Next Article in Journal
Diarrhetic Shellfish Toxins and Other Lipophilic Toxins of Human Health Concern in Washington State
Previous Article in Journal
The Promoting Effect of Ishige sinicola on Hair Growth
Open AccessArticle

A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

by Lili Chen 1,†, Liyan Song 2,*,†, Tingfei Li 3, Jianhua Zhu 1, Jian Xu 1, Qin Zheng 2 and Rongmin Yu 1,2
1
Biotechnological Institute of Chinese Materia Medica, Jinan University, Guangzhou 510632, China
2
College of Pharmacy, Jinan University, Guangzhou 510632, China
3
Guangdong Food and Drug Vocational-Technical School, Guangzhou 510663, China
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Mar. Drugs 2013, 11(6), 1800-1814; https://doi.org/10.3390/md11061800
Received: 4 March 2013 / Revised: 22 April 2013 / Accepted: 8 May 2013 / Published: 24 May 2013
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. View Full-Text
Keywords: Arca subcrenata; peptide; antiproliferative activity; antioxidant activity Arca subcrenata; peptide; antiproliferative activity; antioxidant activity
Show Figures

Graphical abstract

MDPI and ACS Style

Chen, L.; Song, L.; Li, T.; Zhu, J.; Xu, J.; Zheng, Q.; Yu, R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Mar. Drugs 2013, 11, 1800-1814.

Show more citation formats Show less citations formats

Article Access Map by Country/Region

1
Only visits after 24 November 2015 are recorded.
Search more from Scilit
 
Search
Back to TopTop