Transcriptome-Wide Identification and Expression Profiling of SPX Domain-Containing Members in Responses to Phosphorus Deprivation of Pinus massoniana
Abstract
:1. Introduction
2. Materials and Methods
2.1. Identification of SPX Genes in P. massoniana
2.2. Multiple Sequence Alignment, Phylogenetic Analysis, and Conserved Motif Analysis
2.3. Plant Material and Pi Stress Treatments
2.4. RNA-Seq Data Analysis of PmSPX Genes
2.5. RNA Extraction, cDNA Synthesis, and RT-qPCR
2.6. Subcellular Localization Analysis
2.7. Isolation and Cis-Element Analysis of the PmSPX1 Promoter
2.8. Yeast One-Hybrid Assay
2.9. Statistical Analysis
3. Results
3.1. Transcriptome-Wide Identification of SPX Members in P. massoniana
3.2. Phylogenetic Relationships and Conserved Domain Analysis of PmSPX Proteins
3.3. Analysis of the Transcriptional Profiles of PmSPX Genes
3.4. Isolation and Cis-Acting Element Analysis of PmSPX1 Promoter
3.5. PmWRKY75 Can Bind Directly to PmSPX2 Promoter
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Wang, F.; Deng, M.; Xu, J.; Zhu, X.; Mao, C. Molecular mechanisms of phosphate transport and signaling in higher plants. Semin. Cell Dev. Biol. 2018, 74, 114–122. [Google Scholar] [CrossRef] [PubMed]
- Richardson, A.E.; Simpson, R.J. Soil microorganisms mediating phosphorus availability update on microbial phosphorus. Plant Physiol. 2011, 156, 989–996. [Google Scholar] [CrossRef] [Green Version]
- Raghothama, K.G. Phosphate acquisition. Annu. Rev. Plant Physiol. Plant Mol. Biol. 1999, 50, 665–693. [Google Scholar] [CrossRef]
- Cho, H.; Bouain, N.; Zheng, L.; Rouached, H. Plant resilience to phosphate limitation: Current knowledge and future challenges. Crit. Rev. Biotechnol. 2021, 41, 63–71. [Google Scholar] [CrossRef] [PubMed]
- Vance, C.P.; Uhde-Stone, C.; Allan, D.L. Phosphorus acquisition and use: Critical adaptations by plants for securing a nonrenewable resource. New Phytol. 2003, 157, 423–447. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ham, B.K.; Chen, J.; Yan, Y.; Lucas, W.J. Insights into plant phosphate sensing and signaling. Curr. Opin. Biotechnol. 2018, 49, 1–9. [Google Scholar] [CrossRef]
- Chang, M.X.; Gu, M.; Xia, Y.W.; Dai, X.L.; Dai, C.R.; Zhang, J.; Wang, S.C.; Qu, H.Y.; Yamaji, N.; Ma, J.F.; et al. OsPHT1;3 mediates uptake, translocation, and remobilization of phosphate under extremely low phosphate regimes. Plant Physiol. 2019, 179, 656–670. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Qi, W.; Baldwin, S.A.; Muench, S.P.; Baker, A. Pi sensing and signalling: From prokaryotic to eukaryotic cells. Biochem. Soc. Trans. 2016, 44, 766–773. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vogiatzaki, E.; Baroux, C.; Jung, J.Y.; Poirier, Y. PHO1 exports phosphate from the chalazal seed coat to the embryo in developing Arabidopsis seeds. Curr. Biol. 2017, 27, 2893–2900.e3. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Huang, Y.; Xu, P.H.; Hou, B.Z.; Shen, Y.Y. Strawberry tonoplast transporter, FaVPT1, controls phosphate accumulation and fruit quality. Plant Cell Environ. 2019, 42, 2715–2729. [Google Scholar] [CrossRef] [PubMed]
- Torres-Rodríguez, J.V.; Salazar-Vidal, M.N.; Montes, R.A.C.; Massange-Sánchez, J.A.; Gillmor, C.S.; Sawers, R.J.H. Low nitrogen availability inhibits the phosphorus starvation response in maize (Zea mays ssp. mays L.). BMC Plant Biol. 2021, 21, 259. [Google Scholar] [CrossRef] [PubMed]
- Duan, K.; Yi, K.; Dang, L.; Huang, H.; Wu, W.; Wu, P. Characterization of a sub-family of Arabidopsis genes with the SPX domain reveals their diverse functions in plant tolerance to phosphorus starvation. Plant J. 2008, 54, 965–975. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.; Ying, S.; Huang, H.; Li, K.; Wu, P.; Shou, H. Involvement of OsSPX1 in phosphate homeostasis in rice. Plant J. 2009, 57, 895–904. [Google Scholar] [CrossRef] [PubMed]
- Yao, Z.F.; Liang, C.Y.; Zhang, Q.; Chen, Z.J.; Xiao, B.X.; Tian, J.; Liao, H. SPX1 is an important component in the phosphorus signalling network of common bean regulating root growth and phosphorus homeostasis. J. Exp. Bot. 2014, 65, 3299–3310. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Du, H.; Yang, C.; Ding, G.; Shi, L.; Xu, F. Genome-wide identification and characterization of SPX domain-containing members and their responses to phosphate deficiency in Brassica napus. Front. Plant Sci. 2017, 8, 35. [Google Scholar] [CrossRef] [Green Version]
- Kumar, A.; Sharma, M.; Gahlaut, V.; Nagaraju, M.; Chaudhary, S.; Kumar, A.; Tyagi, P.; Gajula, M.N.V.P.; Singh, K.P. Genome-wide identification, characterization, and expression profiling of SPX gene family in wheat. Int. J. Biol. Macromol. 2019, 140, 17–32. [Google Scholar] [CrossRef]
- Wang, Y.; Ribot, C.; Rezzonico, E.; Poirier, Y. Structure and expression profile of the Arabidopsis PHO1 gene family indicates a broad role in inorganic phosphate homeostasis. Plant Physiol. 2004, 135, 400–411. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Secco, D.; Wang, C.; Arpat, B.A.; Wang, Z.; Poirier, Y.; Tyerman, S.D.; Wu, P.; Shou, H.; Whelan, J. The emerging importance of the SPX domain-containing proteins in phosphate homeostasis. New Phytol. 2012, 193, 842–851. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Liu, N.; Shang, W.; Li, C.; Jia, L.; Wang, X.; Xing, G.; Zheng, W. Evolution of the SPX gene family in plants and its role in the response mechanism to phosphorus stress. Open Biol. 2018, 8, 170231. [Google Scholar] [CrossRef] [Green Version]
- Liu, T.Y.; Huang, T.K.; Yang, S.Y.; Hong, Y.T.; Huang, S.M.; Wang, F.N.; Chiang, S.F.; Tsai, S.Y.; Lu, W.C.; Chiou, T.J. Identification of plant vacuolar transporters mediating phosphate storage. Nat. Commun. 2016, 7, 11095. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yang, S.Y.; Huang, T.K.; Kuo, H.F.; Chiou, T.J. Role of vacuoles in phosphorus storage and remobilization. J. Exp. Bot. 2017, 68, 3045–3055. [Google Scholar] [CrossRef]
- Wang, C.; Huang, W.; Ying, Y.; Li, S.; Secco, D.; Tyerman, S.; Whelan, J.; Shou, H. Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves. New Phytol. 2012, 196, 139–148. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.; Yue, W.; Ying, Y.; Wang, S.; Secco, D.; Liu, Y.; Whelan, J.; Tyerman, S.D.; Shou, H. Rice SPX-Major facility superfamily3, a vacuolar phosphate efflux transporter, is involved in maintaining phosphate homeostasis in rice. Plant Physiol. 2015, 169, 2822–2831. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chiou, T.J. The diverse roles of rice PHO1 in phosphate transport: From root to node to grain. Plant Cell Physiol. 2020, 61, 1384–1386. [Google Scholar] [CrossRef]
- Wege, S.; Khan, G.A.; Jung, J.Y.; Vogiatzaki, E.; Pradervand, S.; Aller, I.; Meyer, A.J.; Poirier, Y. The EXS Domain of PHO1 participates in the response of shoots to phosphate deficiency via a root-to-shoot signal. Plant Physiol. 2016, 170, 385–400. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chaiwong, N.; Prom-u-thai, C.; Bouain, N.; Lacombe, B.; Rouached, H. Individual versus combinatorial effects of silicon, phosphate, and iron deficiency on the growth of lowland and upland rice varieties. Int. J. Mol. Sci. 2018, 19, 899. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yang, J.; Wang, L.; Mao, C.; Lin, H. Characterization of the rice NLA family reveals a key role for OsNLA1 in phosphate homeostasis. Rice 2017, 10, 52. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wang, Z.; Hu, H.; Huang, H.; Duan, K.; Wu, Z.; Wu, P. Regulation of OsSPX1 and OsSPX3 on expression of OsSPX domain genes and Pi-starvation signaling in rice. J. Integr. Plant Biol. 2009, 51, 663–674. [Google Scholar] [CrossRef] [PubMed]
- Zhou, Z.; Wang, Z.; Lv, Q.; Shi, J.; Zhong, Y.; Wu, P.; Mao, C. SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal. Behav. 2015, 10, e1061163. [Google Scholar] [CrossRef] [PubMed]
- Qi, W.; Manfield, I.W.; Muench, S.P.; Baker, A. AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution. Biochem. J. 2017, 474, 3675–3687. [Google Scholar] [CrossRef] [PubMed]
- Zhong, Y.; Wang, Y.; Guo, J.; Zhu, X.; Shi, J.; He, Q.; Liu, Y.; Wu, Y.; Zhang, L.; Lv, Q.; et al. Rice SPX6 negatively regulates the phosphate starvation response through suppression of the transcription factor PHR2. New Phytol. 2018, 219, 135–148. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, M.; Wang, H.; Zhao, X.; Lu, Z.; Sun, X.; Ding, G. Role of Suillus placidus in improving the drought tolerance of masson pine (Pinus massoniana Lamb.) Seedlings. Forests 2021, 12, 332. [Google Scholar] [CrossRef]
- Farjon, A. Pinus massoniana. IUCN Red List of Threat Species. 2013. Available online: https://doi.org/10.2305/IUCN.UK.2013-1.RLTS.T42379A2976356.en (accessed on 22 July 2021).
- Fan, F.; Wang, Q.; Wen, X.; Ding, G. Transcriptome-wide identification and expression profiling of Pinus Massoniana MYB transcription factors responding to phosphorus deficiency. J. For. Res. 2020, 31, 909–919. [Google Scholar] [CrossRef]
- Zhang, Y.; Zhou, Z.; Ma, X.; Jin, G. Foraging ability and growth performance of four subtropical tree species in response to heterogeneous nutrient environments. J. Res. 2021, 15, 91–98. [Google Scholar] [CrossRef]
- Fan, F.; Shang, X.; Ding, G.; Zhou, Z.; Tian, J. Integrated mRNA and miRNA expression analyses of Pinus massoniana roots and shoots in long-term response to phosphate deficiency. J. Plant Growth Regul. 2021, 9. [Google Scholar] [CrossRef]
- Ren, J.; Wen, L.; Gao, X.; Jin, C.; Xue, Y.; Yao, X. DOG 1.0: Illustrator of protein domain structures. Cell Res. 2009, 19, 271–273. [Google Scholar] [CrossRef] [PubMed]
- Tamura, K.; Stecher, G.; Peterson, D.; Filipski, A.; Kumar, S. MEGA6: Molecular evolutionary genetics analysis version 6.0. Mol. Biol. Evol. 2013, 30, 2725–2729. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef]
- Chen, W.; Chen, R.; Zhang, Y.; Li, J.; Tigabu, M.; Ma, X.; Li, M. Cloning, Characterization and Expression Analysis of the Phosphate Starvation Response Gene, ClPHR1, from Chinese Fir. Forests 2020, 11, 104. [Google Scholar] [CrossRef] [Green Version]
- Livak, K.J.; Schmittgen, T.D. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C(T)) Method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; Van de Peer, Y.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef]
- Miao, J.; Sun, J.; Liu, D.; Li, B.; Zhang, A.; Li, Z.; Tong, Y. Characterization of the promoter of phosphate transporter TaPHT1.2 differentially expressed in wheat varieties. J. Genet. Genomics 2009, 36, 455–466. [Google Scholar] [CrossRef]
- Su, T.; Xu, Q.; Zhang, F.C.; Chen, Y.; Li, L.Q.; Wu, W.H.; Chen, Y.F. WRKY42 modulates phosphate homeostasis through regulating phosphate translocation and acquisition in Arabidopsis. Plant Physiol. 2015, 167, 1579–1591. [Google Scholar] [CrossRef] [Green Version]
- Wang, C.; Fan, F.; Qin, H.; Zhou, Z.; Tan, J.; Ding, G. Cloning, prokaryotic expression and expression pattern analysis of Pinus massoniana PmSPX2 gene. Plant Physiol. J. 2021, 57, 1645–1656. [Google Scholar] [CrossRef]
- McKay Fletcher, D.M.; Ruiz, S.; Dias, T.; Petroselli, C.; Roose, T. Linking root structure to functionality: The impact of root system architecture on citrate-enhanced phosphate uptake. New Phytol. 2020, 227, 376–391. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ruan, W.; Guo, M.; Cai, L.; Hu, H.; Li, C.; Liu, Y.; Wu, Z.; Mao, C.; Yi, K.; Wu, P.; et al. Genetic manipulation of a high-affinity PHR1 target cis-element to improve phosphorous uptake in Oryza sativa L. Plant Mol. Biol. 2015, 87, 429–440. [Google Scholar] [CrossRef] [PubMed]
- Sega, P.; Kruszka, K.; Szewc, Ł.; Szweykowska-Kulińska, Z.; Pacak, A. Identification of transcription factors that bind to the 5′-UTR of the barley PHO2 gene. Plant Mol. Biol. 2020, 102, 73–88. [Google Scholar] [CrossRef] [PubMed]
- Ried, M.K.; Wild, R.; Zhu, J.; Pipercevic, J.; Sturm, K.; Broger, L.; Harmel, R.K.; Abriata, L.A.; Hothorn, L.A.; Fiedler, D.; et al. Inositol pyrophosphates promote the interaction of SPX domains with the coiled-coil motif of PHR transcription factors to regulate plant phosphate homeostasis. Nat. Commun. 2021, 12, 384. [Google Scholar] [CrossRef]
- Zhang, K.; Song, Q.; Wei, Q.; Wang, C.; Zhang, L.; Xu, W.; Su, Z. Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice. Plant Biotechnol. J. 2016, 14, 1661–1672. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhao, L.; Liu, F.; Xu, W.; Di, C.; Zhou, S.; Xue, Y.; Yu, J.; Su, Z. Increased expression of OsSPX1 enhances cold/subfreezing tolerance in tobacco and Arabidopsis thaliana. Plant Biotechnol. J. 2009, 7, 550–561. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Chen, Y.F.; Wu, W.H. Potassium and phosphorus transport and signaling in plants. J. Integr. Plant Biol. 2021, 63, 34–52. [Google Scholar] [CrossRef] [PubMed]
- Secco, D.; Baumann, A.; Poirier, Y. Characterization of the rice PHO1 gene family reveals a key role for OsPHO1;2 in phosphate homeostasis and the evolution of a distinct clade in dicotyledons. Plant Physiol. 2010, 152, 1693–1704. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Che, J.; Yamaji, N.; Miyaji, T.; Mitani-Ueno, N.; Kato, Y.; Shen, R.F.; Ma, J.F. Node-localized transporters of phosphorus essential for seed development in rice. Plant Cell Physiol. 2020, 61, 1387–1398. [Google Scholar] [CrossRef] [PubMed]
- Liu, J.; Fu, S.; Yang, L.; Luan, M.; Zhao, F.; Luan, S.; Lan, W. Vacuolar SPX-MFS transporters are essential for phosphate adaptation in plants. Plant Signal. Behav. 2016, 11, e1213474. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yue, W.; Ying, Y.; Wang, C.; Zhao, Y.; Dong, C.; Whelan, J.; Shou, H. OsNLA1, a RING-type ubiquitin ligase, maintains phosphate homeostasis in Oryza sativa via degradation of phosphate transporters. Plant J. 2017, 90, 1040–1051. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Du, W.; Ning, L.; Liu, Y.; Zhang, S.; Yang, Y.; Wang, Q.; Chao, S.; Yang, H.; Huang, F.; Cheng, H.; et al. Identification of loci and candidate gene GmSPX-RING1 responsible for phosphorus efficiency in soybean via genome-wide association analysis. BMC Genom. 2020, 21, 725. [Google Scholar] [CrossRef] [PubMed]
- Lv, Q.; Zhong, Y.; Wang, Y.; Wang, Z.; Zhang, L.; Shi, J.; Wu, Z.; Liu, Y.; Mao, C.; Yi, K.; et al. SPX4 negatively regulates phosphate signaling and homeostasis through its interaction with PHR2 in rice. Plant Cell 2014, 26, 1586–1597. [Google Scholar] [CrossRef] [Green Version]
- Wang, Z.; Ruan, W.; Shi, J.; Zhang, L.; Xiang, D.; Yang, C.; Li, C.; Wu, Z.; Liu, Y.; Yu, Y.; et al. Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner. Proc. Natl. Acad. Sci. USA 2014, 111, 14953–14958. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Puga, M.I.; Mateos, I.; Charukesi, R.; Wang, Z.; Franco-Zorrilla, J.M.; de Lorenzo, L.; Irigoyen, M.L.; Masiero, S.; Bustos, R.; Rodríguez, J.; et al. SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis. Proc. Natl. Acad. Sci. USA 2014, 111, 14947–14952. [Google Scholar] [CrossRef] [Green Version]
- Yan, H.; Sheng, M.; Wang, C.; Liu, Y.; Yang, J.; Liu, F.; Xu, W.; Su, Z. AtSPX1-mediated transcriptional regulation during leaf senescence in Arabidopsis thaliana. Plant Sci. 2019, 283, 238–246. [Google Scholar] [CrossRef] [PubMed]
- Li, Y.; Chen, C.Y.; Kaye, A.M.; Wasserman, W.W. The identification of cis-regulatory elements: A review from a machine learning perspective. Biosystems 2015, 138, 6–17. [Google Scholar] [CrossRef] [PubMed]
- Kang, X.; Ni, M. Arabidopsis SHORT HYPOCOTYL UNDER BLUE1 contains SPX and EXS domains and acts in cryptochrome signaling. Plant Cell 2006, 18, 921–934. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhou, Y.; Ni, M. SHORT HYPOCOTYL UNDER BLUE1 truncations and mutations alter its association with a signaling protein complex in Arabidopsis. Plant Cell 2010, 22, 703–715. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Oldroyd, G.E.D.; Leyser, O. A plant’s diet, surviving in a variable nutrient environment. Science 2020, 368, eaba0196. [Google Scholar] [CrossRef] [PubMed]
- Sega, P.; Pacak, A. Plant PHR Transcription Factors: Put on A Map. Genes 2019, 10, 1018. [Google Scholar] [CrossRef] [Green Version]
- Jain, A.; Nagarajan, V.K.; Raghothama, K.G. Transcriptional regulation of phosphate acquisition by higher plants. Cell Mol. Life Sci. 2012, 69, 3207–3224. [Google Scholar] [CrossRef] [PubMed]
- He, Q.; Lu, H.; Guo, H.; Wang, Y.; Zhao, P.; Li, Y.; Wang, F.; Xu, J.; Mo, X.; Mao, C. OsbHLH6 interacts with OsSPX4 and regulates the phosphate starvation response in rice. Plant J. 2021, 105, 649–667. [Google Scholar] [CrossRef] [PubMed]
- Zhang, J.; Gu, M.; Liang, R.; Shi, X.; Chen, L.; Hu, X.; Wang, S.; Dai, X.; Qu, H.; Li, H.; et al. OsWRKY21 and OsWRKY108 function redundantly to promote phosphate accumulation through maintaining the constitutive expression of OsPHT1;1 under phosphate-replete conditions. New Phytol. 2021, 229, 1598–1614. [Google Scholar] [CrossRef] [PubMed]
- Jiang, J.; Ma, S.; Ye, N.; Jiang, M.; Cao, J.; Zhang, J. WRKY transcription factors in plant responses to stresses. J. Integr. Plant Biol. 2017, 59, 86–101. [Google Scholar] [CrossRef]
- Shen, N.; Hou, S.; Tu, G.; Lan, W.; Jing, Y. Transcription factor WRKY33 mediates the phosphate deficiency-induced remodeling of root architecture by modulating iron homeostasis in Arabidopsis roots. Int. J. Mol. Sci. 2021, 22, 9275. [Google Scholar] [CrossRef] [PubMed]
- Fan, F.; Wang, Q.; Li, H.; Ding, G.; Wen, X. Transcriptome-wide identification and expression profiles of masson pine WRKY transcription factors in response to low phosphorus stress. Plant Mol. Biol. Rep. 2021, 39, 1–9. [Google Scholar] [CrossRef]
- Zhao, K.; Zhang, D.; Lv, K.; Zhang, X.; Cheng, Z.; Li, R.; Zhou, B.; Jiang, T. Functional characterization of poplar WRKY75 in salt and osmotic tolerance. Plant Sci. 2019, 289, 110259. [Google Scholar] [CrossRef] [PubMed]
- Ren, F.; Zhao, C.Z.; Liu, C.S.; Huang, K.L.; Guo, Q.Q.; Chang, L.L.; Xiong, H.; Li, X.B. A Brassica napus PHT1 phosphate transporter, BnPht1;4, promotes phosphate uptake and affects roots architecture of transgenic Arabidopsis. Plant Mol. Biol. 2014, 86, 595–607. [Google Scholar] [CrossRef] [PubMed]
Gene | Gene ID a | cDNA Length | aa | MW (kDa) | pI | Domain Subfamilies b | Subcellular Localization c |
---|---|---|---|---|---|---|---|
PmSPX1 | Unigene0025956 | 1256 | 290 | 33.642 | 5.27 | SPX | Nuclear |
PmSPX2 | Unigene0055609 | 1740 | 349 | 39.626 | 5.58 | SPX | Nuclear |
PmSPX4 | Unigene004869 | 1904 | 366 | 41.013 | 5.07 | SPX | Nuclear |
PmSPX-MFS1 | Unigene0002810 | 1949 | 530 | 60.389 | 8.34 | SPX-MFS | Plasma Membrane |
PmSPX-MFS2 | Unigene0019666 | 2660 | 702 | 78.396 | 6.14 | SPX-MFS | Plasma Membrane |
PmPHO1 | Unigene0054294 | 2988 | 820 | 93.081 | 9.40 | SPX-EXS | Plasma Membrane |
PmPHO1;H1 | Unigene0004203 | 3130 | 802 | 93.057 | 9.24 | SPX-EXS | Plasma Membrane |
PmNLA1 | Unigene0027297 | 1998 | 267 | 30.413 | 7.53 | SPX-RING | Nuclear |
PmNLA2 | Unigene0000965 | 1371 | 355 | 40.391 | 8.18 | SPX-RING | Nuclear |
PmNLA3 | Unigene0063200 | 2560 | 353 | 40.235 | 8.97 | SPX-RING | Nuclear |
Motif | Length | Sequence |
---|---|---|
1 | 29 | RELVLLENYSSLNATAIRKILKKYDKRTG |
2 | 21 | YPEWKDKFLNYKLLKKKLKKI |
3 | 50 | TCPICLDTVFDPVALGCGHIFCNNCACTGASIPTIEGVKAANPRARCPJC |
4 | 47 | KDRRAAEKDFIKLLDAZLEKFNLFFLEKEEEYIIRLEELKERIERLK |
5 | 50 | KSPWLIELIAFQINTRDPEHGHIGEIFPECSCDFTGSDPVJTCTLPDSVK |
6 | 50 | RQMGVYADSVHLPELGLLVKKRCRGYWEERLHTERAERVKQAKEHWDLQS |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Wang, C.; Fan, F.; Shang, X.; Zhou, Z.; Ding, G. Transcriptome-Wide Identification and Expression Profiling of SPX Domain-Containing Members in Responses to Phosphorus Deprivation of Pinus massoniana. Forests 2021, 12, 1627. https://doi.org/10.3390/f12121627
Wang C, Fan F, Shang X, Zhou Z, Ding G. Transcriptome-Wide Identification and Expression Profiling of SPX Domain-Containing Members in Responses to Phosphorus Deprivation of Pinus massoniana. Forests. 2021; 12(12):1627. https://doi.org/10.3390/f12121627
Chicago/Turabian StyleWang, Conghui, Fuhua Fan, Xianwen Shang, Zijing Zhou, and Guijie Ding. 2021. "Transcriptome-Wide Identification and Expression Profiling of SPX Domain-Containing Members in Responses to Phosphorus Deprivation of Pinus massoniana" Forests 12, no. 12: 1627. https://doi.org/10.3390/f12121627
APA StyleWang, C., Fan, F., Shang, X., Zhou, Z., & Ding, G. (2021). Transcriptome-Wide Identification and Expression Profiling of SPX Domain-Containing Members in Responses to Phosphorus Deprivation of Pinus massoniana. Forests, 12(12), 1627. https://doi.org/10.3390/f12121627