Next Article in Journal
Evidence Suggesting That Alzheimer’s Disease May Be a Transmissible Disorder
Previous Article in Journal
Cell Membrane-Integrated Neuroligin-1 Regulates the Anti-Inflammatory Effects of CRC Cell-Derived Exosomes
Previous Article in Special Issue
Strategic Optimization of the Middle Domain IIIA in RBP-Albumin IIIA-IB Fusion Protein to Enhance Productivity and Thermostability
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Hybridization Design and High-Throughput Screening of Peptides with Immunomodulatory and Antioxidant Activities

by
Junyong Wang
,
Rijun Zhang
*,
Xuelian Zhao
,
Jing Zhang
,
Yucui Tong
,
Zaheer Abbas
,
Zhenzhen Li
,
Haosen Zhang
,
Dayong Si
and
Xubiao Wei
*
Laboratory of Feed Biotechnology, State Key Laboratory of Animal Nutrition and Feeding, College of Animal Science and Technology, China Agricultural University, Beijing 100193, China
*
Authors to whom correspondence should be addressed.
Int. J. Mol. Sci. 2025, 26(2), 505; https://doi.org/10.3390/ijms26020505
Submission received: 31 December 2024 / Revised: 7 January 2025 / Accepted: 8 January 2025 / Published: 9 January 2025

Abstract

With the increasing recognition of the role of immunomodulation and oxidative stress in various diseases, designing peptides with both immunomodulatory and antioxidant activities has emerged as a promising therapeutic strategy. In this study, a hybridization design was applied as a powerful method to obtain multifunctional peptides. A total of 40 peptides with potential immunomodulatory and antioxidant activities were designed and screened. First, molecular docking was employed to screen peptides with a high binding affinity to MD2, a key receptor protein in the NFκB immune pathway. For the in vitro high-throughput screening, we constructed a reporter gene-based stable cell line, IPEC-J2-Lucia ARE cells, which was subsequently used to screen peptides with antioxidant activity. Furthermore, the biocompatibility, immunomodulatory, and antioxidant activities of these peptides were assessed. Among the candidates, the hybrid peptide VA exhibited the strongest immune-enhancing activity through the activation of the NF-κB pathway and significant antioxidant activity via the Nrf2-ARE pathway. Additionally, VA demonstrated protective effects against H2O2-induced oxidative damage in HepG2 cells. This study not only demonstrates the potential of peptide hybridization, but also develops a screening platform for multifunctional peptides. It provides a new tool for the treatment of autoimmune diseases and oxidative stress-related diseases.

1. Introduction

The immune system plays a crucial role in defense against foreign pathogens [1,2,3]. Immunodeficiency or dysregulation of the immune response can lead to a variety of diseases and, in severe cases, to cancer [4,5,6]. Toll-like receptors (TLRs), particularly TLR4/MD2, are key components of the innate immune system and are responsible for pathogen recognition [7]. TLR4/MD2 recognizes agonist molecules (e.g., lipopolysaccharide (LPS)) to initiate immune responses [7,8,9]. Therefore, targeting TLR4/MD2 for immune enhancements is an effective strategy to improve immune defense capacity [10,11,12].
Oxidative stress occurs when the body’s redox homeostasis is disrupted, which is usually due to an excess of reactive oxygen species (ROS) [13]. ROS can damage cellular DNA, proteins, and lipids, leading to cellular dysfunction and diseases such as cancer, atherosclerosis, and rheumatoid arthritis [13,14]. The Keap1-Nrf2-ARE pathway is a major antioxidant defense mechanism [14,15,16]. In response to ROS signaling, Nrf2 dissociates from Keap1 and translocates to the nucleus, where it binds to antioxidant response elements (ARE) and activates the expression of downstream antioxidant genes, thereby restoring redox homeostasis and protecting the cell from damage [16,17]. In recent years, considerable attention has been paid to the development of peptides that can modulate both immune regulation and oxidative stress [10,17,18,19,20]. However, few studies have focused on peptides that target both immune enhancement and antioxidant stress, which could offer more efficient and cost-effective solutions to issues in fields such as medicine, food, and agriculture.
Hybridization design strategies can combine functional fragments of different peptides to create hybrid peptides with multiple functions [21,22]. This approach has been widely applied in various research studies due to its simplicity and efficiency [23,24]. In addition to peptide design, another major challenge is identifying functional peptide fragments from large peptide sequence libraries. With the rapid development of computer technology, computational-based virtual screening has made the high-throughput screening of functional peptides possible [25,26]. Molecular docking, a powerful screening tool, allows for the efficient identification of peptide sequences with high binding affinity to target proteins, thus greatly reducing the workload of screening potential candidates [11,27,28]. There are several protein–peptide docking software tools available, such as ROSETTA FlexPepDock [29], ZDOCK [30], AUTO DOCK [31], HDOCK [32], and HADDOCK peptide [33]. Each docking software has its own algorithmic preferences that may yield a different performance depending on the specific task. HDOCK outperforms most docking software in global rigid-body blind docking, particularly in handling large-scale docking tasks, where it provides higher accuracy and efficiency. More importantly, HDOCK’s docking speed is so fast that the average processing time per project is less than 30 min [32]. This is especially important for rapid screening in drug development and molecular design. On the other hand, cell-based screening models utilizing luciferase reporter genes have greatly improved the efficiency of high-throughput drug screening [34,35,36]. Unlike virtual screening, cell-based assays ensure that potential bioactive targets are not overlooked. Additionally, the results obtained from cell-based assays are more convincing and reliable.
This study aims to design hybrid peptides that simultaneously target MD2 for immune regulation and the Nrf2-ARE pathway for antioxidant stress (Figure 1). Based on our previous research and the literature, we selected nine peptides as parent sequences for hybrid peptide design [22,37,38,39,40,41,42]. According to the results of our preliminary experiments, these peptides were divided into two groups: immune-modulatory peptides (P, Ta, Tb, A) and antioxidant peptides (R, H, Y, M, V) (Figure S1). Subsequently, 40 hybrid peptides were obtained through hybrid design. Through molecular docking, we identified potential immune-enhancing peptides that interact with MD2. Additionally, we used an ARE-based reporter gene assay to screen for peptides with antioxidant activity. By combining these two functions, we aim to discover hybrid peptides that both enhance immune responses and protect against oxidative stress, offering new therapeutic strategies for diseases associated with immunodeficiency and redox imbalance.

2. Results

2.1. Hybrid Peptide Design

Nine peptides with potential immunomodulatory or antioxidant activities were selected as parent peptides. The sequences of these parent peptides are listed in Table 1: TP5 (P), Tα1-a (Ta), Tα-b (Tb), Aβ (A), RP (R), PH (H), YG9 (Y), MMO (M), and VLP (V). Based on our preliminary experiments, the parent peptides were categorized into two groups: those with potential immunomodulatory activity (P, Ta, Tb, A) and those with antioxidant activity (R, H, Y, M, V). By hybridizing peptides from the two groups, a total of 40 designed hybrid peptides were obtained (Table 2).

2.2. Hybrid Peptide Sequence Information and Toxicity Prediction

Forty hybrid peptides were designed, and their sequence information, molecular weights, solubility, and toxicity profiles were summarized (Table 2). The length of the peptides ranged from 10 residues (PR) to 52 residues (AH) and the predicted molecular weights ranged from 1184.35 Da to 5800.44 Da. The solubility of all designed hybrid peptides was predicted to be “Good”, and toxicity predictions indicated that none of the peptides were toxic. These results suggest that the hybrid peptides do not pose significant biosafety concerns and are suitable for subsequent molecular docking screenings.

2.3. Three-Dimensional Modeling and Molecular Docking with HDOCK

The three-dimensional structures of all 40 hybrid peptides were predicted using PEPFOLD 3.5, generating 200 different models for each peptide. The top-ranked model for each peptide was selected for further docking studies and the predicted structures are shown in Figure 2. After obtaining the 3D structures of the hybrid peptides, global rigid docking simulations of the hybrid peptide were performed using HDOCK with the MD2 crystal structure (PDB ID: 2Z64) as the receptor. Each peptide was docked with MD2 for 4000 global random docking simulations, and the top-scoring docking pose for each peptide was selected as its optimal docking conformation with MD2. The 40 peptides were ranked according to their docking scores (Table 3). The hybrid peptide YP exhibited the highest HDOCK score of −309.2, while the lowest score was observed for RA (−131.3). Further structural analysis using Ramachandran plots confirmed that the docking complexes of all 40 peptides had high structural validity, with more than 90% of amino acid residues being located in the core+allowed region, indicating that the docking complex adheres to stereochemical conformational rules and is reasonable (Table 4). These results suggest that the docking complexes are valid and can be used for subsequent analysis. The top ten peptides based on docking scores were selected as candidates for further in vitro functional validation.

2.4. Biocompatibility of Hybrid Peptides

The biocompatibility of the chemically synthesized hybrid peptides was evaluated through hemolysis and cytotoxicity assays. The hemolysis assay results showed that the hemolysis rate of the ten candidate hybrid peptides and their corresponding parent peptides was less than 5% within the concentration range of 0–100 μg/mL (Figure 3a), indicating no significant hemolytic activity. The cytotoxicity of all candidate hybrid peptides in the range of 0–100 μg/mL was less than 20% (Figure 3b). These findings are consistent with the predicted biosafety results, further confirming the reliability of the computational predictions.

2.5. Screening Hybrid Peptides for Immune Modulatory and Antioxidant Activities Using Luciferase Reporter Assays

The immunomodulatory and antioxidant activities of the candidate hybrid peptides were screened using RAW-Lucia NF-κB and IPEC-J2-Lucia ARE cell lines, which were constructed in our laboratory. Figure 4a shows the results of the peptide activation of the NF-κB signaling pathway. The results indicated that hybrid peptides PR, RP, YTa, TbY, and VA significantly activated the NF-κB signaling pathway (p < 0.05), with VA showing the strongest activation; the activation level was increased 6.5-fold compared to the control group (Figure 4a). In terms of antioxidant activity, the hybrid peptides PY, YP, MP, TaY, and VA were found to stimulate the ARE pathway (Figure 5a). VA exhibited the highest ARE activation, with a three-fold increase compared to the control group. Taken together, these results demonstrate that the hybrid peptide VA possesses both immune-modulatory and antioxidant activities.

2.6. Immune-Enhancing Activity of Hybrid Peptides

The immune-modulatory effects of the hybrid peptides were evaluated by incubating them with RAW 264.7 mouse macrophage cells for 24 h, followed by measurement of the expression levels of immune-regulatory factors TNF-α, IL-6, and IL-1β (Figure 4b–d). The results showed that hybrid peptides PR, RP, MP, TaY, TbY, and VA significantly upregulated the expression of TNF-α, IL-6, and IL-1β. YTb particularly upregulated IL-6 and IL-1β, while YTa only significantly increased IL-6 expression. These results are consistent with those obtained from the RAW-Lucia NF-κB assay (Figure 4a), indicating that the in vitro screening and validation of immunomodulatory peptides using RAW-Lucia NF-κB is feasible.

2.7. Protective Effect of Hybrid Peptides Against H2O2-Induced Oxidative Damage in HepG2 Cells

To further assess the antioxidant activity of the hybrid peptides, we employed a hydrogen peroxide (H2O2)-induced oxidative damage model in HepG2 cells. The results are shown in Figure 5b. After 6 h of H2O2 treatment, cell viability dropped below 50%. However, pre-incubation with certain hybrid peptides significantly enhanced cell survival and alleviated H2O2-induced cell damage. Hybrid peptide treatment groups that showed significant differences compared to the model group included PY, MP, TaY, YTa, and VA. Among them, VA exhibited the strongest protective effect, increasing HepG2 cell viability by 30% compared to the H2O2-treated group (Figure 5b). Moreover, the weakest peptide (YTa) still resulted in a 12% increase in cell survival compared to the model group.

3. Discussion

Both immunomodulatory and antioxidant stress agents play vital roles in the prevention and treatment of various diseases [6,15,43,44]. In recent years, significant research has been dedicated to these two areas, with peptide-based drugs gaining considerable attention due to their high efficacy and low toxicity [45,46]. However, most peptide drug development has, thus far, targeted only one of these functions—either immunomodulatory or antioxidant stress—while peptides that combine both functions remain rare [18,20,44,47]. The aim of this study was to develop a peptide drug with both immunomodulatory and antioxidant properties.
Peptide hybridization represents an efficient and rapid approach for designing bifunctional or multifunctional peptides [21,23,24]. This method has been successfully used to generate peptides with dual or even multiple functions, providing promising therapeutic candidates and making the hypothesis of this study feasible [22]. In this study, based on a literature review and prior work in our laboratory, we selected nine peptides with immunomodulatory or antioxidant properties. These peptides were divided into two groups: the immunomodulatory peptide group (P, A, Ta, Tb) and the antioxidant stress peptide group (R, Y, M, V, H) (Table 1). Through peptide hybridization, we synthesized 40 hybrid peptides to screen for bifunctional hybrid peptides in this study (Table 2).
Traditionally, peptides are chemically synthesized and then tested for their functionality in vitro [47,48]. However, this method is not optimal for large-scale peptide screening due to the high costs associated with peptide synthesis. Recent advances in computational methods, such as virtual screening and molecular docking, have greatly enhanced the efficiency of drug discovery by enabling in silico screening [25,29,32]. These methods provide a cost-effective alternative.
The TLR4/MD2 complex is an important component of the pattern recognition receptor family, playing a critical role in the recognition of lipopolysaccharides (LPS) from Gram-negative bacteria [7,49]. Additionally, TLR4/MD2 is a valuable target for immunomodulatory agents, as it can activate the immune system and enhance cellular immune responses [9]. In the process of LPS recognition, the activation of TLR4 is dependent on the binding of LPS to MD2 [7,50]. This binding leads to a conformational change in TLR4, transducing extracellular signals into the cell and triggering a cascade of intracellular events [7,50]. Many immune-boosting agents targeting the TLR4-NF-κB pathway work through this mechanism, with drugs binding to MD2 to activate TLR4 [11,34,51]. Based on this principle, we used the crystal structure of MD2 as the receptor in molecular docking simulations, with the designed hybrid peptides being used as ligands. Using the HDOCK platform, we performed a global blind docking to analyze the potential binding modes of the hybrid peptides to MD2.
From the docking results, we selected the top 10 hybrid peptides, which were chemically synthesized for functional validation using the RAW-Lucia NF-κB reporter cell model. The results showed that five of these hybrid peptides (PR, RP, YTa, TbY, and VA) successfully enhanced the NF-κB pathway (Figure 4a). Furthermore, by measuring the expression of immune-regulatory cytokines (TNF-α, IL-6, and IL-1β) in RAW 264.7 cells treated with the hybrid peptides, we confirmed that these peptides promoted the expression of immune-regulatory factors (Figure 4b–d). These findings highlight the effectiveness of computational screening in identifying potential immunomodulatory peptides, while emphasizing the importance of experimental validation.
The Nrf2-ARE pathway is a key signaling pathway in the cellular response to oxidative stress, playing a crucial role in protecting cells against oxidative damage [13,14]. The Antioxidant Response Element (ARE, 5′-(A/G)TGACNNNGC(A/G)-3′) is a conserved sequence found in the promoter regions of detoxification and antioxidant genes; Nrf2 regulates the expression of these genes by binding to the ARE [14,35]. This activation leads to the transcription of genes such as NQO1, GST, GSH, and HO1, which are involved in cellular protection against harmful environments [16]. Therefore, by measuring the activation intensity of the ARE reporter gene, the activation level of the Nrf2-ARE signaling pathway by the test drugs can be indirectly assessed, providing further insights for research [35,52]. In this study, we constructed the IPEC-J2-Lucia ARE cell model to screen the candidate hybrid peptides’ ability to activate the ARE pathway. The results revealed that five of the hybrid peptides (PY, YP, MP, TaY, and VA) significantly activated ARE, with VA demonstrating the most potent antioxidant activity, increasing ARE activation threefold compared to the control group (Figure 5a). Meanwhile, we performed a secondary validation of the screening results using the H2O2-induced HepG2 oxidative damage model (Figure 5b). The results showed that PY, MP, TaY, and VA were consistent with the previous findings, further confirming the stability and reliability of the screening cell line we established.
Based on our designed screening process for immunomodulatory and antioxidative hybrid peptides, we ultimately identified a peptide, VA, that possesses both functions. Cell-based assays were conducted to validate the activity of VA, further confirming the feasibility of our hybrid peptide screening strategy. Additionally, many studies have been conducted using virtual screening based on molecular docking. However, most studies focus on screening from peptide libraries, with no specific functional targets [10,53]. For example, 519 peptides were derived from gelatin hydrolysates, and through molecular docking, only two peptides capable of binding to TLR4/MD2 were identified [10]. The efficiency of obtaining useful peptide sequences using this screening model is relatively low.
In contrast, using the approach designed in this study, we successfully obtained a hybrid peptide, VA, with both immune-modulatory and antioxidant activities, suggesting that our design and screening method can enhance the efficiency of obtaining functional peptides. However, as the current number of tests is relatively small, further large-scale experiments are necessary to fully validate the reliability and efficiency of our approach.
Moreover, our approach has certain limitations. It relies on accumulated experience and validation to select parent peptide sequences. Additionally, the activity of parent peptides from different sources can vary, making it challenging to achieve the desired outcomes in subsequent design and screening processes, especially when the initial activity of the parent peptide is weak. An example of this is the antioxidant parent peptide R (Figure 5). Therefore, an important focus for optimizing our approach in future work will be determining how to efficiently identify source peptides with strong biological activity.

4. Materials and Methods

4.1. Peptide Design and Synthesis

Parent peptides with potential immunomodulatory and antioxidant activities were identified, and hybrid peptides were constructed by combining the parent peptides. Details of the hybrid and parent peptides are provided in Table 1 and Table 2. The molecular weight and solubility of the peptides were predicted using the online tool provided by NovoPro (https://www.novopro.cn/tools/calc_peptide_property.html, (accessed on 7 January 2025)) (Shanghai, China). Toxicity predictions were made using the ToxinPred online tool (https://webs.iiitd.edu.in/raghava/toxinpred/, (accessed on 7 January 2025)). The hybrid peptides and corresponding parent peptides were synthesized by GL Biochem Ltd. with a purity of 95% (Shanghai, China). The molecular masses of the peptides were confirmed using MALDI-TOF-MS, and the data are provided in the Supplementary Materials.

4.2. Peptide Modeling and Molecular Docking

The 3D structures of all designed peptides were modeled using the PEP-FOLD 3.5 web server (https://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD3, (accessed on 7 January 2025)). The crystal structure of MD2 was retrieved from the Protein Data Bank (PDB ID: 2Z64). Molecular docking of the synthesized hybrid peptides with MD2 was performed using the HDOCK web server (http://hdock.phys.hust.edu.cn/, (accessed on 7 January 2025)). The structural validity of the docking complexes was assessed using the Ramachandran plot tool available at https://saves.mbi.ucla.edu/, (accessed on 7 January 2025). Based on the docking scores, the top ten hybrid peptide candidates were selected, synthesized, and further evaluated in vitro.

4.3. Cell Culture

RAW 264.7 mouse macrophages were purchased from the Shanghai Cell Bank, Institute of Cell Biology, Chinese Academy of Sciences, and cultured in Dulbecco’s Modified Eagle’s Medium (DMEM; HyClone, UT, USA), supplemented with 10% fetal bovine serum (Procell, Wuhan, China) and 1% penicillin–streptomycin (Solarbio, Beijing, China). Cells were maintained at 37 °C in a humidified environment with 5% CO2 and 95% air and passaged daily.
IPEC-J2 cells were obtained from Procell, cultured under the same conditions as RAW 264.7 cells, with medium changes every other day, and passaged every 3–4 days.
The RAW-Lucia NF-κB and IPEC-J2-Lucia ARE cell lines, stably transfected in-house, were maintained under identical conditions to their wild-type counterparts.

4.4. Construction of Luciferase Reporter Gene Stable Cell Lines and Luciferase Reporter Assay

The ARE sequences and NF-κB element sequences are referenced in [52,54]. Based on the sequence information, plasmids pCD-ARE-puro and pCDH-NF-κB-puro were constructed. These plasmids, along with pMD2.G and psPAX2, were transfected into HEK293T cells using a three-plasmid virus packaging system to produce viruses. The virus supernatants were then used to infect IPEC-J2 or RAW 264.7 cells, followed by positive clone screening with Puromycin. For the testing of stable cell lines, tBHQ was used for IPEC-J2-Lucia ARE cells and LPS was used for RAW-Lucia NF-κB cells.
Candidate peptides (100 μg/mL) were incubated with RAW-Lucia NF-κB or IPEC-J2-Lucia ARE cells (3 × 10⁵ cells/well) in 96-well plates for 12 h. LPS (100 ng/mL) was used as the positive control for the RAW-Lucia NF-κB cells and tBHQ (10 μM) was used as the positive control for the IPEC-J2-Lucia ARE cells. Subsequently, 15 μL of the culture supernatant was mixed with 50 μL of detection buffer (50 mM HEPES, pH 7.0; 50 mM NaCl; 0.05% CHAPS; 10 mM EDTA; and 1 μM coelenterazine). Luminescence was measured using a multimode plate reader, and relative luminescence units (RLUs) were calculated.

4.5. Cytotoxicity Assay

The cytotoxicity of the hybrid and parent peptides on RAW 264.7 cells was evaluated using a CCK-8 assay (Solarbio, Beijing, China). RAW 264.7 cells (3 × 10⁵ cells/well) were seeded into 96-well plates and incubated for 12 h, followed by treatment with various concentrations of hybrid peptides (0, 10, 20, 30, 40, 50, 60, 70, 80, 90, and 100 μg/mL) for 24 h. Afterward, 10 μL of CCK-8 reagent was added to each well and incubated at 37 °C for 0.5–2 h. Absorbance was measured at 450 nm, and cell viability was calculated using the following formula:
C e l l   v i a b i l i t y % = A S A B A C A B × 100 %
where AS is the absorbance of wells containing cells, CCK-8, and peptides; AB is the absorbance of wells containing medium and CCK-8 without cells; and AC is the absorbance of wells containing cells and CCK-8 without peptides.

4.6. Hemolysis Assay

Fresh sheep red blood cells (RBCs) (Solarbio, Beijing, China) were mixed with an equal volume of PBS and centrifuged at 800× g for 5 min. The supernatant was discarded and the RBCs were resuspended in PBS. This washing process was repeated until the supernatant became clear. An 8% RBC suspension was prepared by mixing the cells with PBS. Subsequently, 10 μL of various peptide concentrations (0, 10, 20, 30, 40, 50, 60, 70, 80, 90, and 100 μg/mL) were added to 96-well plates, followed by 90 μL of the RBC suspension. The plates were incubated at 37 °C for 1 h and centrifuged at 800× g for 5 min. The supernatant was collected for detection. Absorbance of the supernatant was measured at 414 nm. Triton X-100 (0.1%) served as the positive control and PBS was used as the negative control. Hemolysis was calculated using the following formula:
H e m o l y s i s   r a t e % = A A 0 A 1 × 100 %
where A is the absorbance of the sample, A0 is the absorbance of the negative control, and A1 is the absorbance of the positive control.

4.7. Enzyme-Linked Immunosorbent Assay (ELISA)

RAW 264.7 macrophages (2 × 106 cells/well) were seeded in 6-well plates and incubated for 12 h. Hybrid peptides and parent peptides were added to achieve a final concentration of 100 μg/mL, LPS (100 ng/mL) as a positive control. After 24 h of incubation, the culture supernatants were collected, and the levels of TNF-α, IL-6, and IL-1β were measured using ELISA kits according to the manufacturer’s instructions (Solarbio, Beijing, China).

4.8. H2O2-Induced Oxidative Damage Model in HepG2 Cells

HepG2 cells (2 × 105 cells/well) were seeded into 96-well plates and incubated overnight at 37 °C with 5% CO2. The supernatant was removed, and hybrid or parent peptides were added at a final concentration of 100 ng/mL for 2 h. H2O2 (Sigma-Aldrich, St. louis, MO, USA) was then added to a final concentration of 650 μM and the cells were further incubated for 6 h. Cell viability was assessed using the CCK-8 assay.

4.9. Statistical Analysis

Statistical analysis was performed using GraphPad Prism v9.0. Data were analyzed using Student’s t-test for comparisons between two groups. All data are expressed as the mean ± SD of at least three independent experiments. Statistical significance was defined as p ≤ 0.05. * p ≤ 0.05, ** p ≤ 0.01, *** p ≤ 0.001, and **** p ≤ 0.0001.

5. Conclusions

This study demonstrates the successful design and evaluation of hybrid peptides that can modulate both immune responses and oxidative stress. By utilizing peptide hybridization, we generated multifunctional peptides with combined immunomodulatory and antioxidant properties. The top-performing peptide, VA, exhibited significant activity in enhancing immune responses and protecting against oxidative stress, making it a promising candidate for further therapeutic development. Our approach not only expands the potential of peptide-based therapies but also provides a platform for the creation of multifunctional peptides with therapeutic applications in cancer, autoimmune disorders, and oxidative stress-related conditions.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms26020505/s1.

Author Contributions

Conceptualization, J.W., R.Z. and X.W.; data curation, X.Z.; formal analysis, J.W.; funding acquisition, X.W., D.S. and R.Z.; investigation, X.Z. and J.W.; methodology, J.W., J.Z. and Y.T.; project administration, X.W., D.S. and R.Z.; resources, J.W.; software, J.W., H.Z. and Z.L.; validation, X.Z. and J.Z.; visualization, J.W. and X.Z.; writing—original draft, J.W.; writing—review and editing, J.W., J.Z., Z.A. and X.W. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the National Key R & D projects of China (No. 2022YFD1300700).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data are contained within the article.

Conflicts of Interest

The authors declare no conflicts of interest.

Abbreviations

The following abbreviations are used in this manuscript:
TLR4Toll-like receptor 4
MD2Myeloid differentiation protein-2
LPSLipopolysaccharides
NF-κBNuclear factor kappa-B
AREAntioxidant response elements
Keap1Kelch-like ECH-associated protein 1
Nrf2Nuclear factor erythroid 2-related factor 2
TNF-αTumor necrosis factor-α
IL-6Interleukin-6
IL-1βInterleukin-1β

References

  1. Wang, J.; Han, C.; Lu, Z.; Ge, P.; Cui, Y.; Zhao, D.; Yang, X.; Wu, B.; Qiang, L.; Zhang, Y.; et al. Simulated microgravity suppresses MAPK pathway-mediated innate immune response to bacterial infection and induces gut microbiota dysbiosis. FASEB J. 2020, 34, 14631–14644. [Google Scholar] [CrossRef] [PubMed]
  2. Kim, S.M.; Park, S.; Hwang, S.H.; Lee, E.Y.; Kim, J.H.; Lee, G.S.; Lee, G.; Chang, D.H.; Lee, J.G.; Hwang, J.; et al. Secreted Akkermansia muciniphila threonyl-tRNA synthetase functions to monitor and modulate immune homeostasis. Cell Host Microbe 2023, 31, 1021–1037.e1010. [Google Scholar] [CrossRef]
  3. Wraith, D.C. The Future of Immunotherapy: A 20-Year Perspective. Front. Immunol. 2017, 8, 1668. [Google Scholar] [CrossRef] [PubMed]
  4. Ferlay, J.; Shin, H.R.; Bray, F.; Forman, D.; Mathers, C.; Parkin, D.M. Estimates of worldwide burden of cancer in 2008: GLOBOCAN 2008. Int. J. Cancer 2010, 127, 2893–2917. [Google Scholar] [CrossRef] [PubMed]
  5. Cao, L.L.; Kagan, J.C. Targeting innate immune pathways for cancer immunotherapy. Immunity 2023, 56, 2206–2217. [Google Scholar] [CrossRef]
  6. Goldszmid, R.S.; Dzutsev, A.; Trinchieri, G. Host immune response to infection and cancer: Unexpected commonalities. Cell Host Microbe 2014, 15, 295–305. [Google Scholar] [CrossRef] [PubMed]
  7. Fitzgerald, K.A.; Kagan, J.C. Toll-like Receptors and the Control of Immunity. Cell 2020, 180, 1044–1066. [Google Scholar] [CrossRef]
  8. Li, W.; Liu, M.; Lai, S.; Xu, C.; Lu, F.; Xiao, X.; Bao, Y. Immunomodulatory effects of polysaccharopeptide (PSP) in human PBMC through regulation of TRAF6/TLR immunosignal-transduction pathways. Immunopharmacol. Immunotoxicol. 2010, 32, 576–584. [Google Scholar] [CrossRef] [PubMed]
  9. Zhou, L.; Liu, Z.; Wang, Z.; Yu, S.; Long, T.; Zhou, X.; Bao, Y. Astragalus polysaccharides exerts immunomodulatory effects via TLR4-mediated MyD88-dependent signaling pathway in vitro and in vivo. Sci. Rep. 2017, 7, 44822. [Google Scholar] [CrossRef]
  10. Yu, Z.; Wang, Y.; Shuian, D.; Liu, J.; Zhao, W. Identification and Molecular Mechanism of Novel Immunomodulatory Peptides from Gelatin Hydrolysates: Molecular Docking, Dynamic Simulation, and Cell Experiments. J. Agric. Food Chem. 2023, 71, 2924–2934. [Google Scholar] [CrossRef]
  11. Wang, Z.; Chen, G.; Chen, L.; Liu, X.; Fu, W.; Zhang, Y.; Li, C.; Liang, G.; Cai, Y. Insights into the binding mode of curcumin to MD-2: Studies from molecular docking, molecular dynamics simulations and experimental assessments. Mol. Biosyst. 2015, 11, 1933–1938. [Google Scholar] [CrossRef] [PubMed]
  12. Wu, S.; Zhang, C.; Wang, Y.; Li, P.; Du, X.; Wang, X. Dissecting the species-specific recognition of Neoseptin 3 by TLR4/MD2 via molecular dynamics simulations. Phys. Chem. Chem. Phys. 2023, 25, 13012–13018. [Google Scholar] [CrossRef]
  13. Halliwell, B. Understanding mechanisms of antioxidant action in health and disease. Nat. Rev. Mol. Cell Biol. 2023, 25, 13–33. [Google Scholar] [CrossRef] [PubMed]
  14. Raghunath, A.; Sundarraj, K.; Nagarajan, R.; Arfuso, F.; Bian, J.; Kumar, A.P.; Sethi, G.; Perumal, E. Antioxidant response elements: Discovery, classes, regulation and potential applications. Redox Biol. 2018, 17, 297–314. [Google Scholar] [CrossRef]
  15. Zhu, L.; He, S.; Huang, L.; Ren, D.; Nie, T.; Tao, K.; Xia, L.; Lu, F.; Mao, Z.; Yang, Q. Chaperone-mediated autophagy degrades Keap1 and promotes Nrf2-mediated antioxidative response. Aging Cell 2022, 21, e13616. [Google Scholar] [CrossRef] [PubMed]
  16. Liu, S.; Pi, J.; Zhang, Q. Signal amplification in the KEAP1-NRF2-ARE antioxidant response pathway. Redox Biol. 2022, 54, 102389. [Google Scholar] [CrossRef]
  17. Abed, D.A.; Goldstein, M.; Albanyan, H.; Jin, H.; Hu, L. Discovery of direct inhibitors of Keap1–Nrf2 protein–protein interaction as potential therapeutic and preventive agents. Acta Pharm. Sin. B 2015, 5, 285–299. [Google Scholar] [CrossRef] [PubMed]
  18. Luan, J.; Wang, L.; Yang, J.; Li, X.; Wang, J.; Cui, F.; Mi, H.; Xu, Y.; Yi, S.; Li, J. Identification, molecular docking, and protective effects on H2O2-induced HEK-293 cell oxidative damage of antioxidant peptides from Pacific saury (Cololabis saira). Food Funct. 2023, 14, 160–170. [Google Scholar] [CrossRef]
  19. Miao, X.; Liu, X.; Chen, H.; Wang, C.; Diao, J. Restoration and preservation effects of mung bean antioxidant peptides on H2O2-induced WRL-68 cells via Keap1-Nrf2 pathway. Food Sci. Nutr. 2023, 11, 7130–7144. [Google Scholar] [CrossRef]
  20. Lai, J.; Yao, Y.; Zhang, Y.; Liu, Y.; Lu, C.; Meng, C.; Xia, D.; Li, Y.; Cao, K.; Gao, X.; et al. Cell-Penetrating Peptide Conjugated Au Nanoclusters Selectively Suppress Refractory Lymphoma Cells via Targeting Both Canonical and Noncanonical NF-κB Signaling Pathways. Bioconjug. Chem. 2023, 34, 228–237. [Google Scholar] [CrossRef] [PubMed]
  21. Kumar, S.D.; Kim, E.Y.; Radhakrishnan, N.K.; Bang, J.K.; Yang, S.; Shin, S.Y. Enhanced Antibacterial, Anti-Inflammatory, and Antibiofilm Activities of Tryptophan-Substituted Peptides Derived from Cecropin A-Melittin Hybrid Peptide BP100. Molecules 2024, 29, 5231. [Google Scholar] [CrossRef]
  22. Wang, J.; Tang, Y.; Zhao, X.; Ding, Z.; Ahmat, M.; Si, D.; Zhang, R.; Wei, X. Molecular hybridization modification improves the stability and immunomodulatory activity of TP5 peptide. Front. Immunol. 2024, 15, 1472839. [Google Scholar] [CrossRef] [PubMed]
  23. Trevellin, G.F.; Kwag, J.; Shui, M.L.; Klim, H.; Alvarez, V.; Darling, L.E.O.; Elmore, D.E. Hybrids of Membrane-Translocating Antimicrobial Peptides Show Enhanced Activity through Membrane Permeabilization. ACS Med. Chem. Lett. 2024, 15, 1918–1924. [Google Scholar] [CrossRef] [PubMed]
  24. Zhang, L.; Wei, X.; Zhang, R.; Si, D.; Petitte, J.N.; Ahmad, B.; Zhang, M. A Novel Peptide Ameliorates LPS-Induced Intestinal Inflammation and Mucosal Barrier Damage via Its Antioxidant and Antiendotoxin Effects. Int. J. Mol. Sci. 2019, 20, 3974. [Google Scholar] [CrossRef]
  25. Tsaban, T.; Varga, J.K.; Avraham, O.; Ben-Aharon, Z.; Khramushin, A.; Schueler-Furman, O. Harnessing protein folding neural networks for peptide-protein docking. Nat. Commun. 2022, 13, 176. [Google Scholar] [CrossRef]
  26. Rajpoot, S.; Solanki, K.; Kumar, A.; Zhang, K.Y.J.; Pullamsetti, S.S.; Savai, R.; Faisal, S.M.; Pan, Q.; Baig, M.S. In-Silico Design of a Novel Tridecapeptide Targeting Spike Protein of SARS-CoV-2 Variants of Concern. Int. J. Pept. Res. Ther. 2022, 28, 28. [Google Scholar] [CrossRef] [PubMed]
  27. Masomian, M.; Lalani, S.; Poh, C.L. Molecular Docking of SP40 Peptide towards Cellular Receptors for Enterovirus 71 (EV-A71). Molecules 2021, 26, 6576. [Google Scholar] [CrossRef]
  28. Wong, F.; Krishnan, A.; Zheng, E.J.; Stark, H.; Manson, A.L.; Earl, A.M.; Jaakkola, T.; Collins, J.J. Benchmarking AlphaFold-enabled molecular docking predictions for antibiotic discovery. Mol. Syst. Biol. 2022, 18, e11081. [Google Scholar] [CrossRef] [PubMed]
  29. Raveh, B.; London, N.; Schueler-Furman, O. Sub-angstrom modeling of complexes between flexible peptides and globular proteins. Proteins 2010, 78, 2029–2040. [Google Scholar] [CrossRef]
  30. Pierce, B.G.; Wiehe, K.; Hwang, H.; Kim, B.H.; Vreven, T.; Weng, Z. ZDOCK server: Interactive docking prediction of protein-protein complexes and symmetric multimers. Bioinformatics 2014, 30, 1771–1773. [Google Scholar] [CrossRef]
  31. Eberhardt, J.; Santos-Martins, D.; Tillack, A.F.; Forli, S. AutoDock Vina 1.2.0: New Docking Methods, Expanded Force Field, and Python Bindings. J. Chem. Inf. Model. 2021, 61, 3891–3898. [Google Scholar] [CrossRef] [PubMed]
  32. Yan, Y.; Tao, H.; He, J.; Huang, S.Y. The HDOCK server for integrated protein-protein docking. Nat. Protoc. 2020, 15, 1829–1852. [Google Scholar] [CrossRef] [PubMed]
  33. Geng, C.; Narasimhan, S.; Rodrigues, J.P.; Bonvin, A.M. Information-Driven, Ensemble Flexible Peptide Docking Using HADDOCK. Methods Mol. Biol. 2017, 1561, 109–138. [Google Scholar] [CrossRef] [PubMed]
  34. Sung, N.-Y.; Jung, P.-M.; Yoon, M.; Kim, J.-S.; Choi, J.-I.; Jeong, H.G.; Lee, J.-W.; Kim, J.-H. Anti-inflammatory effect of sweetfish-derived protein and its enzymatic hydrolysate on LPS-induced RAW264.7 cells via inhibition of NF-κB transcription. Fish. Sci. 2012, 78, 381–390. [Google Scholar] [CrossRef]
  35. Wang, X.J.; Hayes, J.D.; Wolf, C.R. Generation of a stable antioxidant response element-driven reporter gene cell line and its use to show redox-dependent activation of nrf2 by cancer chemotherapeutic agents. Cancer Res. 2006, 66, 10983–10994. [Google Scholar] [CrossRef]
  36. Hou, Y.; Wang, Z.; Liu, P.; Wei, X.; Zhang, Z.; Fan, S.; Zhang, L.; Han, F.; Song, Y.; Chu, L.; et al. SMPDL3A is a cGAMP-degrading enzyme induced by LXR-mediated lipid metabolism to restrict cGAS-STING DNA sensing. Immunity 2023, 56, 2492–2507.e2410. [Google Scholar] [CrossRef] [PubMed]
  37. Yang, Q.; Cai, X.X.; Huang, M.C.; Wang, S.Y. A specific peptide with immunomodulatory activity from Pseudostellaria heterophylla and the action mechanism. J. Funct. Foods 2020, 68, 9. [Google Scholar] [CrossRef]
  38. He, P.; Wang, Q.; Zhan, Q.; Pan, L.; Xin, X.; Wu, H.; Zhang, M. Purification and characterization of immunomodulatory peptides from enzymatic hydrolysates of duck egg ovalbumin. Food Funct. 2021, 12, 668–681. [Google Scholar] [CrossRef] [PubMed]
  39. Yang, Q.; Cai, X.; Huang, M.; Chen, X.; Tian, Y.; Chen, G.; Wang, M.; Wang, S.; Xiao, J. Isolation, Identification, and Immunomodulatory Effect of a Peptide from Pseudostellaria heterophylla Protein Hydrolysate. J. Agric. Food Chem. 2020, 68, 12259–12270. [Google Scholar] [CrossRef]
  40. Zhang, W.; Ye, L.; Wang, F.; Zheng, J.; Tian, X.; Chen, Y.; Ding, G.; Yang, Z. Immunomodulatory Effects of the Meretrix Meretrix Oligopeptide (QLNWD) on Immune-Deficient Mice. Molecules 2019, 24, 4452. [Google Scholar] [CrossRef]
  41. Devi, S.; Kumar, N.; Kapila, S.; Mada, S.B.; Reddi, S.; Vij, R.; Kapila, R. Buffalo casein derived peptide can alleviates H2O2 induced cellular damage and necrosis in fibroblast cells. Exp. Toxicol. Pathol. 2017, 69, 485–495. [Google Scholar] [CrossRef]
  42. Zhang, L.; Wei, X.; Zhang, R.; Koci, M.; Si, D.; Ahmad, B.; Cheng, J.; Wang, J. Development of a Highly Efficient Hybrid Peptide That Increases Immunomodulatory Activity Via the TLR4-Mediated Nuclear Factor-κB Signaling Pathway. Int. J. Mol. Sci. 2019, 20, 6161. [Google Scholar] [CrossRef] [PubMed]
  43. Duan, T.; Du, Y.; Xing, C.; Wang, H.Y.; Wang, R.F. Toll-Like Receptor Signaling and Its Role in Cell-Mediated Immunity. Front. Immunol. 2022, 13, 812774. [Google Scholar] [CrossRef]
  44. Pei, X.-D.; He, Y.-N.; Wu, Q.-L.; Zhang, Y.-M.; Li, F.; Jiao, D.-Q.; Liu, X.-L.; Wang, C.-H. Novel Antioxidant Peptides Derived from Feather Keratin Alleviate H2O2-Induced Oxidative Damage in HepG2 Cells via Keap1/Nrf2 Pathway. J. Agric. Food Chem. 2023, 71, 20062–20072. [Google Scholar] [CrossRef] [PubMed]
  45. Henninot, A.; Collins, J.C.; Nuss, J.M. The Current State of Peptide Drug Discovery: Back to the Future? J. Med. Chem. 2018, 61, 1382–1414. [Google Scholar] [CrossRef]
  46. Otvos, L. The latest trends in peptide drug discovery and future challenges. Expert Opin. Drug Discov. 2024, 19, 869–872. [Google Scholar] [CrossRef] [PubMed]
  47. Zhang, J.; Sun, Y.; Sun, C.; Shang, D. The antimicrobial peptide LK2(6)A(L) exhibits anti-inflammatory activity by binding to the myeloid differentiation 2 domain and protects against LPS-induced acute lung injury in mice. Bioorg. Chem. 2023, 132, 106376. [Google Scholar] [CrossRef]
  48. Xiang, W.; Clemenza, P.; Klousnitzer, J.; Chen, J.; Qin, W.; Tristram-Nagle, S.; Doi, Y.; Di, Y.P.; Deslouches, B. Rational Framework for the Design of Trp- and Arg-Rich Peptide Antibiotics Against Multidrug-Resistant Bacteria. Front. Microbiol. 2022, 13, 889791. [Google Scholar] [CrossRef] [PubMed]
  49. Kim, H.M.; Park, B.S.; Kim, J.I.; Kim, S.E.; Lee, J.; Oh, S.C.; Enkhbayar, P.; Matsushima, N.; Lee, H.; Yoo, O.J.; et al. Crystal structure of the TLR4-MD-2 complex with bound endotoxin antagonist Eritoran. Cell 2007, 130, 906–917. [Google Scholar] [CrossRef]
  50. Ciesielska, A.; Matyjek, M.; Kwiatkowska, K. TLR4 and CD14 trafficking and its influence on LPS-induced pro-inflammatory signaling. Cell. Mol. Life Sci. 2021, 78, 1233–1261. [Google Scholar] [CrossRef] [PubMed]
  51. Ain, Q.U.; Batool, M.; Choi, S. TLR4-Targeting Therapeutics: Structural Basis and Computer-Aided Drug Discovery Approaches. Molecules 2020, 25, 627. [Google Scholar] [CrossRef] [PubMed]
  52. Mineo, S.; Takahashi, N.; Yamada-Hara, M.; Tsuzuno, T.; Aoki-Nonaka, Y.; Tabeta, K. Rice bran-derived protein fractions enhance sulforaphane-induced anti-oxidative activity in gingival epithelial cells. Arch. Oral Biol. 2021, 129, 105215. [Google Scholar] [CrossRef]
  53. Xiao, T.; Zeng, J.; Qiu, L.; Wang, R.; Li, N.; Deng, Z.; Zheng, L. Combining in silico and in vitro approaches to identify endogenous hypoglycemic peptides from human milk. Food Funct. 2022, 13, 2899–2912. [Google Scholar] [CrossRef] [PubMed]
  54. Jin, W.J.; Kim, B.; Kim, D.; Park Choo, H.Y.; Kim, H.H.; Ha, H.; Lee, Z.H. NF-κB signaling regulates cell-autonomous regulation of CXCL10 in breast cancer 4T1 cells. Exp. Mol. Med. 2017, 49, e295. [Google Scholar] [CrossRef]
Figure 1. Workflow for the design and screening of immunomodulatory and antioxidant hybrid peptides.
Figure 1. Workflow for the design and screening of immunomodulatory and antioxidant hybrid peptides.
Ijms 26 00505 g001
Figure 2. Three-dimensional structural modeling of 40 hybrid peptides using PEPFOLD 3.5.
Figure 2. Three-dimensional structural modeling of 40 hybrid peptides using PEPFOLD 3.5.
Ijms 26 00505 g002
Figure 3. Biocompatibility evaluation of candidate hybrid peptides and their parent peptides. (a) Hemolytic activity of hybrid peptides and their parent peptides on sheep red blood cells. (b) Cytotoxicity of hybrid peptides and their parent peptides on RAW 264.7 cells. The data are presented as the mean ± SD (n = 3).
Figure 3. Biocompatibility evaluation of candidate hybrid peptides and their parent peptides. (a) Hemolytic activity of hybrid peptides and their parent peptides on sheep red blood cells. (b) Cytotoxicity of hybrid peptides and their parent peptides on RAW 264.7 cells. The data are presented as the mean ± SD (n = 3).
Ijms 26 00505 g003
Figure 4. Immunomodulatory activity of candidate hybrid peptides. (a) Level of activation of RAW-Lucia NF-κB cells by hybrid peptides and their parent peptides. (bd) Effect of hybrid peptides and their parent peptides on the secretion levels of immune-modulatory factors TNF-α (b), IL-1β (c), and IL-6 (d) in RAW 264.7 cells. The data are presented as the mean ± SD (n = 3). * p ≤ 0.05, ** p ≤ 0.01, *** p ≤ 0.001, and **** p ≤ 0.0001 compared to the CON group.
Figure 4. Immunomodulatory activity of candidate hybrid peptides. (a) Level of activation of RAW-Lucia NF-κB cells by hybrid peptides and their parent peptides. (bd) Effect of hybrid peptides and their parent peptides on the secretion levels of immune-modulatory factors TNF-α (b), IL-1β (c), and IL-6 (d) in RAW 264.7 cells. The data are presented as the mean ± SD (n = 3). * p ≤ 0.05, ** p ≤ 0.01, *** p ≤ 0.001, and **** p ≤ 0.0001 compared to the CON group.
Ijms 26 00505 g004
Figure 5. Screening and verification of the antioxidant activity of candidate hybrid peptides. (a) Stimulation activity of candidate hybrid peptides and their parent peptides on IPEC-J2-Lucia ARE cells. *** p ≤ 0.001 and **** p ≤ 0.0001 compared to the CON group. (b) Protective effect of candidate hybrid peptides and their parent peptides on H2O2-induced oxidative damage in the HepG2 model. ** p ≤ 0.01, *** p ≤ 0.001, and **** p ≤ 0.0001 compared to the H2O2-treated group.
Figure 5. Screening and verification of the antioxidant activity of candidate hybrid peptides. (a) Stimulation activity of candidate hybrid peptides and their parent peptides on IPEC-J2-Lucia ARE cells. *** p ≤ 0.001 and **** p ≤ 0.0001 compared to the CON group. (b) Protective effect of candidate hybrid peptides and their parent peptides on H2O2-induced oxidative damage in the HepG2 model. ** p ≤ 0.01, *** p ≤ 0.001, and **** p ≤ 0.0001 compared to the H2O2-treated group.
Ijms 26 00505 g005
Table 1. Sequence information of parent peptides.
Table 1. Sequence information of parent peptides.
PeptideSequenceAbbreviation
TP5RKDVYP
Tα1-aKEKKEVVETa
Tα1-bEVVEEATb
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGA
RP5RGPPPR
PHTQIDKVVHFDKLPGFH
YG9YGPSSYGYGY
MMOQLNWDM
VLPVLPVPQKV
Table 2. Sequence information of hybrid peptides.
Table 2. Sequence information of hybrid peptides.
Peptide NameSequenceResidue NumberMolecular Weight (Da)Water SolubilityToxicity Prediction
1PRRKDVYRGPPP101184.35Goodnon
2PVRKDVYVLPVPQK121441.71Goodnon
3PHRKDVYTQIDKVVHFDKLPGF202405.75Goodnon
4PYRKDVYYGPSSYGYG141611.71Goodnon
5PMRKDVYQLNWD101336.45Goodnon
6RPRGPPPRKDVY101184.35Goodnon
7VPVLPVPQKRKDVY121441.71Goodnon
8HPTQIDKVVHFDKLPGFRKDVY202405.75Goodnon
9YPYGPSSYGYGRKDVY141611.71Goodnon
10MPQLNWDRKDVY101336.45Goodnon
11TaRKEKKEVVERGPPP131492.72Goodnon
12TaVKEKKEVVEVLPVPQK151750.08Goodnon
13TaHKEKKEVVETQIDKVVHFDKLPGF232714.12Goodnon
14TaYKEKKEVVEYGPSSYGYG171920.08Goodnon
15TaMKEKKEVVEQLNWD131644.82Goodnon
16RTaRGPPPKEKKEVVE131492.72Goodnon
17VTaVLPVPQKKEKKEVVE151750.08Goodnon
18HTaTQIDKVVHFDKLPGFKEKKEVVE232714.12Goodnon
19YTaYGPSSYGYGKEKKEVVE171920.08Goodnon
20MTaQLNWDKEKKEVVE131644.82Goodnon
21TbREVVEEARGPPP111179.28Goodnon
22TbVEVVEEAVLPVPQK131436.64Goodnon
23TbHEVVEEATQIDKVVHFDKLPGF212400.68Goodnon
24TbYEVVEEAYGPSSYGYG151606.64Goodnon
25TbMEVVEEAQLNWD111331.38Goodnon
26RTbRGPPPEVVEEA111179.28Goodnon
27VTbVLPVPQKEVVEEA131436.64Goodnon
28HTbTQIDKVVHFDKLPGFEVVEEA212400.68Goodnon
29YTbYGPSSYGYGEVVEEA151606.64Goodnon
30MTbQLNWDEVVEEA111331.38Goodnon
31ARDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGRGPPP424579.05Goodnon
32AVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGVLPVPQK444836.42Goodnon
33AHDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGTQIDKVVHFDKLPGF525800.44Goodnon
34AYDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGYGPSSYGYG465006.41Goodnon
35AMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGQLNWD424731.15Goodnon
36RARGPPPDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG424579.05Goodnon
37VAVLPVPQKDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG444836.42Goodnon
38HATQIDKVVHFDKLPGFDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG525800.44Goodnon
39YAYGPSSYGYGDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG465006.41Goodnon
40MAQLNWDDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG424731.15Goodnon
Table 3. HDOCK docking scores of hybrid peptides.
Table 3. HDOCK docking scores of hybrid peptides.
PeptideSequenceHDOCK Score
1YPYGPSSYGYGRKDVY−309.2
2PYRKDVYYGPSSYGYG−229.8
3YTaYGPSSYGYGKEKKEVVE−207.6
4VAVLPVPQKDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG−203.7
5PRRKDVYRGPPP−198.1
6MPQLNWDRKDVY−194.6
7RPRGPPPRKDVY−193.1
8YTbYGPSSYGYGEVVEEA−191.2
9TbYEVVEEAYGPSSYGYG−191
10TaYKEKKEVVEYGPSSYGYG−189.6
11TaVKEKKEVVEVLPVPQK−184
12PVRKDVYVLPVPQK−182.3
13PHRKDVYTQIDKVVHFDKLPGF−179.4
14VTaVLPVPQKKEKKEVVE−177.2
15TaHKEKKEVVETQIDKVVHFDKLPGF−176.6
16PMRKDVYQLNWD−176.3
17HTaTQIDKVVHFDKLPGFKEKKEVVE−175.3
18MTbQLNWDEVVEEA−175.1
19TbHEVVEEATQIDKVVHFDKLPGF−174.7
20AHDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGTQIDKVVHFDKLPGF−172.8
21HTbTQIDKVVHFDKLPGFEVVEEA−172.6
22TbVEVVEEAVLPVPQK−169.9
23TbMEVVEEAQLNWD−169.2
24VPVLPVPQKRKDVY−167.6
25VTbVLPVPQKEVVEEA−167.5
26HPTQIDKVVHFDKLPGFRKDVY−167.3
27AYDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGYGPSSYGYG−163.9
28YAYGPSSYGYGDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG−163.8
29HATQIDKVVHFDKLPGFDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG−162.2
30AVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGVLPVPQK−161.9
31AMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGQLNWD−158.1
32TaMKEKKEVVEQLNWD−157.8
33TbREVVEEARGPPP−156.2
34MAQLNWDDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG−154.4
35TaRKEKKEVVERGPPP−153.8
36MTaQLNWDKEKKEVVE−151.2
37RTaRGPPPKEKKEVVE−144.8
38ARDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGRGPPP−140.4
39RTbRGPPPEVVEEA−136.8
40RARGPPPDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG−131.3
Table 4. Ramachandran plot analysis of the conformational plausibility of docking complexes.
Table 4. Ramachandran plot analysis of the conformational plausibility of docking complexes.
Peptide
Name
SequenceCoreAllowCore+
Allow
GenerDisall
1PRRKDVYRGPPP83.116.199.20.00.8
2PVRKDVYVLPVPQK84.314.298.50.01.5
3PHRKDVYTQIDKVVHFDKLPGF83.715.699.30.70.0
4PYRKDVYYGPSSYGYG84.415.6100.00.00.0
5PMRKDVYQLNWD83.515.799.20.80.0
6RPRGPPPRKDVY85.414.6100.00.00.0
7VPVLPVPQKRKDVY83.616.4100.00.00.0
8HPTQIDKVVHFDKLPGFRKDVY82.217.8100.00.00.0
9YPYGPSSYGYGRKDVY82.717.3100.00.00.0
10MPQLNWDRKDVY85.015.0100.00.00.0
11TaRKEKKEVVERGPPP85.814.2100.00.00.0
12TaVKEKKEVVEVLPVPQK82.516.899.30.70.0
13TaHKEKKEVVETQIDKVVHFDKLPGF84.115.299.30.70.0
14TaYKEKKEVVEYGPSSYGYG84.715.3100.00.00.0
15TaMKEKKEVVEQLNWD85.414.6100.00.00.0
16RTaRGPPPKEKKEVVE84.915.1100.00.00.0
17VTaVLPVPQKKEKKEVVE84.713.998.61.50.0
18HTaTQIDKVVHFDKLPGFKEKKEVVE85.514.5100.00.00.0
19YTaYGPSSYGYGKEKKEVVE84.615.4100.00.00.0
20MTaQLNWDKEKKEVVE86.213.8100.00.00.0
21TbREVVEEARGPPP84.016.0100.00.00.0
22TbVEVVEEAVLPVPQK85.214.199.30.70.0
23TbHEVVEEATQIDKVVHFDKLPGF86.014.0100.00.00.0
24TbYEVVEEAYGPSSYGYG82.915.598.41.60.0
25TbMEVVEEAQLNWD85.214.199.30.80.0
26RTbRGPPPEVVEEA85.514.5100.00.00.0
27VTbVLPVPQKEVVEEA85.214.8100.00.00.0
28HTbTQIDKVVHFDKLPGFEVVEEA86.813.2100.00.00.0
29YTbYGPSSYGYGEVVEEA83.615.699.20.80.0
30MTbQLNWDEVVEEA85.914.1100.00.00.0
31ARDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGRGPPP85.814.2100.00.00.0
32AVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGVLPVPQK86.113.9100.00.00.0
33AHDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGTQIDKVVHFDKLPGF86.213.8100.00.00.0
34AYDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGYGPSSYGYG85.514.5100.00.00.0
35AMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGQLNWD85.414.6100.00.00.0
36RARGPPPDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG85.714.3100.00.00.0
37VAVLPVPQKDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG86.113.9100.00.00.0
38HATQIDKVVHFDKLPGFDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG85.514.5100.00.00.0
39YAYGPSSYGYGDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG84.615.4100.00.00.0
40MAQLNWDDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG86.213.8100.00.00.0
Note: Amino acid residues that fall within the core and allowed regions (maximum allowable areas) account for over 90% of the residues in the protein, indicating that the model adheres to the rules of stereochemistry.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Wang, J.; Zhang, R.; Zhao, X.; Zhang, J.; Tong, Y.; Abbas, Z.; Li, Z.; Zhang, H.; Si, D.; Wei, X. Hybridization Design and High-Throughput Screening of Peptides with Immunomodulatory and Antioxidant Activities. Int. J. Mol. Sci. 2025, 26, 505. https://doi.org/10.3390/ijms26020505

AMA Style

Wang J, Zhang R, Zhao X, Zhang J, Tong Y, Abbas Z, Li Z, Zhang H, Si D, Wei X. Hybridization Design and High-Throughput Screening of Peptides with Immunomodulatory and Antioxidant Activities. International Journal of Molecular Sciences. 2025; 26(2):505. https://doi.org/10.3390/ijms26020505

Chicago/Turabian Style

Wang, Junyong, Rijun Zhang, Xuelian Zhao, Jing Zhang, Yucui Tong, Zaheer Abbas, Zhenzhen Li, Haosen Zhang, Dayong Si, and Xubiao Wei. 2025. "Hybridization Design and High-Throughput Screening of Peptides with Immunomodulatory and Antioxidant Activities" International Journal of Molecular Sciences 26, no. 2: 505. https://doi.org/10.3390/ijms26020505

APA Style

Wang, J., Zhang, R., Zhao, X., Zhang, J., Tong, Y., Abbas, Z., Li, Z., Zhang, H., Si, D., & Wei, X. (2025). Hybridization Design and High-Throughput Screening of Peptides with Immunomodulatory and Antioxidant Activities. International Journal of Molecular Sciences, 26(2), 505. https://doi.org/10.3390/ijms26020505

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop