidlin, Anni Djurhuus, Caitlin E. Black, Tom Hart, Adrian L. Smith, and et al. 2020. "Identification and Distribution of Novel Cressdnaviruses and Circular Molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula" Viruses 12, no. 9: 1029. https://doi.org/10.3390/v12091029

APA Style

Levy, H., Fontenele, R. S., Harding, C., Suazo, C., Kraberger, S., Schmidlin, K., Djurhuus, A., Black, C. E., Hart, T., Smith, A. L., & Varsani, A. (2020). Identification and Distribution of Novel Cressdnaviruses and Circular Molecules in Four Penguin Species in South Georgia and the Antarctic Peninsula. Viruses, 12(9), 1029. https://doi.org/10.3390/v12091029

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop