Designing mRNA- and Peptide-Based Vaccine Construct against Emerging Multidrug-Resistant Citrobacter freundii: A Computational-Based Subtractive Proteomics Approach
Abstract
1. Introduction
2. Materials and Methods
2.1. Proteome Retrieval
2.2. Subcellular Localization and Host Homology
2.3. Protein Clustering, Antigenicity, and Allergenicity
2.4. Identification of Trans-Membrane Alpha-Helices
2.5. Prediction of Immune Cell Epitopes and Population Coverage Analysis
2.6. Designing of mRNA-Based Vaccine Construct
2.7. Designing of Peptide-Based Vaccine Construct
2.8. Physiochemical Properties, Antigenicity, Allergenicity, Toxicity, and Solubility Analysis of Vaccine Construct
2.9. Structures Prediction and Validation of Vaccine Construct
2.10. Docking and Interaction Analysis of MEVC
2.11. Codon Optimization and Computational Cloning of Vaccine Construct
2.12. Immune Simulation
2.13. Molecular Dynamics Simulation
3. Results
3.1. Proteome Subtraction, Subcellular Localization, and Trans-Membrane Alpha-Helices Identification
3.2. Immune Cells Epitope Prediction and Validation
3.3. Construction of mRNA- and Peptide-Based Vaccine
3.4. Structure Predictions, Validation, and Docking
3.5. Computational Cloning and Immune Simulation of Vaccine Construct
3.6. Molecular Dynamics Simulations
4. Discussion
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Zhou, W.; Chen, Q.; Qian, C.; Shen, K.; Zhu, X.; Zhou, D.; Lu, W.; Sun, Z.; Liu, H.; Li, K.; et al. In Vitro Susceptibility and Florfenicol Resistance in Citrobacter Isolates and Whole-Genome Analysis of Multidrug-Resistant Citrobacter freundii. Int. J. Genom. 2019, 2019, 7191935. [Google Scholar] [CrossRef]
- Yang, L.; Li, P.; Liang, B.; Hu, X.; Li, J.; Xie, J.; Yang, C.; Hao, R.; Wang, L.; Jia, L. Multidrug-resistant Citrobacter freundii ST139 co-producing NDM-1 and CMY-152 from China. Sci. Rep. 2018, 8, 10653. [Google Scholar] [CrossRef] [PubMed]
- Liu, L.; Lan, R.; Liu, L.; Wang, Y.; Zhang, Y.; Wang, Y.; Xu, J. Antimicrobial resistance and cytotoxicity of Citrobacter spp. in Maanshan Anhui Province, China. Front. Microbiol. 2017, 8, 1357. [Google Scholar] [PubMed]
- Yap, P.S.X.; Kamar, A.A.; Chong, C.W.; Yap, I.K.S.; Teh, C.S.J. Whole genome analysis of multidrug-resistant Citrobacter freundii B9-C2 isolated from preterm neonate’s stool in the first week. J. Glob. Antimicrob. Resist. 2020, 21, 246–251. [Google Scholar]
- Rabaan, A.A.; Alhumaid, S.; Mutair, A.A.; Garout, M.; Abulhamayel, Y.; Halwani, M.A.; Alestad, J.H.; Bshabshe, A.A.; Sulaiman, T.; AlFonaisan, M.K. Application of Artificial Intelligence in Combating High Antimicrobial Resistance Rates. Antibiotics 2022, 11, 784. [Google Scholar]
- Zeb, S.; Mushtaq, M.; Ahmad, M.; Saleem, W.; Rabaan, A.A.; Naqvi, B.S.Z.; Garout, M.; Aljeldah, M.; Al Shammari, B.R.; Al Faraj, N.J. Self-Medication as an Important Risk Factor for Antibiotic Resistance: A Multi-Institutional Survey among Students. Antibiotics 2022, 11, 842. [Google Scholar] [CrossRef]
- Liu, L.; Zhang, L.; Zhou, H.; Yuan, M.; Hu, D.; Wang, Y.; Sun, H.; Xu, J.; Lan, R. Antimicrobial Resistance and Molecular Characterization of Citrobacter spp. Causing Extraintestinal Infections. Front. Cell. Infect. Microbiol. 2021, 11, 737636. [Google Scholar] [CrossRef]
- Ismail, S.; Ahmad, S.; Azam, S.S. Vaccinomics to design a novel single chimeric subunit vaccine for broad-spectrum immunological applications targeting nosocomial Enterobacteriaceae pathogens. Eur. J. Pharm. Sci. 2020, 146, 105258. [Google Scholar]
- Ulloa, E.R.; Kousha, A.; Tsunemoto, H.; Pogliano, J.; Licitra, C.; LiPuma, J.J.; Sakoulas, G.; Nizet, V.; Kumaraswamy, M. Azithromycin Exerts Bactericidal Activity and Enhances Innate Immune Mediated Killing of MDR Achromobacter xylosoxidans. Infect. Microbs Dis. 2020, 2, 10–17. [Google Scholar] [CrossRef]
- Khan, A.; Junaid, M.; Kaushik, A.C.; Ali, A.; Ali, S.S.; Mehmood, A.; Wei, D.-Q. Computational identification, characterization and validation of potential antigenic peptide vaccines from hrHPVs E6 proteins using immunoinformatics and computational systems biology approaches. PLoS ONE 2018, 13, e0196484. [Google Scholar]
- Naveed, M.; Jabeen, K.; Naz, R.; Mughal, M.S.; Rabaan, A.A.; Bakhrebah, M.A.; Alhoshani, F.M.; Aljeldah, M.; Shammari, B.R.A.; Alissa, M. Regulation of Host Immune Response against Enterobacter cloacae Proteins via Computational mRNA Vaccine Design through Transcriptional Modification. Microorganisms 2022, 10, 1621. [Google Scholar] [CrossRef] [PubMed]
- Naveed, M.; Ali, U.; Karobari, M.I.; Ahmed, N.; Mohamed, R.N.; Abullais, S.S.; Kader, M.A.; Marya, A.; Messina, P.; Scardina, G.A. A Vaccine Construction against COVID-19-Associated Mucormycosis Contrived with Immunoinformatics-Based Scavenging of Potential Mucoralean Epitopes. Vaccines 2022, 10, 664. [Google Scholar] [CrossRef] [PubMed]
- Kumar, V.; Sun, P.; Vamathevan, J.; Li, Y.; Ingraham, K.; Palmer, L.; Huang, J.; Brown, J.R. Comparative genomics of Klebsiella pneumoniae strains with different antibiotic resistance profiles. Antimicrob. Agents Chemother. 2011, 55, 4267–4276. [Google Scholar] [CrossRef] [PubMed]
- Consortium, T.U. UniProt: The universal protein knowledgebase in 2021. Nucleic Acids Res. 2021, 49, D480–D489. [Google Scholar] [CrossRef]
- Yu, C.-S.; Cheng, C.-W.; Su, W.-C.; Chang, K.-C.; Huang, S.-W.; Hwang, J.-K.; Lu, C.-H. CELLO2GO: A web server for protein subCELlular LOcalization prediction with functional gene ontology annotation. PLoS ONE 2014, 9, e99368. [Google Scholar] [CrossRef]
- Huang, Y.; Niu, B.; Gao, Y.; Fu, L.; Li, W. CD-HIT Suite: A web server for clustering and comparing biological sequences. Bioinformatics 2010, 26, 680–682. [Google Scholar] [CrossRef]
- Doytchinova, I.A.; Flower, D.R. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007, 8, 4. [Google Scholar] [CrossRef]
- Dimitrov, I.; Bangov, I.; Flower, D.R.; Doytchinova, I. AllerTOP v. 2—A server for in silico prediction of allergens. J. Mol. Model. 2014, 20, 2278. [Google Scholar]
- Krogh, A.; Larsson, B.; Von Heijne, G.; Sonnhammer, E.L. Predicting transmembrane protein topology with a hidden Markov model: Application to complete genomes. J. Mol. Biol. 2001, 305, 567–580. [Google Scholar]
- Jespersen, M.C.; Peters, B.; Nielsen, M.; Marcatili, P. BepiPred-2.0: Improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. 2017, 45, W24–W29. [Google Scholar] [CrossRef]
- Nielsen, M.; Lundegaard, C.; Worning, P.; Lauemøller, S.L.; Lamberth, K.; Buus, S.; Brunak, S.; Lund, O. Reliable prediction of T-cell epitopes using neural networks with novel sequence representations. Protein Sci. 2003, 12, 1007–1017. [Google Scholar] [CrossRef] [PubMed]
- Jensen, K.K.; Andreatta, M.; Marcatili, P.; Buus, S.; Greenbaum, J.A.; Yan, Z.; Sette, A.; Peters, B.; Nielsen, M. Improved methods for predicting peptide binding affinity to MHC class II molecules. Immunology 2018, 154, 394–406. [Google Scholar] [CrossRef] [PubMed]
- Bui, H.-H.; Sidney, J.; Dinh, K.; Southwood, S.; Newman, M.J.; Sette, A. Predicting population coverage of T-cell epitope-based diagnostics and vaccines. BMC Bioinform. 2006, 7, 153. [Google Scholar]
- Kanekiyo, M.; Ellis, D.; King, N.P. New vaccine design and delivery technologies. J. Infect. Dis. 2019, 219, S88–S96. [Google Scholar] [CrossRef]
- Al Tbeishat, H. Novel in silico mRNA vaccine design exploiting proteins of M. tuberculosis that modulates host immune responses by inducing epigenetic modifications. Sci. Rep. 2022, 12, 4645. [Google Scholar]
- Gasteiger, E.; Hoogland, C.; Gattiker, A.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein identification and analysis tools on the ExPASy server. In The Proteomics Protocols Handbook; Humana Press: Totova, NJ, USA, 2005; pp. 571–607. [Google Scholar]
- Gupta, S.; Kapoor, P.; Chaudhary, K.; Gautam, A.; Kumar, R.; Raghava, G.P. In silico approach for predicting toxicity of peptides and proteins. PLoS ONE 2013, 8, e73957. [Google Scholar] [CrossRef]
- Musil, M.; Konegger, H.; Hon, J.; Bednar, D.; Damborsky, J. Computational design of stable and soluble biocatalysts. ACS Catal. 2018, 9, 1033–1054. [Google Scholar] [CrossRef]
- Jones, D.T. Protein secondary structure prediction based on position-specific scoring matrices. J. Mol. Biol. 1999, 292, 195–202. [Google Scholar] [CrossRef]
- Ko, J.; Park, H.; Heo, L.; Seok, C. GalaxyWEB server for protein structure prediction and refinement. Nucleic Acids Res. 2012, 40, W294–W297. [Google Scholar]
- Laskowski, R.; MacArthur, M.; Thornton, J. PROCHECK: Validation of protein-structure coordinates. In International Tables for Crystallography; Rossmann, M.G., Arnold, E., Eds.; John Wiley & Sons, Ltd.: Chichester, UK, 2006; pp. 722–725. [Google Scholar]
- Colovos, C.; Yeates, T.O. Verification of protein structures: Patterns of nonbonded atomic interactions. Protein Sci. 1993, 2, 1511–1519. [Google Scholar] [CrossRef]
- Anderson, R.J.; Weng, Z.; Campbell, R.K.; Jiang, X. Main-chain conformational tendencies of amino acids. Proteins Struct. Funct. Bioinform. 2005, 60, 679–689. [Google Scholar] [CrossRef] [PubMed]
- Prajapat, R.; Marwal, A.; Gaur, R. Recognition of errors in the refinement and validation of three-dimensional structures of AC1 proteins of begomovirus strains by using ProSA-Web. J. Viruses 2014, 2014, 752656. [Google Scholar] [CrossRef]
- Desta, I.T.; Porter, K.A.; Xia, B.; Kozakov, D.; Vajda, S. Performance and its limits in rigid body protein-protein docking. Structure 2020, 28, 1071–1081.e3. [Google Scholar] [CrossRef] [PubMed]
- Weng, G.; Wang, E.; Wang, Z.; Liu, H.; Zhu, F.; Li, D.; Hou, T. HawkDock: A web server to predict and analyze the protein–protein complex based on computational docking and MM/GBSA. Nucleic Acids Res. 2019, 47, W322–W330. [Google Scholar] [CrossRef]
- Grote, A.; Hiller, K.; Scheer, M.; Münch, R.; Nörtemann, B.; Hempel, D.C.; Jahn, D. JCat: A novel tool to adapt codon usage of a target gene to its potential expression host. Nucleic Acids Res. 2005, 33, W526–W531. [Google Scholar] [CrossRef]
- Stolfi, P.; Castiglione, F. Emulating complex simulations by machine learning methods. BMC Bioinform. 2021, 22, 483. [Google Scholar] [CrossRef]
- Rapin, N.; Lund, O.; Castiglione, F. Immune system simulation online. Bioinformatics 2011, 27, 2013–2014. [Google Scholar] [CrossRef]
- Giglioli, N.; Saltelli, A. SimLab 1.1, Software for Sensitivity and Uncertainty Analysis, tool for sound modelling. arXiv 2000, arXiv:cs/0011031. [Google Scholar]
- Hara, Y.; Mohamed, R.; Nathan, S. Immunogenic Burkholderia pseudomallei outer membrane proteins as potential candidate vaccine targets. PLoS ONE 2009, 4, e6496. [Google Scholar] [CrossRef]
- Lewicki, M.; Kozioł, M.; Lorenc, K.; Kozioł, M.; Pawlicki, M.; Smoleń, A. Citrobacter freundii and Acinetobacter baumanii infection in a patient with neoplastic lung disease—Case report. Ann. Agric. Environ. Med. 2021, 28, 724–728. [Google Scholar] [CrossRef]
- Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. An evaluation of a recombinant multiepitope based antigen for detection of Toxoplasma gondii specific antibodies. BMC Infect. Dis. 2017, 17, 807. [Google Scholar] [CrossRef] [PubMed]
- Hammed-Akanmu, M.; Mim, M.; Osman, A.Y.; Sheikh, A.M.; Behmard, E.; Rabaan, A.A.; Suppain, R.; Hajissa, K. Designing a Multi-Epitope Vaccine against Toxoplasma gondii: An Immunoinformatics Approach. Vaccines 2022, 10, 1389. [Google Scholar] [CrossRef]
- Fahmi, M.; Kharisma, V.D.; Ansori, A.N.M.; Ito, M. Retrieval and Investigation of Data on SARS-CoV-2 and COVID-19 Using Bioinformatics Approach. Adv. Exp. Med. Biol. 2021, 1318, 839–857. [Google Scholar] [CrossRef] [PubMed]
- Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. Design and evaluation of a recombinant multi-epitope antigen for serodiagnosis of Toxoplasma gondii infection in humans. Parasites Vectors 2015, 8, 315. [Google Scholar] [CrossRef] [PubMed]
- Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. Immunogenicity of multiepitope vaccine candidate against Toxoplasma gondii infection in BALB/c mice. Iran. J. Parasitol. 2018, 13, 215. [Google Scholar]
- Hajissa, K.; Zakaria, R.; Suppian, R.; Mohamed, Z. Epitope-based vaccine as a universal vaccination strategy against Toxoplasma gondii infection: A mini-review. J. Adv. Vet. Anim. Res. 2019, 6, 174. [Google Scholar] [CrossRef]
- Shapiro, G.K.; Tatar, O.; Dube, E.; Amsel, R.; Knauper, B.; Naz, A.; Perez, S.; Rosberger, Z. The vaccine hesitancy scale: Psychometric properties and validation. Vaccine 2018, 36, 660–667. [Google Scholar] [CrossRef]
- Alharbi, M.; Alshammari, A.; Alasmari, A.F.; Alharbi, S.M.; Tahir Ul Qamar, M.; Ullah, A.; Ahmad, S.; Irfan, M.; Khalil, A.A.K. Designing of a Recombinant Multi-Epitopes Based Vaccine against Enterococcus mundtii Using Bioinformatics and Immunoinformatics Approaches. Int. J. Environ. Res. Public Health 2022, 19, 3729. [Google Scholar] [CrossRef]







| Population/Area | Class Combined | ||
|---|---|---|---|
| Coverage | Average Hit | pc90 | |
| World | 97.22% | 4.27 | 1.71 |
| Average | 97.22% | 4.27 | 1.71 |
| Standard Deviation | 0 | 0 | 0 |
| Target Protein Accession ID | Type of Epitopes | Total Shortlisted Epitopes | Epitope Sequences | TMHMM Score | Antigenicity Score |
|---|---|---|---|---|---|
| >UPI000021C373 | BCL | 2 | ISDKKFYNLSDTSGKGSLDYPLP | 0 | 0.9 |
| PARLNPVSGKVSPH | 1.2 | ||||
| CTL | 1 | RLNPVSGKV | 1.42 | ||
| HTL | 2 | LHYELVINNNPVNSL | 0.82 | ||
| HLHYELVINNNPVNS | 1.01 | ||||
| >UPI000272882E | BCL | 2 | SGSKSSDTGSYSG | 0 | 1.8 |
| GSSDATT | 2.7 | ||||
| CTL | 2 | GSKSSDTGSY | 1.7 | ||
| FQIRYRATAI | 1.06 | ||||
| HTL | 1 | NKGIDISAARGTPIY | 0.8 | ||
| >UPI0002B869E4 | BCL | 1 | VSINDLKQWNNLRGSSLK | 0 | 0.7 |
| CTL | 2 | YLHDVTLRA | 1.04 | ||
| PTDFWSLPL | 1.18 | ||||
| HTL | 2 | GRVMKAIKTNKARGK | 0.57 | ||
| PQYVMVPKKHAEKLR | 0.62 | ||||
| >UPI0004D735E6 | BCL | 2 | FAGENGNSTT | 0 | 1.6 |
| SGTDYGRS | 0.9 | ||||
| CTL | 2 | ALKNVPGVGA | 1.12 | ||
| APSAGTSAL | 1.06 | ||||
| HTL | 2 | KLGYRVNRNLDFQLN | 1.6 | ||
| DINQVIGDTTAARLN | 0.8 | ||||
| >UPI0004DAE55E | BCL | 2 | ADERDQLKSIQADIAAKERAVRQQQQQRSTLLA | 1 | 0.67 |
| SSGGQGR | 4 | ||||
| CTL | 2 | FSVRPLFYA | 1.16 | ||
| ASRKGSTYK | 1.73 | ||||
| HTL | 2 | RDQLKSIQADIAAKE | 0.64 | ||
| ERDQLKSIQADIAAK | 0.7 | ||||
| >UPI000C150917 | BCL | 2 | DQTDSVAVSH | 1 | 0.8 |
| GNSTSGQRGNN | 2.9 | ||||
| CTL | 2 | ASRKGSTYK | 1.73 | ||
| GEQLQGELRW | 1.17 | ||||
| HTL | 2 | DFSFRLNGNLDKTQA | 1.69 | ||
| GDFSFRLNGNLDKTQ | 1.44 |
| Vaccine Type | Proteome-Wide Peptides Based on MEVC Construct | Number of Amino Acids | Molecular Weight (kd) | Theoretical pI | Aliphatic Index | Hydropathicity (GRAVY) | Antigenicity Score | Solubility |
|---|---|---|---|---|---|---|---|---|
| Peptide | EAAAKISDKKFYNLSDTSGKGSLDYPLPPARLNPVSGKVSPHSGSKSSDTGSYSGGSSDATTVSINDLKQWNNLRRLANNSDSFAGENGNSTTSGTDYGRSADERDQLKSIQADIAAKERAVRQQQQQRSTLLASSGGQGRDQTDSVAVSHGNSTSGQRGNNCPGPGRLNPVSGKVGSKSSDTGSYFQIRYRATAIYLHDVTLRAPTDFWSLPLALKNVPGVGAAPSAGTSALFSVRPLFYAASRKGSTYKASRKGSTYKGEQLQGELRWAAYHLHYELVINNNPVNSLHYELVINNNPVNSLNKGIDISAARGTPIYGRVMKAIKTNKARGKPQYVMVPKKHAEKLRKLGYRVNRNLDFQLNDINQVIGDTTAARLNRDQLKSIQADIAAKEERDQLKSIQADIAAKHHHHHH | 414 | 44,938.96 | 9.86 | 71.47 | −0.731 | 0.9616 | 0.536 |
| mRNA | EAAAKMKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRGGPGPGLHYELVINNNPVNSLGPGPGHLHYELVINNNPVNSGPGPGNKGIDISAARGTPIYGPGPGGRVMKAIKTNKARGKGPGPGPQYVMVPKKHAEKLRGPGPGKLGYRVNRNLDFQLNGPGPGDINQVIGDTTAARLNGPGPGRDQLKSIQADIAAKEGPGPGERDQLKSIQADIAAKGPGPGDFSFRLNGNLDKTQAGPGPGGDFSFRLNGNLDKTQKKISDKKFYNLSDTSGKGSLDYPLPKKPARLNPVSGKVSPHKKSGSKSSDTGSYSGKKGSSDATTKKVSINDLKQWNNLRGSSLKKKGSSAQRLANNSDSKKFAGENGNSTTKKSGTDYGRSKKSSGGQGRKKDQTDSVAVSHKKGNSTSGQRGNNAAYRLNPVSGKVAAYGSKSSDTGSYAAYFQIRYRATAIAAYYLHDVTLRAAAYPTDFWSLPLAAYALKNVPGVGAAAYAPSAGTSALAAYFSVRPLFYAAAYASRKGSTYKAAYASRKGSTYKAAYGEQLQGELRWAAY | 692 | 71,897.13 | 9.8 | 62.2 | −0.63 | 1.08 | 0.764 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Naveed, M.; Hassan, J.-u.; Ahmad, M.; Naeem, N.; Mughal, M.S.; Rabaan, A.A.; Aljeldah, M.; Shammari, B.R.A.; Alissa, M.; Sabour, A.A.; et al. Designing mRNA- and Peptide-Based Vaccine Construct against Emerging Multidrug-Resistant Citrobacter freundii: A Computational-Based Subtractive Proteomics Approach. Medicina 2022, 58, 1356. https://doi.org/10.3390/medicina58101356
Naveed M, Hassan J-u, Ahmad M, Naeem N, Mughal MS, Rabaan AA, Aljeldah M, Shammari BRA, Alissa M, Sabour AA, et al. Designing mRNA- and Peptide-Based Vaccine Construct against Emerging Multidrug-Resistant Citrobacter freundii: A Computational-Based Subtractive Proteomics Approach. Medicina. 2022; 58(10):1356. https://doi.org/10.3390/medicina58101356
Chicago/Turabian StyleNaveed, Muhammad, Jawad-ul Hassan, Muneeb Ahmad, Nida Naeem, Muhammad Saad Mughal, Ali A. Rabaan, Mohammed Aljeldah, Basim R. Al Shammari, Mohammed Alissa, Amal A. Sabour, and et al. 2022. "Designing mRNA- and Peptide-Based Vaccine Construct against Emerging Multidrug-Resistant Citrobacter freundii: A Computational-Based Subtractive Proteomics Approach" Medicina 58, no. 10: 1356. https://doi.org/10.3390/medicina58101356
APA StyleNaveed, M., Hassan, J.-u., Ahmad, M., Naeem, N., Mughal, M. S., Rabaan, A. A., Aljeldah, M., Shammari, B. R. A., Alissa, M., Sabour, A. A., Alaeq, R. A., Alshiekheid, M. A., Turkistani, S. A., Elmi, A. H., & Ahmed, N. (2022). Designing mRNA- and Peptide-Based Vaccine Construct against Emerging Multidrug-Resistant Citrobacter freundii: A Computational-Based Subtractive Proteomics Approach. Medicina, 58(10), 1356. https://doi.org/10.3390/medicina58101356

