The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review
Abstract
1. Introduction
2. Components
2.1. Earthworm
2.2. Periplaneta
2.3. Amphibians
2.4. Marine Organisms
2.5. Scorpions
3. Mechanism
3.1. The TGF-Beta Pathway
3.2. The PI3K/AKT Pathway
3.3. The NF-Kappa B Signaling Pathway
3.4. The JAK/STAT Signaling Pathway
4. Formulation and Dressing
4.1. Hydrogel
4.2. Microneedles
4.3. Electrospinning Nanofibers
4.4. Others
Formulation or Dressing | Biocompatibility | Improve Penetration | Allow for Gas Exchange | Against Microorganisms | Control Drug Release | Targeted Drug Delivery | Others | Ref. |
---|---|---|---|---|---|---|---|---|
hydrogel | + | + | + | + | + | + | [189,190,191] | |
microneedles | + | + | + | + | Bypass the stratum corneum and enter the epidermis/dermis layer Natural mechanical stimulation induces collagen deposition and recombination Change the local stress environment Anti scar treatment | [201,202,203,204,205] | ||
electrospinning nanofibers | + | + | + | + | Customized structure to adapt to different wounds Replace damaged skin as a temporary barrier | [218] | ||
nanoparticles | + | + | Packaged in other dressings to make formulations Some types of nanoparticles have antibacterial properties | [223,224,225,226] | ||||
microparticles | + | + | + | Packaged in other dressings to make formulations | [227,228,229,230] | |||
membranes | + | + | Easy to use Allow for inspection of the wound bed without removing the dressing | [231,232,233] | ||||
silk fibroin | + | + | + | + | Customized into complex structures to ensure specific requirements Regulate cell proliferation and migration during inflammation | [234,235,236] | ||
sponges | + | Multi-porous material support that can restore its shape after mechanical compression or stretching | [237] | |||||
foam | + | + | Fix the dressing on the affected area Painless removal | [232,238,239] |
5. Discussions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
References
- Falcone, M.; Meier, J.J.; Marini, M.G.; Caccialanza, R.; Aguado, J.M.; Del Prato, S.; Menichetti, F. Diabetes and acute bacterial skin and skin structure infections. Diabetes Res. Clin. Pract. 2021, 174, 108732. [Google Scholar] [CrossRef] [PubMed]
- Hameedaldeen, A.; Liu, J.; Batres, A.; Graves, G.S.; Graves, D.T. FOXO1, TGF-β regulation and wound healing. Int. J. Mol. Sci. 2014, 15, 16257–16269. [Google Scholar] [CrossRef] [PubMed]
- Lin, H.; Zheng, Z.; Yuan, J.; Zhang, C.; Cao, W.; Qin, X. Collagen Peptides Derived from Sipunculus nudus Accelerate Wound Healing. Molecules 2021, 26, 1385. [Google Scholar] [CrossRef]
- Singer, A.J.; Clark, R.A.F. Cutaneous Wound Healing. N. Engl. J. Med. 1999, 341, 738–746. [Google Scholar] [CrossRef]
- Woo, K.; Santamaria, N.; Beeckman, D.; Alves, P.; Cullen, B.; Gefen, A.; Lázaro-Martínez, J.L.; Lev-Tov, H.; Najafi, B.; Sharpe, A.; et al. Using patient-reported experiences to inform the use of foam dressings for hard-to-heal wounds: Perspectives from a wound care expert panel. J. Wound Care 2024, 33, 814–822. [Google Scholar] [CrossRef] [PubMed]
- Martinengo, L.; Olsson, M.; Bajpai, R.; Soljak, M.; Upton, Z.; Schmidtchen, A.; Car, J.; Järbrink, K. Prevalence of chronic wounds in the general population: Systematic review and meta-analysis of observational studies. Ann. Epidemiol. 2019, 29, 8–15. [Google Scholar] [CrossRef]
- Olsson, M.; Järbrink, K.; Divakar, U.; Bajpai, R.; Upton, Z.; Schmidtchen, A.; Car, J. The humanistic and economic burden of chronic wounds: A systematic review. Wound Repair Regen. 2019, 27, 114–125. [Google Scholar] [CrossRef]
- Cerutti, C.; Ridley, A.J. Endothelial cell-cell adhesion and signaling. Exp. Cell Res. 2017, 358, 31–38. [Google Scholar] [CrossRef]
- Han, J.; Shuvaev, V.V.; Muzykantov, V.R. Catalase and superoxide dismutase conjugated with platelet-endothelial cell adhesion molecule antibody distinctly alleviate abnormal endothelial permeability caused by exogenous reactive oxygen species and vascular endothelial growth factor. J. Pharmacol. Exp. Ther. 2011, 338, 82–91. [Google Scholar] [CrossRef]
- Deng, Z.H.; Yin, J.J.; Luo, W.; Kotian, R.N.; Gao, S.S.; Yi, Z.Q.; Xiao, W.F.; Li, W.P.; Li, Y.S. The effect of earthworm extract on promoting skin wound healing. Biosci. Rep. 2018, 38, BSR20171366. [Google Scholar] [CrossRef]
- Pattanayak, S.P.; Sunita, P. Wound healing, anti-microbial and antioxidant potential of Dendrophthoe falcata (L.f) Ettingsh. J. Ethnopharmacol. 2008, 120, 241–247. [Google Scholar] [CrossRef]
- Martin, P.; Nunan, R. Cellular and molecular mechanisms of repair in acute and chronic wound healing. Br. J. Dermatol. 2015, 173, 370–378. [Google Scholar] [CrossRef] [PubMed]
- Du, C.; Li, Y.; Xia, X.; Du, E.; Lin, Y.; Lian, J.; Ren, C.; Li, S.; Wei, W.; Qin, Y. Identification of a novel collagen-like peptide by high-throughput screening for effective wound-healing therapy. Int. J. Biol. Macromol. 2021, 173, 541–553. [Google Scholar] [CrossRef] [PubMed]
- Jing, J.; Sun, X.; Zhou, C.; Zhang, Y.; Shen, Y.; Zeng, X.; Yue, B.; Zhang, X. Cloning, Expression and Effects of P. americana Thymosin on Wound Healing. Int. J. Mol. Sci. 2019, 20, 4932. [Google Scholar] [CrossRef] [PubMed]
- Dreifke, M.B.; Jayasuriya, A.A.; Jayasuriya, A.C. Current wound healing procedures and potential care. Mater. Sci. Eng. C Mater. Biol. Appl. 2015, 48, 651–662. [Google Scholar] [CrossRef] [PubMed]
- Peng, L.H.; Huang, Y.F.; Zhang, C.Z.; Niu, J.; Chen, Y.; Chu, Y.; Jiang, Z.H.; Gao, J.Q.; Mao, Z.W. Integration of antimicrobial peptides with gold nanoparticles as unique non-viral vectors for gene delivery to mesenchymal stem cells with antibacterial activity. Biomaterials 2016, 103, 137–149. [Google Scholar] [CrossRef]
- Peng, L.H.; Niu, J.; Zhang, C.Z.; Yu, W.; Wu, J.H.; Shan, Y.H.; Wang, X.R.; Shen, Y.Q.; Mao, Z.W.; Liang, W.Q.; et al. TAT conjugated cationic noble metal nanoparticles for gene delivery to epidermal stem cells. Biomaterials 2014, 35, 5605–5618. [Google Scholar] [CrossRef]
- Liu, C.W.; Hsieh, C.Y.; Chen, J.Y. Investigations on the Wound Healing Potential of Tilapia Piscidin (TP)2-5 and TP2-6. Mar. Drugs 2022, 20, 205. [Google Scholar] [CrossRef]
- Song, Q.; Xie, Y.; Gou, Q.; Guo, X.; Yao, Q.; Gou, X. JAK/STAT3 and Smad3 activities are required for the wound healing properties of Periplaneta americana extracts. Int. J. Mol. Med. 2017, 40, 465–473. [Google Scholar] [CrossRef]
- Jarić, S.; Kostić, O.; Mataruga, Z.; Pavlović, D.; Pavlović, M.; Mitrović, M.; Pavlović, P. Traditional wound-healing plants used in the Balkan region (Southeast Europe). J. Ethnopharmacol. 2018, 211, 311–328. [Google Scholar] [CrossRef]
- Agyare, C.; Boakye, Y.D.; Bekoe, E.O.; Hensel, A.; Dapaah, S.O.; Appiah, T. Review: African medicinal plants with wound healing properties. J. Ethnopharmacol. 2016, 177, 85–100. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Z.; Wang, J.; Ding, Y.; Dai, X.; Li, Y. Oral administration of marine collagen peptides from Chum Salmon skin enhances cutaneous wound healing and angiogenesis in rats. J. Sci. Food Agric. 2011, 91, 2173–2179. [Google Scholar] [CrossRef] [PubMed]
- Goodarzi, G.; Qujeq, D.; Elmi, M.M.; Feizi, F.; Fathai, S. The effect of the glycolipoprotein extract (G-90) from earthworm Eisenia foetida on the wound healing process in alloxan-induced diabetic rats. Cell Biochem. Funct. 2016, 34, 242–249. [Google Scholar] [CrossRef]
- Grdisa, M.; Popović, M.; Hrzenjak, T. Stimulation of growth factor synthesis in skin wounds using tissue extract (G-90) from the earthworm Eissenia foetida. Cell Biochem. Funct. 2004, 22, 373–378. [Google Scholar] [CrossRef] [PubMed]
- He, M.; Xie, W.Q.; Cheng, G.; Li, W.P.; Yu, D.J.; Jin, H.F.; Deng, Z.H.; Li, Y.S. The therapeutic effects of earthworm extract on deep second-degree burn wound healing. Ann. Palliat. Med. 2021, 10, 2869–2879. [Google Scholar] [CrossRef] [PubMed]
- Yang, Y.; Hu, H.; Wang, W.; Duan, X.; Luo, S.; Wang, X.; Sun, Y. The identification of functional proteins from amputated lumbricus Eisenia fetida on the wound healing process. Biomed. Pharmacother. 2017, 95, 1469–1478. [Google Scholar] [CrossRef]
- Yang, Y.; Sun, Y.; Zhang, N.; Li, J.; Zhang, C.; Duan, X.; Ding, Y.; Zhao, R.; Zheng, Z.; Geng, D.; et al. The up-regulation of two identified wound healing specific proteins-HSP70 and lysozyme in regenerated Eisenia fetida through transcriptome analysis. J. Ethnopharmacol. 2019, 237, 64–73. [Google Scholar] [CrossRef]
- Wang, W.; Ye, J.; Guo, Z.; Ma, Y.; Yang, Q.; Zhong, W.; Du, S.; Bai, J. A novel glycoprotein from earthworm extract PvE-3: Insights of their characteristics for promoting diabetic wound healing and attenuating methylglyoxal-induced cell damage. Int. J. Biol. Macromol. 2023, 239, 124267. [Google Scholar] [CrossRef]
- Li, T.; Sun, Y.; Wang, J.; Zhang, C.; Sun, Y. Promoted Skin Wound Healing by Tail-Amputated Eisenia foetida Proteins via the Ras/Raf/MEK/ERK Signaling Pathway. ACS Omega 2023, 8, 13935–13943. [Google Scholar] [CrossRef]
- Song, S.; Wang, Y.; Ji, K.; Liang, H.; Ji, A. Effect of earthworm active protein on fibroblast proliferation and its mechanism. Pharm. Biol. 2016, 54, 732–739. [Google Scholar] [CrossRef]
- Li, L.J.; Wang, M.Z.; Yuan, T.J.; Xu, X.H.; Dad, H.A.; Yu, C.L.; Hou, J.; Peng, L.H. The crude ethanol extract of Periplaneta americana L. stimulates wound healing in vitro & in vivo. Chin. Med. 2019, 14, 33. [Google Scholar] [CrossRef]
- Liao, Q.; Pang, L.; Li, J.J.; Zhang, C.; Li, J.X.; Zhang, X.; Mao, T.; Wu, D.T.; Ma, X.Y.; Geng, F.N.; et al. Characterization and diabetic wound healing benefits of protein-polysaccharide complexes isolated from an animal ethno-medicine Periplaneta americana L. Int. J. Biol. Macromol. 2022, 195, 466–474. [Google Scholar] [CrossRef] [PubMed]
- Chang, J.; He, X.; Hu, J.; Kamau, P.M.; Lai, R.; Rao, D.; Luo, L. Bv8-Like Toxin from the Frog Venom of Amolops jingdongensis Promotes Wound Healing via the Interleukin-1 Signaling Pathway. Toxins 2019, 12, 15. [Google Scholar] [CrossRef] [PubMed]
- Shi, Y.; Li, C.; Wang, M.; Chen, Z.; Luo, Y.; Xia, X.S.; Song, Y.; Sun, Y.; Zhang, A.M. Cathelicidin-DM is an Antimicrobial Peptide from Duttaphrynus melanostictus and Has Wound-Healing Therapeutic Potential. ACS Omega 2020, 5, 9301–9310. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Guo, X.; Yi, T.; Zhu, Y.; Ren, X.; Guo, R.; Dai, Y.; Liang, S. Frog Skin Derived Peptides With Potential Protective Effects on Ultraviolet B-Induced Cutaneous Photodamage. Front. Immunol. 2021, 12, 613365. [Google Scholar] [CrossRef] [PubMed]
- Wu, J.; Yang, J.; Wang, X.; Wei, L.; Mi, K.; Shen, Y.; Liu, T.; Yang, H.; Mu, L. A frog cathelicidin peptide effectively promotes cutaneous wound healing in mice. Biochem. J. 2018, 475, 2785–2799. [Google Scholar] [CrossRef]
- Feng, G.; Wei, L.; Che, H.; Shen, Y.; Yang, J.; Mi, K.; Liu, J.; Wu, J.; Yang, H.; Mu, L. A Frog Peptide Ameliorates Skin Photoaging Through Scavenging Reactive Oxygen Species. Front. Pharmacol. 2021, 12, 761011. [Google Scholar] [CrossRef]
- Bian, W.; Meng, B.; Li, X.; Wang, S.; Cao, X.; Liu, N.; Yang, M.; Tang, J.; Wang, Y.; Yang, X. OA-GL21, a novel bioactive peptide from Odorrana andersonii, accelerated the healing of skin wounds. Biosci. Rep. 2018, 38, BSR20180215. [Google Scholar] [CrossRef]
- Song, Y.; Wu, C.; Zhang, X.; Bian, W.; Liu, N.; Yin, S.; Yang, M.; Luo, M.; Tang, J.; Yang, X. A short peptide potentially promotes the healing of skin wound. Biosci. Rep. 2019, 39, BSR20181734. [Google Scholar] [CrossRef]
- Zhang, Y.; Wang, Y.; Zeng, L.; Liu, Y.; Sun, H.; Li, S.; Wang, S.; Shu, L.; Liu, N.; Yin, S.; et al. Amphibian-derived peptide homodimer OA-GL17d promotes skin wound regeneration through the miR-663a/TGF-β1/Smad axis. Burns Trauma 2022, 10, tkac032. [Google Scholar] [CrossRef]
- Liu, H.; Mu, L.; Tang, J.; Shen, C.; Gao, C.; Rong, M.; Zhang, Z.; Liu, J.; Wu, X.; Yu, H.; et al. A potential wound healing-promoting peptide from frog skin. Int. J. Biochem. Cell Biol. 2014, 49, 32–41. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Duan, Z.; Tang, J.; Lv, Q.; Rong, M.; Lai, R. A short peptide from frog skin accelerates diabetic wound healing. FEBS J. 2014, 281, 4633–4643. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Wang, Y.; Zou, Z.; Yang, M.; Wu, C.; Su, Y.; Tang, J.; Yang, X. OM-LV20, a novel peptide from odorous frog skin, accelerates wound healing in vitro and in vivo. Chem. Biol. Drug Des. 2018, 91, 126–136. [Google Scholar] [CrossRef] [PubMed]
- Cao, X.; Wang, Y.; Wu, C.; Li, X.; Fu, Z.; Yang, M.; Bian, W.; Wang, S.; Song, Y.; Tang, J.; et al. Cathelicidin-OA1, a novel antioxidant peptide identified from an amphibian, accelerates skin wound healing. Sci. Rep. 2018, 8, 943. [Google Scholar] [CrossRef] [PubMed]
- He, X.; Yang, Y.; Mu, L.; Zhou, Y.; Chen, Y.; Wu, J.; Wang, Y.; Yang, H.; Li, M.; Xu, W.; et al. A Frog-Derived Immunomodulatory Peptide Promotes Cutaneous Wound Healing by Regulating Cellular Response. Front. Immunol. 2019, 10, 2421. [Google Scholar] [CrossRef]
- Liu, S.; Long, Q.; Xu, Y.; Wang, J.; Xu, Z.; Wang, L.; Zhou, M.; Wu, Y.; Chen, T.; Shaw, C. Assessment of antimicrobial and wound healing effects of Brevinin-2Ta against the bacterium Klebsiella pneumoniae in dermally-wounded rats. Oncotarget 2017, 8, 111369–111385. [Google Scholar] [CrossRef]
- Fan, X.L.; Yu, S.S.; Zhao, J.L.; Li, Y.; Zhan, D.J.; Xu, F.; Lin, Z.H.; Chen, J. Brevinin-2PN, an antimicrobial peptide identified from dark-spotted frog (Pelophylax nigromaculatus), exhibits wound-healing activity. Dev. Comp. Immunol. 2022, 137, 104519. [Google Scholar] [CrossRef]
- Fu, S.; Du, C.; Zhang, Q.; Liu, J.; Zhang, X.; Deng, M. A Novel Peptide from Polypedates megacephalus Promotes Wound Healing in Mice. Toxins 2022, 14, 753. [Google Scholar] [CrossRef]
- Wang, S.; Feng, C.; Yin, S.; Feng, Z.; Tang, J.; Liu, N.; Yang, F.; Yang, X.; Wang, Y. A novel peptide from the skin of amphibian Rana limnocharis with potency to promote skin wound repair. Nat. Prod. Res. 2021, 35, 3514–3518. [Google Scholar] [CrossRef]
- Wang, Y.; Feng, Z.; Yang, M.; Zeng, L.; Qi, B.; Yin, S.; Li, B.; Li, Y.; Fu, Z.; Shu, L.; et al. Discovery of a novel short peptide with efficacy in accelerating the healing of skin wounds. Pharmacol. Res. 2021, 163, 105296. [Google Scholar] [CrossRef]
- Mu, L.; Tang, J.; Liu, H.; Shen, C.; Rong, M.; Zhang, Z.; Lai, R. A potential wound-healing-promoting peptide from salamander skin. FASEB J. 2014, 28, 3919–3929. [Google Scholar] [CrossRef] [PubMed]
- Luo, X.; Ouyang, J.; Wang, Y.; Zhang, M.; Fu, L.; Xiao, N.; Gao, L.; Zhang, P.; Zhou, J.; Wang, Y. A novel anionic cathelicidin lacking direct antimicrobial activity but with potent anti-inflammatory and wound healing activities from the salamander Tylototriton kweichowensis. Biochimie 2021, 191, 37–50. [Google Scholar] [CrossRef] [PubMed]
- Zheng, Z.; Li, M.; Jiang, P.; Sun, N.; Lin, S. Peptides derived from sea cucumber accelerate cells proliferation and migration for wound healing by promoting energy metabolism and upregulating the ERK/AKT pathway. Eur. J. Pharmacol. 2022, 921, 174885. [Google Scholar] [CrossRef] [PubMed]
- Sun, J.H.; Song, S.; Yang, J.F. Oral administration of sea cucumber (Stichopus japonicus) protein exerts wound healing effects via the PI3K/AKT/mTOR signaling pathway. Food Funct. 2022, 13, 9796–9809. [Google Scholar] [CrossRef]
- Mei, F.; Liu, J.; Wu, J.; Duan, Z.; Chen, M.; Meng, K.; Chen, S.; Shen, X.; Xia, G.; Zhao, M. Collagen Peptides Isolated from Salmo salar and Tilapia nilotica Skin Accelerate Wound Healing by Altering Cutaneous Microbiome Colonization via Upregulated NOD2 and BD14. J. Agric. Food Chem. 2020, 68, 1621–1633. [Google Scholar] [CrossRef]
- Yang, F.; Jin, S.; Tang, Y. Marine Collagen Peptides Promote Cell Proliferation of NIH-3T3 Fibroblasts via NF-κB Signaling Pathway. Molecules 2019, 24, 4201. [Google Scholar] [CrossRef]
- Yang, T.; Zhang, K.; Li, B.; Hou, H. Effects of oral administration of peptides with low molecular weight from Alaska Pollock (Theragra chalcogramma) on cutaneous wound healing. J. Funct. Foods 2018, 48, 682–691. [Google Scholar] [CrossRef]
- Wan, T.; Li, L.; Zhu, Z.; Liu, S.; Zhao, Y.; Yu, M. Scorpion Venom Active Polypeptide May Be a New External Drug of Diabetic Ulcer. Evid.-Based Complement. Altern. Med. 2017, 2017, 5161565. [Google Scholar] [CrossRef]
- Daniele-Silva, A.; Rodrigues, S.C.S.; Dos Santos, E.C.G.; Queiroz Neto, M.F.; Rocha, H.A.O.; Silva-Júnior, A.A.D.; Resende, J.M.; Araújo, R.M.; Fernandes-Pedrosa, M.F. NMR three-dimensional structure of the cationic peptide Stigmurin from Tityus stigmurus scorpion venom: In vitro antioxidant and in vivo antibacterial and healing activity. Peptides 2021, 137, 170478. [Google Scholar] [CrossRef]
- Ishihara, K.; Nakajima, N. Stereoselective reduction of carbonyl compounds using the cell-free extract of the earthworm, Lumbricus rubellus, as a novel source of biocatalyst. Biosci. Biotechnol. Biochem. 2006, 70, 3077–3080. [Google Scholar] [CrossRef]
- Zhang, M.; Li, X.; Liu, Y.; Ye, F.; Qiu, G. Effects of extract of dilong (pheretima) on the scalded skin in rats. J. Tradit. Chin. Med. 2006, 26, 68–71. [Google Scholar] [PubMed]
- Chen, H.; Takahashi, S.; Imamura, M.; Okutani, E.; Zhang, Z.G.; Chayama, K.; Chen, B.A. Earthworm fibrinolytic enzyme: Anti-tumor activity on human hepatoma cells in vitro and in vivo. Chin. Med. J. 2007, 120, 898–904. [Google Scholar] [CrossRef] [PubMed]
- Popović, M.; Hrcenjak, T.M.; Babić, T.; Kos, J.; Grdisa, M. Effect of earthworm (G-90) extract on formation and lysis of clots originated from venous blood of dogs with cardiopathies and with malignant tumors. Pathol. Oncol. Res. 2001, 7, 197–202. [Google Scholar] [CrossRef]
- Balamurugan, M.; Parthasarathi, K.; Ranganathan, L.S.; Cooper, E.L. Hypothetical mode of action of earthworm extract with hepatoprotective and antioxidant properties. J. Zhejiang Univ. Sci. B 2008, 9, 141–147. [Google Scholar] [CrossRef]
- Liu, Z.; Wang, J.; Zhang, J.; Yu, B.; Niu, B. An extract from the earthworm Eisenia fetida non-specifically inhibits the activity of influenza and adenoviruses. J. Tradit. Chin. Med. 2012, 32, 657–663. [Google Scholar] [CrossRef] [PubMed]
- Prakash, M.; Gunasekaran, G. Gastroprotective effect of earthworm paste (Lampito mauritii, Kinberg) on experimental gastric ulcer in rats. Eur. Rev. Med. Pharmacol. Sci. 2010, 14, 171–176. [Google Scholar] [PubMed]
- He, P.; Zhang, Y.; Zhang, Y.; Zhang, L.; Lin, Z.; Sun, C.; Wu, H.; Zhang, M. Isolation, identification of antioxidant peptides from earthworm proteins and analysis of the structure-activity relationship of the peptides based on quantum chemical calculations. Food Chem. 2024, 431, 137137. [Google Scholar] [CrossRef]
- Wasunan, P.; Maneewong, C.; Daengprok, W.; Thirabunyanon, M. Bioactive Earthworm Peptides Produced by Novel Protease-Producing Bacillus velezensis PM 35 and Its Bioactivities on Liver Cancer Cell Death via Apoptosis, Antioxidant Activity, Protection Against Oxidative Stress, and Immune Cell Activation. Front. Microbiol. 2022, 13, 892945. [Google Scholar] [CrossRef]
- Farouk, A.E.; Fahmy, S.R.; Soliman, A.M.; Ibrahim, S.A.; Sadek, S.A. A nano-Liposomal formulation potentiates antioxidant, anti-inflammatory, and fibrinolytic activities of Allolobophora caliginosa coelomic fluid: Formulation and characterization. BMC Biotechnol. 2023, 23, 28. [Google Scholar] [CrossRef]
- Wu, Y.; Deng, S.; Wang, X.; Thunders, M.; Qiu, J.; Li, Y. Discovery and Mechanism of Action of a Novel Antimicrobial Peptide from an Earthworm. Microbiol. Spectr. 2023, 11, e0320622. [Google Scholar] [CrossRef]
- Czaplewska, P.; Bogucka, A.; Macur, K.; Rybicka, M.; Rychłowski, M.; Fiołka, M.J. Proteomic response of A549 lung cancer cell line to protein-polysaccharide complex Venetin-1 isolated from earthworm coelomic fluid. Front. Mol. Biosci. 2023, 10, 1128320. [Google Scholar] [CrossRef] [PubMed]
- Li, P.C.; Tien, Y.C.; Day, C.H.; Pai, P.; Kuo, W.W.; Chen, T.S.; Kuo, C.H.; Tsai, C.H.; Ju, D.T.; Huang, C.Y. Impact of LPS-induced cardiomyoblast cell apoptosis inhibited by earthworm extracts. Cardiovasc. Toxicol. 2015, 15, 172–179. [Google Scholar] [CrossRef] [PubMed]
- Poniedziałek, B.; Rosińska, J.; Rzymski, P.; Fiołka, M. Polysaccharide-protein complex from coelomic fluid of Dendrobaena veneta earthworm exerts a multi-pathway antiplatelet effect without coagulopathy and cytotoxicity. Biomed. Pharmacother. 2022, 151, 113205. [Google Scholar] [CrossRef] [PubMed]
- Grdisa, M.; Popovic, M.; Hrzenjak, T. Glycolipoprotein extract (G-90) from earthworm Eisenia foetida exerts some antioxidative activity. Comp. Biochem. Physiol. A Mol. Integr. Physiol. 2001, 128, 821–825. [Google Scholar] [CrossRef] [PubMed]
- Hrzenjak, M.; Kobrehel, D.; Levanat, S.; Jurin, M.; Hrzenjak, T. Mitogenicity of the earthworm’s (Eisenia foetida) insulin-like proteins. Comp. Biochem. Physiol. B 1993, 104, 723–729. [Google Scholar] [CrossRef]
- Hrzenjak, T.; Popović, M.; Bozić, T.; Grdisa, M.; Kobrehel, D.; Tiska-Rudman, L. Fibrinolytic and anticoagulative activities from the earthworm Eisenia foetida. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 1998, 119, 825–832. [Google Scholar] [CrossRef]
- Mihara, H.; Sumi, H.; Yoneta, T.; Mizumoto, H.; Ikeda, R.; Seiki, M.; Maruyama, M. A novel fibrinolytic enzyme extracted from the earthworm, Lumbricus rubellus. Jpn. J. Physiol. 1991, 41, 461–472. [Google Scholar] [CrossRef]
- Gorres, K.L.; Raines, R.T. Prolyl 4-hydroxylase. Crit. Rev. Biochem. Mol. Biol. 2010, 45, 106–124. [Google Scholar] [CrossRef]
- Qiu, L.; Jin, X.Q.; Xiang, D.L.; Fu, Y.X.; Tian, X.F. Study on the collagen constitution of hyperplastic scar in different ages and its influencing factors. Zhonghua Shao Shang Za Zhi 2003, 19, 236–240. [Google Scholar]
- Maslowska, K.H.; Makiela-Dzbenska, K.; Fijalkowska, I.J. The SOS system: A complex and tightly regulated response to DNA damage. Environ. Mol. Mutagen. 2019, 60, 368–384. [Google Scholar] [CrossRef]
- Chen, J.; De, S.; Brainard, J.; Byzova, T.V. Metastatic properties of prostate cancer cells are controlled by VEGF. Cell Commun. Adhes. 2004, 11, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Chen, K.; Pan, H.; Ji, D.; Li, Y.; Duan, H.; Pan, W. Curcumin-loaded sandwich-like nanofibrous membrane prepared by electrospinning technology as wound dressing for accelerate wound healing. Mater. Sci. Eng. C Mater. Biol. Appl. 2021, 127, 112245. [Google Scholar] [CrossRef]
- Krafts, K.P. Tissue repair: The hidden drama. Organogenesis 2010, 6, 225–233. [Google Scholar] [CrossRef] [PubMed]
- Whitmore, L.; Wallace, B.A. Protein secondary structure analyses from circular dichroism spectroscopy: Methods and reference databases. Biopolymers 2008, 89, 392–400. [Google Scholar] [CrossRef] [PubMed]
- Xu, X.; Lai, R. The chemistry and biological activities of peptides from amphibian skin secretions. Chem. Rev. 2015, 115, 1760–1846. [Google Scholar] [CrossRef] [PubMed]
- Zhou, C.; Wang, Z.; Peng, X.; Liu, Y.; Lin, Y.; Zhang, Z.; Qiu, Y.; Jin, M.; Wang, R.; Kong, D. Discovery of two bombinin peptides with antimicrobial and anticancer activities from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Chem. Biol. Drug Des. 2018, 91, 50–61. [Google Scholar] [CrossRef]
- Du, Q.; Wang, H.; Ma, C.; Wu, Y.; Xi, X.; Zhou, M.; Chen, T.; Shaw, C.; Wang, L. Identification of a Novel Vasodilatory Octapeptide from the Skin Secretion of the African Hyperoliid Frog, Kassina senegalensis. Molecules 2017, 22, 1215. [Google Scholar] [CrossRef]
- Wu, Y.; Long, Q.; Xu, Y.; Guo, S.; Chen, T.; Wang, L.; Zhou, M.; Zhang, Y.; Shaw, C.; Walker, B. A structural and functional analogue of a Bowman-Birk-type protease inhibitor from Odorrana schmackeri. Biosci. Rep. 2017, 37, BSR20160593. [Google Scholar] [CrossRef]
- Zhang, Y. Why do we study animal toxins? Dongwuxue Yanjiu 2015, 36, 183–222. [Google Scholar] [CrossRef]
- Yang, X.; Lee, W.H.; Zhang, Y. Extremely abundant antimicrobial peptides existed in the skins of nine kinds of Chinese odorous frogs. J. Proteome Res. 2012, 11, 306–319. [Google Scholar] [CrossRef]
- Raaymakers, C.; Verbrugghe, E.; Hernot, S.; Hellebuyck, T.; Betti, C.; Peleman, C.; Claeys, M.; Bert, W.; Caveliers, V.; Ballet, S.; et al. Antimicrobial peptides in frog poisons constitute a molecular toxin delivery system against predators. Nat. Commun. 2017, 8, 1495. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Zhang, Y.; Lee, W.H.; Yang, X.; Zhang, Y. Novel Peptides from Skins of Amphibians Showed Broad-Spectrum Antimicrobial Activities. Chem. Biol. Drug Des. 2016, 87, 419–424. [Google Scholar] [CrossRef] [PubMed]
- Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.H.; Zhang, Y. Rich diversity and potency of skin antioxidant peptides revealed a novel molecular basis for high-altitude adaptation of amphibians. Sci. Rep. 2016, 6, 19866. [Google Scholar] [CrossRef] [PubMed]
- Yu, H.; Qiao, X.; Gao, J.; Wang, C.; Cai, S.; Feng, L.; Wang, H.; Wang, Y.P. Identification and Characterization of Novel Antioxidant Peptides Involved in Redox Homeostasis of Frog, Limnonectes fragilis. Protein Pept. Lett. 2015, 22, 776–784. [Google Scholar] [CrossRef] [PubMed]
- Ferris, D.R.; Satoh, A.; Mandefro, B.; Cummings, G.M.; Gardiner, D.M.; Rugg, E.L. Ex vivo generation of a functional and regenerative wound epithelium from axolotl (Ambystoma mexicanum) skin. Dev. Growth Differ. 2010, 52, 715–724. [Google Scholar] [CrossRef]
- Rezazade Bazaz, M.; Mashreghi, M.; Mahdavi Shahri, N.; Mashreghi, M.; Asoodeh, A.; Behnam Rassouli, M. Evaluation of Antimicrobial and Healing Activities of Frog Skin on Guinea Pigs Wounds. Jundishapur. J. Microbiol. 2015, 8, e21218. [Google Scholar] [CrossRef]
- Mashreghi, M.; Rezazade Bazaz, M.; Mahdavi Shahri, N.; Asoodeh, A.; Mashreghi, M.; Behnam Rassouli, M.; Golmohammadzadeh, S. Topical effects of frog “Rana ridibunda” skin secretions on wound healing and reduction of wound microbial load. J. Ethnopharmacol. 2013, 145, 793–797. [Google Scholar] [CrossRef]
- Zhang, M.; Li, X.; Li, S.; Liu, Y.; Hao, L. Electrospun poly(l-lactide)/zein nanofiber mats loaded with Rana chensinensis skin peptides for wound dressing. J. Mater. Sci. Mater. Med. 2016, 27, 136. [Google Scholar] [CrossRef]
- Demori, I.; Rashed, Z.E.; Corradino, V.; Catalano, A.; Rovegno, L.; Queirolo, L.; Salvidio, S.; Biggi, E.; Zanotti-Russo, M.; Canesi, L.; et al. Peptides for Skin Protection and Healing in Amphibians. Molecules 2019, 24, 347. [Google Scholar] [CrossRef]
- Wang, G.; Chen, Z.; Tian, P.; Han, Q.; Zhang, J.; Zhang, A.M.; Song, Y. Wound healing mechanism of antimicrobial peptide cathelicidin-DM. Front. Bioeng. Biotechnol. 2022, 10, 977159. [Google Scholar] [CrossRef]
- Cheng, X.; Shao, Z.; Li, C.; Yu, L.; Raja, M.A.; Liu, C. Isolation, Characterization and Evaluation of Collagen from Jellyfish Rhopilema esculentum Kishinouye for Use in Hemostatic Applications. PLoS ONE 2017, 12, e0169731. [Google Scholar] [CrossRef] [PubMed]
- Widdowson, J.P.; Picton, A.J.; Vince, V.; Wright, C.J.; Mearns-Spragg, A. In vivo comparison of jellyfish and bovine collagen sponges as prototype medical devices. J. Biomed. Mater. Res. B Appl. Biomater. 2018, 106, 1524–1533. [Google Scholar] [CrossRef] [PubMed]
- Coppola, D.; Oliviero, M.; Vitale, G.A.; Lauritano, C.; D’Ambra, I.; Iannace, S.; de Pascale, D. Marine Collagen from Alternative and Sustainable Sources: Extraction, Processing and Applications. Mar. Drugs 2020, 18, 214. [Google Scholar] [CrossRef] [PubMed]
- Sinthusamran, S.; Benjakul, S.; Kishimura, H. Comparative study on molecular characteristics of acid soluble collagens from skin and swim bladder of seabass (Lates calcarifer). Food Chem. 2013, 138, 2435–2441. [Google Scholar] [CrossRef]
- Whelan, A.; Duffy, J.; Gaul, R.T.; O’Reilly, D.; Nolan, D.R.; Gunning, P.; Lally, C.; Murphy, B.P. Collagen fibre orientation and dispersion govern ultimate tensile strength, stiffness and the fatigue performance of bovine pericardium. J. Mech. Behav. Biomed. Mater. 2019, 90, 54–60. [Google Scholar] [CrossRef]
- Raz, P.; Brosh, T.; Ronen, G.; Tal, H. Tensile Properties of Three Selected Collagen Membranes. Biomed. Res. Int. 2019, 2019, 5163603. [Google Scholar] [CrossRef]
- Zdzieblik, D.; Oesser, S.; Gollhofer, A.; König, D. Improvement of activity-related knee joint discomfort following supplementation of specific collagen peptides. Appl. Physiol. Nutr. Metab. 2017, 42, 588–595. [Google Scholar] [CrossRef]
- Clark, K.L.; Sebastianelli, W.; Flechsenhar, K.R.; Aukermann, D.F.; Meza, F.; Millard, R.L.; Deitch, J.R.; Sherbondy, P.S.; Albert, A. 24-Week study on the use of collagen hydrolysate as a dietary supplement in athletes with activity-related joint pain. Curr. Med. Res. Opin. 2008, 24, 1485–1496. [Google Scholar] [CrossRef] [PubMed]
- Ma, C.; Sun, N.; Zhang, S.; Zheng, J.; Lin, S. A new dual-peptide strategy for enhancing antioxidant activity and exploring the enhancement mechanism. Food Funct. 2019, 10, 7533–7543. [Google Scholar] [CrossRef]
- Mościcka, P.; Cwajda-Białasik, J.; Szewczyk, M.T.; Jawień, A. Healing Process, Pain, and Health-Related Quality of Life in Patients with Venous Leg Ulcers Treated with Fish Collagen Gel: A 12-Week Randomized Single-Center Study. Int. J. Environ. Res. Public Health 2022, 19, 7108. [Google Scholar] [CrossRef]
- Geahchan, S.; Baharlouei, P.; Rahman, A. Marine Collagen: A Promising Biomaterial for Wound Healing, Skin Anti-Aging, and Bone Regeneration. Mar. Drugs 2022, 20, 61. [Google Scholar] [CrossRef] [PubMed]
- Cadar, E.; Pesterau, A.M.; Sirbu, R.; Negreanu-Pirjol, B.S.; Tomescu, C.L. Jellyfishes-Significant Marine Resources with Potential in the Wound-Healing Process: A Review. Mar. Drugs 2023, 21, 201. [Google Scholar] [CrossRef] [PubMed]
- Xia, Z.; He, D.; Wu, Y.; Kwok, H.F.; Cao, Z. Scorpion venom peptides: Molecular diversity, structural characteristics, and therapeutic use from channelopathies to viral infections and cancers. Pharmacol. Res. 2023, 197, 106978. [Google Scholar] [CrossRef] [PubMed]
- Sachkova, M.Y.; Landau, M.; Surm, J.M.; Macrander, J.; Singer, S.A.; Reitzel, A.M.; Moran, Y. Toxin-like neuropeptides in the sea anemone Nematostella unravel recruitment from the nervous system to venom. Proc. Natl. Acad. Sci. USA 2020, 117, 27481–27492. [Google Scholar] [CrossRef] [PubMed]
- Amorim-Carmo, B.; Parente, A.M.S.; Souza, E.S.; Silva-Junior, A.A.; Araújo, R.M.; Fernandes-Pedrosa, M.F. Antimicrobial Peptide Analogs From Scorpions: Modifications and Structure-Activity. Front. Mol. Biosci. 2022, 9, 887763. [Google Scholar] [CrossRef]
- Moradikian, M.; Komijani, M.; Shayestehfar, A. Detection of Staphylococcus aureus and their toxin genes inhabit on the scorpions surface. Arch. Microbiol. 2022, 204, 576. [Google Scholar] [CrossRef]
- Almaaytah, A.; Albalas, Q. Scorpion venom peptides with no disulfide bridges: A review. Peptides 2014, 51, 35–45. [Google Scholar] [CrossRef]
- Du, Q.; Hou, X.; Ge, L.; Li, R.; Zhou, M.; Wang, H.; Wang, L.; Wei, M.; Chen, T.; Shaw, C. Cationicity-enhanced analogues of the antimicrobial peptides, AcrAP1 and AcrAP2, from the venom of the scorpion, Androctonus crassicauda, display potent growth modulation effects on human cancer cell lines. Int. J. Biol. Sci. 2014, 10, 1097–1107. [Google Scholar] [CrossRef]
- Erdeş, E.; Doğan, T.S.; Coşar, I.; Danışman, T.; Kunt, K.B.; Seker, T.; Yücel, M.; Ozen, C. Characterization of Leiurus abdullahbayrami (Scorpiones: Buthidae) venom: Peptide profile, cytotoxicity and antimicrobial activity. J. Venom. Anim. Toxins Incl. Trop. Dis. 2014, 20, 48. [Google Scholar] [CrossRef]
- Ruszczak, Z. Effect of collagen matrices on dermal wound healing. Adv. Drug Deliv. Rev. 2003, 55, 1595–1611. [Google Scholar] [CrossRef]
- Cen, L.; Liu, W.; Cui, L.; Zhang, W.; Cao, Y. Collagen tissue engineering: Development of novel biomaterials and applications. Pediatr. Res. 2008, 63, 492–496. [Google Scholar] [CrossRef] [PubMed]
- Oslan, S.N.H.; Li, C.X.; Shapawi, R.; Mokhtar, R.A.M.; Noordin, W.N.M.; Huda, N. Extraction and Characterization of Bioactive Fish By-Product Collagen as Promising for Potential Wound Healing Agent in Pharmaceutical Applications: Current Trend and Future Perspective. Int. J. Food Sci. 2022, 2022, 9437878. [Google Scholar] [CrossRef]
- Mangoni, M.L.; McDermott, A.M.; Zasloff, M. Antimicrobial peptides and wound healing: Biological and therapeutic considerations. Exp. Dermatol. 2016, 25, 167–173. [Google Scholar] [CrossRef]
- Jara, C.P.; Mendes, N.F.; Prado, T.P.D.; de Araújo, E.P. Bioactive Fatty Acids in the Resolution of Chronic Inflammation in Skin Wounds. Adv. Wound Care 2020, 9, 472–490. [Google Scholar] [CrossRef] [PubMed]
- Shams, F.; Moravvej, H.; Hosseinzadeh, S.; Mostafavi, E.; Bayat, H.; Kazemi, B.; Bandehpour, M.; Rostami, E.; Rahimpour, A.; Moosavian, H. Overexpression of VEGF in dermal fibroblast cells accelerates the angiogenesis and wound healing function: In vitro and in vivo studies. Sci. Rep. 2022, 12, 18529. [Google Scholar] [CrossRef]
- Hesketh, M.; Sahin, K.B.; West, Z.E.; Murray, R.Z. Macrophage Phenotypes Regulate Scar Formation and Chronic Wound Healing. Int. J. Mol. Sci. 2017, 18, 1545. [Google Scholar] [CrossRef]
- Wynn, T.A.; Vannella, K.M. Macrophages in Tissue Repair, Regeneration, and Fibrosis. Immunity 2016, 44, 450–462. [Google Scholar] [CrossRef] [PubMed]
- Pang, Y.; Wang, D.; Hu, X.; Wang, H.; Fu, W.; Fan, Z.; Chen, X.; Yu, F. Effect of volatile oil from Blumea Balsamifera (L.) DC. leaves on wound healing in mice. J. Tradit. Chin. Med. 2014, 34, 716–724. [Google Scholar] [CrossRef]
- Sorg, H.; Tilkorn, D.J.; Hager, S.; Hauser, J.; Mirastschijski, U. Skin Wound Healing: An Update on the Current Knowledge and Concepts. Eur. Surg. Res. 2017, 58, 81–94. [Google Scholar] [CrossRef]
- Li, M.; Hou, Q.; Zhong, L.; Zhao, Y.; Fu, X. Macrophage Related Chronic Inflammation in Non-Healing Wounds. Front. Immunol. 2021, 12, 681710. [Google Scholar] [CrossRef]
- Ogawa, R. Keloid and Hypertrophic Scars Are the Result of Chronic Inflammation in the Reticular Dermis. Int. J. Mol. Sci. 2017, 18, 606. [Google Scholar] [CrossRef] [PubMed]
- Ghieh, F.; Jurjus, R.; Ibrahim, A.; Geagea, A.G.; Daouk, H.; El Baba, B.; Chams, S.; Matar, M.; Zein, W.; Jurjus, A. The Use of Stem Cells in Burn Wound Healing: A Review. Biomed. Res. Int. 2015, 2015, 684084. [Google Scholar] [CrossRef] [PubMed]
- Diller, R.B.; Tabor, A.J. The Role of the Extracellular Matrix (ECM) in Wound Healing: A Review. Biomimetics 2022, 7, 87. [Google Scholar] [CrossRef]
- Bonnici, L.; Suleiman, S.; Schembri-Wismayer, P.; Cassar, A. Targeting Signalling Pathways in Chronic Wound Healing. Int. J. Mol. Sci. 2023, 25, 50. [Google Scholar] [CrossRef] [PubMed]
- Massagué, J. TGFβ signalling in context. Nat. Rev. Mol. Cell Biol. 2012, 13, 616–630. [Google Scholar] [CrossRef]
- Baba, A.B.; Rah, B.; Bhat, G.R.; Mushtaq, I.; Parveen, S.; Hassan, R.; Hameed Zargar, M.; Afroze, D. Transforming Growth Factor-Beta (TGF-β) Signaling in Cancer-A Betrayal Within. Front. Pharmacol. 2022, 13, 791272. [Google Scholar] [CrossRef]
- Meng, X.M.; Nikolic-Paterson, D.J.; Lan, H.Y. TGF-β: The master regulator of fibrosis. Nat. Rev. Nephrol. 2016, 12, 325–338. [Google Scholar] [CrossRef]
- Li, Y.; Zhang, J.; Yue, J.; Gou, X.; Wu, X. Epidermal Stem Cells in Skin Wound Healing. Adv. Wound Care 2017, 6, 297–307. [Google Scholar] [CrossRef] [PubMed]
- Liarte, S.; Bernabé-García, Á.; Nicolás, F.J. Role of TGF-β in Skin Chronic Wounds: A Keratinocyte Perspective. Cells 2020, 9, 306. [Google Scholar] [CrossRef]
- Park, J.U.; Jeong, S.H.; Song, E.H.; Song, J.; Kim, H.E.; Kim, S. Acceleration of the healing process of full-thickness wounds using hydrophilic chitosan-silica hybrid sponge in a porcine model. J. Biomater. Appl. 2018, 32, 1011–1023. [Google Scholar] [CrossRef]
- Martin, P.; Leibovich, S.J. Inflammatory cells during wound repair: The good, the bad and the ugly. Trends Cell Biol. 2005, 15, 599–607. [Google Scholar] [CrossRef] [PubMed]
- Eming, S.A.; Krieg, T.; Davidson, J.M. Inflammation in wound repair: Molecular and cellular mechanisms. J. Investig. Dermatol. 2007, 127, 514–525. [Google Scholar] [CrossRef]
- Mauviel, A.; Heino, J.; Kähäri, V.M.; Hartmann, D.J.; Loyau, G.; Pujol, J.P.; Vuorio, E. Comparative effects of interleukin-1 and tumor necrosis factor-alpha on collagen production and corresponding procollagen mRNA levels in human dermal fibroblasts. J. Investig. Dermatol. 1991, 96, 243–249. [Google Scholar] [CrossRef] [PubMed]
- Arno, A.I.; Gauglitz, G.G.; Barret, J.P.; Jeschke, M.G. New molecular medicine-based scar management strategies. Burns 2014, 40, 539–551. [Google Scholar] [CrossRef] [PubMed]
- Zhou, R.; Wang, C.; Wen, C.; Wang, D. miR-21 promotes collagen production in keloid via Smad7. Burns 2017, 43, 555–561. [Google Scholar] [CrossRef]
- Kamiya, Y.; Miyazono, K.; Miyazawa, K. Smad7 inhibits transforming growth factor-beta family type i receptors through two distinct modes of interaction. J. Biol. Chem. 2010, 285, 30804–30813. [Google Scholar] [CrossRef]
- Zhang, Z.; Finnerty, C.C.; He, J.; Herndon, D.N. Smad ubiquitination regulatory factor 2 expression is enhanced in hypertrophic scar fibroblasts from burned children. Burns 2012, 38, 236–246. [Google Scholar] [CrossRef] [PubMed]
- Tang, B.; Zhu, B.; Liang, Y.; Bi, L.; Hu, Z.; Chen, B.; Zhang, K.; Zhu, J. Asiaticoside suppresses collagen expression and TGF-β/Smad signaling through inducing Smad7 and inhibiting TGF-βRI and TGF-βRII in keloid fibroblasts. Arch. Dermatol. Res. 2011, 303, 563–572. [Google Scholar] [CrossRef]
- Gaudreault, M.; Vigneault, F.; Leclerc, S.; Guérin, S.L. Laminin reduces expression of the human alpha6 integrin subunit gene by altering the level of the transcription factors Sp1 and Sp3. Investig. Ophthalmol. Vis. Sci. 2007, 48, 3490–3505. [Google Scholar] [CrossRef]
- Gabbiani, G.; Hirschel, B.J.; Ryan, G.B.; Statkov, P.R.; Majno, G. Granulation tissue as a contractile organ. A study of structure and function. J. Exp. Med. 1972, 135, 719–734. [Google Scholar] [CrossRef]
- Darby, I.A.; Hewitson, T.D. Fibroblast differentiation in wound healing and fibrosis. Int. Rev. Cytol. 2007, 257, 143–179. [Google Scholar] [CrossRef] [PubMed]
- He, J.; Peng, H.; Wang, M.; Liu, Y.; Guo, X.; Wang, B.; Dai, L.; Cheng, X.; Meng, Z.; Yuan, L.; et al. Isoliquiritigenin inhibits TGF-β1-induced fibrogenesis through activating autophagy via PI3K/AKT/mTOR pathway in MRC-5 cells. Acta Biochim. Biophys. Sin. 2020, 52, 810–820. [Google Scholar] [CrossRef] [PubMed]
- Tang, M.; Bian, W.; Cheng, L.; Zhang, L.; Jin, R.; Wang, W.; Zhang, Y. Ginsenoside Rg3 inhibits keloid fibroblast proliferation, angiogenesis and collagen synthesis in vitro via the TGF-β/Smad and ERK signaling pathways. Int. J. Mol. Med. 2018, 41, 1487–1499. [Google Scholar] [CrossRef]
- Squarize, C.H.; Castilho, R.M.; Bugge, T.H.; Gutkind, J.S. Accelerated wound healing by mTOR activation in genetically defined mouse models. PLoS ONE 2010, 5, e10643. [Google Scholar] [CrossRef]
- Li, T.; Wang, G. Computer-aided targeting of the PI3K/Akt/mTOR pathway: Toxicity reduction and therapeutic opportunities. Int. J. Mol. Sci. 2014, 15, 18856–18891. [Google Scholar] [CrossRef]
- Hoke, G.D.; Ramos, C.; Hoke, N.N.; Crossland, M.C.; Shawler, L.G.; Boykin, J.V. Atypical Diabetic Foot Ulcer Keratinocyte Protein Signaling Correlates with Impaired Wound Healing. J. Diabetes Res. 2016, 2016, 1586927. [Google Scholar] [CrossRef] [PubMed]
- Jere, S.W.; Houreld, N.N.; Abrahamse, H. Role of the PI3K/AKT (mTOR and GSK3β) signalling pathway and photobiomodulation in diabetic wound healing. Cytokine Growth Factor Rev. 2019, 50, 52–59. [Google Scholar] [CrossRef]
- Xiao, W.; Tang, H.; Wu, M.; Liao, Y.; Li, K.; Li, L.; Xu, X. Ozone oil promotes wound healing by increasing the migration of fibroblasts via PI3K/Akt/mTOR signaling pathway. Biosci. Rep. 2017, 37, BSR20170658. [Google Scholar] [CrossRef]
- Hou, B.; Cai, W.; Chen, T.; Zhang, Z.; Gong, H.; Yang, W.; Qiu, L. Vaccarin hastens wound healing by promoting angiogenesis via activation of MAPK/ERK and PI3K/AKT signaling pathways in vivo. Acta Cir. Bras. 2020, 34, e201901202. [Google Scholar] [CrossRef]
- Yu, T.; Gao, M.; Yang, P.; Liu, D.; Wang, D.; Song, F.; Zhang, X.; Liu, Y. Insulin promotes macrophage phenotype transition through PI3K/Akt and PPAR-γ signaling during diabetic wound healing. J. Cell. Physiol. 2019, 234, 4217–4231. [Google Scholar] [CrossRef]
- Gao, Y.L.; Liu, C.S.; Zhao, R.; Wang, L.L.; Li, S.S.; Liu, M.; Zhang, M.; Jiang, S.K.; Tian, Z.L.; Wang, M.; et al. Effects of PI3K/Akt Pathway in Wound Healing Process of Mice Skin. Fa Yi Xue Za Zhi 2016, 32, 7–12. [Google Scholar] [PubMed]
- Chattopadhyay, S.; Raines, R.T. Review collagen-based biomaterials for wound healing. Biopolymers 2014, 101, 821–833. [Google Scholar] [CrossRef] [PubMed]
- Banerjee, P.; Suguna, L.; Shanthi, C. Wound healing activity of a collagen-derived cryptic peptide. Amino Acids 2015, 47, 317–328. [Google Scholar] [CrossRef] [PubMed]
- Chong, H.C.; Tan, M.J.; Philippe, V.; Tan, S.H.; Tan, C.K.; Ku, C.W.; Goh, Y.Y.; Wahli, W.; Michalik, L.; Tan, N.S. Regulation of epithelial-mesenchymal IL-1 signaling by PPARbeta/delta is essential for skin homeostasis and wound healing. J. Cell Biol. 2009, 184, 817–831. [Google Scholar] [CrossRef] [PubMed]
- Su, L.; Li, X.; Wu, X.; Hui, B.; Han, S.; Gao, J.; Li, Y.; Shi, J.; Zhu, H.; Zhao, B.; et al. Simultaneous deactivation of FAK and Src improves the pathology of hypertrophic scar. Sci. Rep. 2016, 6, 26023. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.; Liu, Z.; Wang, L.; Zhang, X. NF-kappaB signaling pathway, inflammation and colorectal cancer. Cell. Mol. Immunol. 2009, 6, 327–334. [Google Scholar] [CrossRef]
- Herrington, F.D.; Carmody, R.J.; Goodyear, C.S. Modulation of NF-κB Signaling as a Therapeutic Target in Autoimmunity. J. Biomol. Screen. 2016, 21, 223–242. [Google Scholar] [CrossRef]
- Taniguchi, K.; Karin, M. NF-κB, inflammation, immunity and cancer: Coming of age. Nat. Rev. Immunol. 2018, 18, 309–324. [Google Scholar] [CrossRef]
- Liu, T.; Zhang, L.; Joo, D.; Sun, S.C. NF-κB signaling in inflammation. Signal Transduct. Target Ther. 2017, 2, 17023. [Google Scholar] [CrossRef]
- Brown, K.D.; Claudio, E.; Siebenlist, U. The roles of the classical and alternative nuclear factor-kappaB pathways: Potential implications for autoimmunity and rheumatoid arthritis. Arthritis Res. Ther. 2008, 10, 212. [Google Scholar] [CrossRef]
- Canesso, M.C.; Vieira, A.T.; Castro, T.B.; Schirmer, B.G.; Cisalpino, D.; Martins, F.S.; Rachid, M.A.; Nicoli, J.R.; Teixeira, M.M.; Barcelos, L.S. Skin wound healing is accelerated and scarless in the absence of commensal microbiota. J. Immunol. 2014, 193, 5171–5180. [Google Scholar] [CrossRef] [PubMed]
- Williams, H.; Campbell, L.; Crompton, R.A.; Singh, G.; McHugh, B.J.; Davidson, D.J.; McBain, A.J.; Cruickshank, S.M.; Hardman, M.J. Microbial Host Interactions and Impaired Wound Healing in Mice and Humans: Defining a Role for BD14 and NOD2. J. Investig. Dermatol. 2018, 138, 2264–2274. [Google Scholar] [CrossRef] [PubMed]
- Bielig, H.; Zurek, B.; Kutsch, A.; Menning, M.; Philpott, D.J.; Sansonetti, P.J.; Kufer, T.A. A function for AAMP in Nod2-mediated NF-kappaB activation. Mol. Immunol. 2009, 46, 2647–2654. [Google Scholar] [CrossRef] [PubMed]
- Liu, Y.; Yang, H.; Liu, L.X.; Yan, W.; Guo, H.J.; Li, W.J.; Tian, C.; Li, H.H.; Wang, H.X. NOD2 contributes to myocardial ischemia/reperfusion injury by regulating cardiomyocyte apoptosis and inflammation. Life Sci. 2016, 149, 10–17. [Google Scholar] [CrossRef]
- Yang, B.; Lin, Y.; Huang, Y.; Zhu, N.; Shen, Y.Q. Extracellular vesicles modulate key signalling pathways in refractory wound healing. Burns Trauma 2023, 11, tkad039. [Google Scholar] [CrossRef] [PubMed]
- Hu, X.; Li, J.; Fu, M.; Zhao, X.; Wang, W. The JAK/STAT signaling pathway: From bench to clinic. Signal Transduct. Target. Ther. 2021, 6, 402. [Google Scholar] [CrossRef]
- Hunckler, J.; de Mel, A. A current affair: Electrotherapy in wound healing. J. Multidiscip. Healthc. 2017, 10, 179–194. [Google Scholar] [CrossRef]
- Jere, S.W.; Abrahamse, H.; Houreld, N.N. The JAK/STAT signaling pathway and photobiomodulation in chronic wound healing. Cytokine Growth Factor Rev. 2017, 38, 73–79. [Google Scholar] [CrossRef]
- Matos, C.; Lobão, P. Non-Steroidal Anti-Inflammatory Drugs Loaded Liposomes for Topical Treatment of Inflammatory and Degenerative Conditions. Curr. Med. Chem. 2020, 27, 3809–3829. [Google Scholar] [CrossRef]
- Leppert, W.; Malec-Milewska, M.; Zajaczkowska, R.; Wordliczek, J. Transdermal and Topical Drug Administration in the Treatment of Pain. Molecules 2018, 23, 681. [Google Scholar] [CrossRef]
- Touitou, E.; Natsheh, H. Topical Administration of Drugs Incorporated in Carriers Containing Phospholipid Soft Vesicles for the Treatment of Skin Medical Conditions. Pharmaceutics 2021, 13, 2129. [Google Scholar] [CrossRef] [PubMed]
- Marwah, H.; Garg, T.; Goyal, A.K.; Rath, G. Permeation enhancer strategies in transdermal drug delivery. Drug Deliv. 2016, 23, 564–578. [Google Scholar] [CrossRef]
- Natsheh, H.; Touitou, E. Phospholipid Vesicles for Dermal/Transdermal and Nasal Administration of Active Molecules: The Effect of Surfactants and Alcohols on the Fluidity of Their Lipid Bilayers and Penetration Enhancement Properties. Molecules 2020, 25, 2959. [Google Scholar] [CrossRef]
- Lau, W.M.; White, A.W.; Gallagher, S.J.; Donaldson, M.; McNaughton, G.; Heard, C.M. Scope and limitations of the co-drug approach to topical drug delivery. Curr. Pharm. Des. 2008, 14, 794–802. [Google Scholar] [CrossRef] [PubMed]
- Ramos Campos, E.V.; Proença, P.L.F.; Doretto-Silva, L.; Andrade-Oliveira, V.; Fraceto, L.F.; de Araujo, D.R. Trends in nanoformulations for atopic dermatitis treatment. Expert Opin. Drug Deliv. 2020, 17, 1615–1630. [Google Scholar] [CrossRef] [PubMed]
- Seykora, J.; Dentchev, T.; Margolis, D.J. Filaggrin-2 barrier protein inversely varies with skin inflammation. Exp. Dermatol. 2015, 24, 720–722. [Google Scholar] [CrossRef]
- Anastasi, A.; Erspamer, V.; Bucci, M. Isolation and amino acid sequences of alytesin and bombesin, two analogous active tetradecapeptides from the skin of European discoglossid frogs. Arch Biochem. Biophys. 1972, 148, 443–446. [Google Scholar] [CrossRef]
- Sun, G.; Shen, Y.I.; Harmon, J.W. Engineering Pro-Regenerative Hydrogels for Scarless Wound Healing. Adv. Healthc. Mater. 2018, 7, e1800016. [Google Scholar] [CrossRef]
- Griffin, D.R.; Weaver, W.M.; Scumpia, P.O.; Di Carlo, D.; Segura, T. Accelerated wound healing by injectable microporous gel scaffolds assembled from annealed building blocks. Nat. Mater. 2015, 14, 737–744. [Google Scholar] [CrossRef]
- Shafique, M.; Sohail, M.; Minhas, M.U.; Khaliq, T.; Kousar, M.; Khan, S.; Hussain, Z.; Mahmood, A.; Abbasi, M.; Aziz, H.C.; et al. Bio-functional hydrogel membranes loaded with chitosan nanoparticles for accelerated wound healing. Int. J. Biol. Macromol. 2021, 170, 207–221. [Google Scholar] [CrossRef]
- Chouhan, D.; Lohe, T.U.; Samudrala, P.K.; Mandal, B.B. In Situ Forming Injectable Silk Fibroin Hydrogel Promotes Skin Regeneration in Full Thickness Burn Wounds. Adv. Healthc. Mater. 2018, 7, e1801092. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Li, Y.; Yang, X.; Cao, Z.; Nie, H.; Bian, Y.; Yang, G. Glucose-triggered in situ forming keratin hydrogel for the treatment of diabetic wounds. Acta Biomater. 2021, 125, 208–218. [Google Scholar] [CrossRef]
- Klubthawee, N.; Bovone, G.; Marco-Dufort, B.; Guzzi, E.A.; Aunpad, R.; Tibbitt, M.W. Biopolymer Nano-Network for Antimicrobial Peptide Protection and Local Delivery. Adv. Healthc. Mater. 2022, 11, e2101426. [Google Scholar] [CrossRef]
- Vázquez-González, M.; Willner, I. Stimuli-Responsive Biomolecule-Based Hydrogels and Their Applications. Angew. Chem. Int. Ed. Engl. 2020, 59, 15342–15377. [Google Scholar] [CrossRef]
- Fan, F.; Saha, S.; Hanjaya-Putra, D. Biomimetic Hydrogels to Promote Wound Healing. Front. Bioeng. Biotechnol. 2021, 9, 718377. [Google Scholar] [CrossRef] [PubMed]
- Cifuentes, A.; Gómez-Gil, V.; Ortega, M.A.; Asúnsolo, Á.; Coca, S.; Román, J.S.; Álvarez-Mon, M.; Buján, J.; García-Honduvilla, N. Chitosan hydrogels functionalized with either unfractionated heparin or bemiparin improve diabetic wound healing. Biomed. Pharmacother. 2020, 129, 110498. [Google Scholar] [CrossRef] [PubMed]
- Simões, D.; Miguel, S.P.; Ribeiro, M.P.; Coutinho, P.; Mendonça, A.G.; Correia, I.J. Recent advances on antimicrobial wound dressing: A review. Eur. J. Pharm. Biopharm. 2018, 127, 130–141. [Google Scholar] [CrossRef]
- Chen, Z.; Hu, Y.; Li, J.; Zhang, C.; Gao, F.; Ma, X.; Zhang, J.; Fu, C.; Geng, F. A feasible biocompatible hydrogel film embedding Periplaneta americana extract for acute wound healing. Int. J. Pharm. 2019, 571, 118707. [Google Scholar] [CrossRef]
- Feng, X.; Zhang, X.; Li, S.; Zheng, Y.; Shi, X.; Li, F.; Guo, S.; Yang, J. Preparation of aminated fish scale collagen and oxidized sodium alginate hybrid hydrogel for enhanced full-thickness wound healing. Int. J. Biol. Macromol. 2020, 164, 626–637. [Google Scholar] [CrossRef]
- Amani, H.; Shahbazi, M.A.; D’Amico, C.; Fontana, F.; Abbaszadeh, S.; Santos, H.A. Microneedles for painless transdermal immunotherapeutic applications. J. Control Release 2021, 330, 185–217. [Google Scholar] [CrossRef]
- Zhu, J.; Zhou, X.; Kim, H.J.; Qu, M.; Jiang, X.; Lee, K.; Ren, L.; Wu, Q.; Wang, C.; Zhu, X.; et al. Gelatin Methacryloyl Microneedle Patches for Minimally Invasive Extraction of Skin Interstitial Fluid. Small 2020, 16, e1905910. [Google Scholar] [CrossRef] [PubMed]
- Ramalheiro, A.; Paris, J.L.; Silva, B.F.B.; Pires, L.R. Rapidly dissolving microneedles for the delivery of cubosome-like liquid crystalline nanoparticles with sustained release of rapamycin. Int. J. Pharm. 2020, 591, 119942. [Google Scholar] [CrossRef] [PubMed]
- Lyu, S.; Dong, Z.; Xu, X.; Bei, H.P.; Yuen, H.Y.; James Cheung, C.W.; Wong, M.S.; He, Y.; Zhao, X. Going below and beyond the surface: Microneedle structure, materials, drugs, fabrication, and applications for wound healing and tissue regeneration. Bioact. Mater. 2023, 27, 303–326. [Google Scholar] [CrossRef] [PubMed]
- Aust, M.C.; Reimers, K.; Kaplan, H.M.; Stahl, F.; Repenning, C.; Scheper, T.; Jahn, S.; Schwaiger, N.; Ipaktchi, R.; Redeker, J.; et al. Percutaneous collagen induction-regeneration in place of cicatrisation? J. Plast. Reconstr. Aesthetic Surg. 2011, 64, 97–107. [Google Scholar] [CrossRef]
- Zhang, Q.; Shi, L.; He, H.; Liu, X.; Huang, Y.; Xu, D.; Yao, M.; Zhang, N.; Guo, Y.; Lu, Y.; et al. Down-Regulating Scar Formation by Microneedles Directly via a Mechanical Communication Pathway. ACS Nano 2022, 16, 10163–10178. [Google Scholar] [CrossRef]
- Tsioris, K.; Raja, W.K.; Pritchard, E.M.; Panilaitis, B.; Kaplan, D.L.; Omenetto, F.G. Fabrication of Silk Microneedles for Controlled-Release Drug Delivery. Adv. Funct. Mater. 2012, 22, 330–335. [Google Scholar] [CrossRef]
- Gao, B.; Guo, M.; Lyu, K.; Chu, T.; He, B. Intelligent Silk Fibroin Based Microneedle Dressing (i-SMD). Adv. Funct. Mater. 2021, 31, 2006839. [Google Scholar] [CrossRef]
- Jamaledin, R.; Yiu, C.K.Y.; Zare, E.N.; Niu, L.N.; Vecchione, R.; Chen, G.; Gu, Z.; Tay, F.R.; Makvandi, P. Advances in Antimicrobial Microneedle Patches for Combating Infections. Adv. Mater. 2020, 32, e2002129. [Google Scholar] [CrossRef]
- Li, W.X.; Zhang, X.P.; Chen, B.Z.; Fei, W.M.; Cui, Y.; Zhang, C.Y.; Guo, X.D. An update on microneedle-based systems for diabetes. Drug Deliv. Transl. Res. 2022, 12, 2275–2286. [Google Scholar] [CrossRef]
- Szabó, A.; De Decker, I.; Semey, S.; Claes, K.E.; Blondeel, P.; Monstrey, S.; Dorpe, J.V.; Van Vlierberghe, S. Photo-crosslinkable polyester microneedles as sustained drug release systems toward hypertrophic scar treatment. Drug Deliv. 2024, 31, 2305818. [Google Scholar] [CrossRef]
- Aziz, A.Y.R.; Mahfufah, U.; Syahirah, N.A.; Habibie; Asri, R.M.; Yulianty, R.; Kastian, R.F.; Sari, Y.W.; Chabib, L.; Hamzah, H.; et al. Dual delivery systems combining nanocrystals and dissolving microneedles for improved local vaginal delivery of fluconazole. Drug Deliv. Transl. Res. 2024, 14, 1678–1692. [Google Scholar] [CrossRef] [PubMed]
- Sun, B.; Zhang, T.; Chen, H.; Gao, W.; Zhou, J.; Chen, Y.; Ding, W.; Yin, X.; Ren, J.; Hua, C.; et al. Microneedle delivery system with rapid dissolution and sustained release of bleomycin for the treatment of hemangiomas. J. Nanobiotechnol. 2024, 22, 372. [Google Scholar] [CrossRef] [PubMed]
- Ou Yang, M.W.; Hu, L.F.; Feng, Y.H.; Li, X.; Peng, J.; Yu, R.; Zhang, C.Y.; Chen, B.Z.; Guo, X.D. Hybrid Microneedle-Mediated Transdermal Delivery of Atorvastatin Calcium-Loaded Polymeric Micelles for Hyperlipidemia Therapy. ACS Appl. Bio Mater. 2024, 7, 4051–4061. [Google Scholar] [CrossRef] [PubMed]
- Cai, G.; Li, R.; Chai, X.; Cai, X.; Zheng, K.; Wang, Y.; Fan, K.; Guo, Z.; Guo, J.; Jiang, W. Catalase-templated nanozyme-loaded microneedles integrated with polymyxin B for immunoregulation and antibacterial activity in diabetic wounds. J. Colloid Interface Sci. 2024, 667, 529–542. [Google Scholar] [CrossRef]
- Zhou, X.; Liu, H.; Yu, Z.; Yu, H.; Meng, D.; Zhu, L.; Li, H. Direct 3D printing of triple-responsive nanocomposite hydrogel microneedles for controllable drug delivery. J. Colloid Interface Sci. 2024, 670, 1–11. [Google Scholar] [CrossRef]
- Yu, X.; Wang, C.; Wang, Y.; Li, L.; Gao, X.; Zhu, T.; An, P.; Meng, Z.; Wang, W.; Wu, T.; et al. Microneedle Array Patch Made of Kangfuxin/Chitosan/Fucoidan Complex Enables Full-Thickness Wound Healing. Front. Chem. 2022, 10, 838920. [Google Scholar] [CrossRef]
- Abou Zekry, S.S.; Abdellatif, A.; Azzazy, H.M.E. Fabrication of pomegranate/honey nanofibers for use as antibacterial wound dressings. Wound Med. 2020, 28, 100181. [Google Scholar] [CrossRef]
- Chen, S.; Wang, H.; Su, Y.; John, J.V.; McCarthy, A.; Wong, S.L.; Xie, J. Mesenchymal stem cell-laden, personalized 3D scaffolds with controlled structure and fiber alignment promote diabetic wound healing. Acta Biomater. 2020, 108, 153–167. [Google Scholar] [CrossRef] [PubMed]
- Naeimi, A.; Payandeh, M.; Ghara, A.R.; Ghadi, F.E. In vivo evaluation of the wound healing properties of bio-nanofiber chitosan/polyvinyl alcohol incorporating honey and Nepeta dschuparensis. Carbohydr. Polym. 2020, 240, 116315. [Google Scholar] [CrossRef]
- Larijani, G.; Parivar, K.; Hayati Roodbari, N.; Yaghmaei, P.; Amini, N. Fortified electrospun collagen utilizing biocompatible Poly Glycerol Sebacate prepolymer (PGSp) and zink oxide nanoparticles (ZnO NPs) for diabetics wound healing: Physical, biological and animal studies. Regen. Ther. 2024, 26, 102–113. [Google Scholar] [CrossRef]
- Li, X.; Jiang, F.; Duan, Y.; Li, Q.; Qu, Y.; Zhao, S.; Yue, X.; Huang, C.; Zhang, C.; Pan, X. Chitosan electrospun nanofibers derived from Periplaneta americana residue for promoting infected wound healing. Int. J. Biol. Macromol. 2023, 229, 654–667. [Google Scholar] [CrossRef]
- Costa, N.N.; de Faria Lopes, L.; Ferreira, D.F.; de Prado, E.M.L.; Severi, J.A.; Resende, J.A.; de Paula Careta, F.; Ferreira, M.C.P.; Carreira, L.G.; de Souza, S.O.L.; et al. Polymeric films containing pomegranate peel extract based on PVA/starch/PAA blends for use as wound dressing: In vitro analysis and physicochemical evaluation. Mater. Sci. Eng. C Mater. Biol. Appl. 2020, 109, 110643. [Google Scholar] [CrossRef] [PubMed]
- Huang, S.; Fu, X. Naturally derived materials-based cell and drug delivery systems in skin regeneration. J. Control. Release 2010, 142, 149–159. [Google Scholar] [CrossRef] [PubMed]
- Bonifácio, B.V.; Silva, P.B.; Ramos, M.A.; Negri, K.M.; Bauab, T.M.; Chorilli, M. Nanotechnology-based drug delivery systems and herbal medicines: A review. Int. J. Nanomed. 2014, 9, 1–15. [Google Scholar] [CrossRef]
- Lopes Rocha Correa, V.; Assis Martins, J.; Ribeiro de Souza, T.; de Castro Nunes Rincon, G.; Pacheco Miguel, M.; Borges de Menezes, L.; Correa Amaral, A. Melatonin loaded lecithin-chitosan nanoparticles improved the wound healing in diabetic rats. Int. J. Biol. Macromol. 2020, 162, 1465–1475. [Google Scholar] [CrossRef]
- Kumar, M.; Mahmood, S.; Chopra, S.; Bhatia, A. Biopolymer based nanoparticles and their therapeutic potential in wound healing—A review. Int. J. Biol. Macromol. 2024, 267, 131335. [Google Scholar] [CrossRef]
- Farshidfar, N.; Iravani, S.; Varma, R.S. Alginate-Based Biomaterials in Tissue Engineering and Regenerative Medicine. Mar. Drugs 2023, 21, 189. [Google Scholar] [CrossRef] [PubMed]
- Kato, Y.; Onishi, H.; Machida, Y. Application of chitin and chitosan derivatives in the pharmaceutical field. Curr. Pharm. Biotechnol. 2003, 4, 303–309. [Google Scholar] [CrossRef]
- Mndlovu, H.; du Toit, L.C.; Kumar, P.; Choonara, Y.E.; Marimuthu, T.; Kondiah, P.P.D.; Pillay, V. Bioplatform Fabrication Approaches Affecting Chitosan-Based Interpolymer Complex Properties and Performance as Wound Dressings. Molecules 2020, 25, 222. [Google Scholar] [CrossRef]
- Hussain, Z.; Thu, H.E.; Shuid, A.N.; Katas, H.; Hussain, F. Recent Advances in Polymer-based Wound Dressings for the Treatment of Diabetic Foot Ulcer: An Overview of State-of-the-art. Curr. Drug Targets 2018, 19, 527–550. [Google Scholar] [CrossRef]
- Hafezi, F.; Scoutaris, N.; Douroumis, D.; Boateng, J. 3D printed chitosan dressing crosslinked with genipin for potential healing of chronic wounds. Int. J. Pharm. 2019, 560, 406–415. [Google Scholar] [CrossRef] [PubMed]
- Weller, C.D.; Team, V.; Sussman, G. First-Line Interactive Wound Dressing Update: A Comprehensive Review of the Evidence. Front. Pharmacol. 2020, 11, 155. [Google Scholar] [CrossRef] [PubMed]
- Chang, W.; Chen, L.; Chen, K. The bioengineering application of hyaluronic acid in tissue regeneration and repair. Int. J. Biol. Macromol. 2024, 270, 132454. [Google Scholar] [CrossRef] [PubMed]
- Hassan, M.A.; Basha, A.A.; Eraky, M.; Abbas, E.; El-Samad, L.M. Advancements in silk fibroin and silk sericin-based biomaterial applications for cancer therapy and wound dressing formulation: A comprehensive review. Int. J. Pharm. 2024, 662, 124494. [Google Scholar] [CrossRef] [PubMed]
- Monika, P.; Chandraprabha, M.N.; Radhakrishnan, V.; Somayaji, P.; Sabu, L. Therapeutic potential of silkworm sericin in wound healing applications. Wound Repair Regen. 2024. ahead of print. [Google Scholar] [CrossRef]
- González-Restrepo, D.; Zuluaga-Vélez, A.; Orozco, L.M.; Sepúlveda-Arias, J.C. Silk fibroin-based dressings with antibacterial and anti-inflammatory properties. Eur. J. Pharm. Sci. 2024, 195, 106710. [Google Scholar] [CrossRef]
- Mehrabani, M.G.; Karimian, R.; Rakhshaei, R.; Pakdel, F.; Eslami, H.; Fakhrzadeh, V.; Rahimi, M.; Salehi, R.; Kafil, H.S. Chitin/silk fibroin/TiO2 bio-nanocomposite as a biocompatible wound dressing bandage with strong antimicrobial activity. Int. J. Biol. Macromol. 2018, 116, 966–976. [Google Scholar] [CrossRef]
- Norman, G.; Westby, M.J.; Rithalia, A.D.; Stubbs, N.; Soares, M.O.; Dumville, J.C. Dressings and topical agents for treating venous leg ulcers. Cochrane Database Syst. Rev. 2018, 6, Cd012583. [Google Scholar] [CrossRef]
- Jiang, P.; Li, Q.; Luo, Y.; Luo, F.; Che, Q.; Lu, Z.; Yang, S.; Yang, Y.; Chen, X.; Cai, Y. Current status and progress in research on dressing management for diabetic foot ulcer. Front. Endocrinol. 2023, 14, 1221705. [Google Scholar] [CrossRef]
- Chaudhary, K.; Kumar, R.; Singh, S.; Tuknait, A.; Gautam, A.; Mathur, D.; Anand, P.; Varshney, G.C.; Raghava, G.P. A Web Server and Mobile App for Computing Hemolytic Potency of Peptides. Sci. Rep. 2016, 6, 22843. [Google Scholar] [CrossRef]
- Muttenthaler, M.; King, G.F.; Adams, D.J.; Alewood, P.F. Trends in peptide drug discovery. Nat. Rev. Drug Discov. 2021, 20, 309–325. [Google Scholar] [CrossRef] [PubMed]
- Basith, S.; Manavalan, B.; Hwan Shin, T.; Lee, G. Machine intelligence in peptide therapeutics: A next-generation tool for rapid disease screening. Med. Res. Rev. 2020, 40, 1276–1314. [Google Scholar] [CrossRef] [PubMed]
- Zhou, P.; Wang, C.; Ren, Y.; Yang, C.; Tian, F. Computational peptidology: A new and promising approach to therapeutic peptide design. Curr. Med. Chem. 2013, 20, 1985–1996. [Google Scholar] [CrossRef] [PubMed]
- Robles-Loaiza, A.A.; Pinos-Tamayo, E.A.; Mendes, B.; Ortega-Pila, J.A.; Proaño-Bolaños, C.; Plisson, F.; Teixeira, C.; Gomes, P.; Almeida, J.R. Traditional and Computational Screening of Non-Toxic Peptides and Approaches to Improving Selectivity. Pharmaceuticals 2022, 15, 323. [Google Scholar] [CrossRef]
- Goles, M.; Daza, A.; Cabas-Mora, G.; Sarmiento-Varón, L.; Sepúlveda-Yañez, J.; Anvari-Kazemabad, H.; Davari, M.D.; Uribe-Paredes, R.; Olivera-Nappa, Á.; Navarrete, M.A.; et al. Peptide-based drug discovery through artificial intelligence: Towards an autonomous design of therapeutic peptides. Brief Bioinform. 2024, 25, bbae275. [Google Scholar] [CrossRef]
- Thapa, R.K.; Diep, D.B.; Tønnesen, H.H. Topical antimicrobial peptide formulations for wound healing: Current developments and future prospects. Acta Biomater. 2020, 103, 52–67. [Google Scholar] [CrossRef]
Source | Species | Active Ingredient | Acquisition Method | Effect on Wound Healing | Ref. |
---|---|---|---|---|---|
Earthworm | Eisenia foetida | G-90 | Remove impurities with chloroform Extract with methanol and water | Promote EGF generation Promote proliferation of fibroblasts and epithelial cells | [23,24] |
Ohira the 2nd | EE | Ultrafiltration | Stimulate cytokine secretion Anti-inflammatory Increase the synthesis of collagen Promote blood capillary Promote fibroblast proliferation | [10] | |
Ohira the 2nd | EE-1 | Ultrafiltration, dialysis | Activate angiogenesis Activate epithelial regeneration Inhibite fibrosis Inhibite of scar formation | [25] | |
Eisenia foetida | ES-2 | Homogenize, dialysis, salting out | Stimulate VEGF production Promote proliferation of fibroblasts and keratinocytes | [26] | |
Eisenia foetida | G-90′ | Homogenize, dialysis, salting out | Upregulate expression of proteins HSP70 and lysozyme | [27] | |
Eisenia Andrei | col4a1 | Sonication, centrifuge, filter | Activate the RAS/MAPK signaling pathway Activate the proliferation of fibroblasts | [13] | |
Pheretima vulgaris Chen | PvE-3 | Extracted by water Precipitated by ethanol | Anti-inflammatory Stimulate granulation formation Enhance the secretion of α-SMA Promote the neovascularization and collagen fiber synthesis | [28] | |
Eisenia foetida | ES2 | Dialysis, centrifuge | Promote the secretion of cytokines Promote the synthesis and accumulation of collagen | [29] | |
earthworm | EAP | —— | Accelerate the proliferation of NIH3T3 Promote the expression of cyclins | [30] | |
Periplaneta | Periplaneta americana L. | PAL | Ethanol extraction | Regulate cell cycle Promote cytokine secretion Accelerate epithelial cell growth Promote angiogenesis | [31] |
Periplaneta americana | PaPPc2 and PaPPc3 | Reflux extracted by water Precipitated by ethanol Anion exchange chromatography | Promote angiogenesis Promote collagen synthesis | [32] | |
Periplaneta americana | PAE | Ethanol extraction, filter | Enhance epithelial repair, follicle regeneration, and fibrous tissue proliferation | [19] | |
Amphibians | Amolops jingdongensis | Bv8-AJ | Ladder sequencing determines amino acid sequence Synthetic peptides | Anti-inflammatory Promote IL-1 generation Promote proliferation of fibroblasts and keratinocytes | [33] |
Duttaphrynus melanostictus | cathelicidin-DM | cDNAs synthesis for determining amino acid Sequences of synthetic peptides | Facilitate the proliferation of human umbilical vein endothelial cells (HUVECs), human skin fibroblasts (HSFs), and human immortalized epidermal cells (HaCaTs) Promote the migration of HUVEC and HSF cells Promote the differentiation of fibroblasts into myofibroblasts | [34] | |
Hyla annectans | FW-1 and FW-2 | cDNAs synthesis for determining Amino Acid | Anti-inflammatory Antioxidant | [35] | |
Nanorana ventripunctata | Cathelicidin-NV | Ladder sequencing determines amino acid sequence Synthetic peptides | Promote the expression of cytokine Enhance the proliferation of keratinocyte and fibroblast cells Promte the differentiation of fibroblasts to myofibroblasts Promote collagen production | [36] | |
Nanorana ventripunctata | Antioxidin-NV | Ladder sequencing and cDNAs synthesis determines amino acid sequence Synthetic peptides | Anti-inflammatory Antioxidant Alleviate DNA damage Alleviate cell apoptosis | [37] | |
Odorrana andersonii | OA-GL21 | Ladder sequencing and cDNAs synthesis determines amino acid sequence Synthetic peptides | Induce the migration of HaCaT and HSF cells Promote re-epithelialization Promote formation of granulation tissue | [38] | |
Odorrana andersonii | OA-GL12 | cDNA synthesis, Illumina MiSeq sequencing, Synthetic peptides | Promote the expression of cytokine Anti-inflammatory Antioxidant | [39] | |
Odorrana andersonii | OA-GL17d | DNA cloning, mass spectrometry and Edman degradation determines amino acid sequence. Synthetic peptides | Promote the expression of TGF-β1 | [40] | |
Odorrana grahami | AH90 | Solid-phase synthesis | Induce the release of TGF-β1 | [41] | |
Odorrana grahami | CW49 | Solid-phase synthesis | Anti-inflammatory Promote angiogenesis | [42] | |
Odorrana margaretae | OM-LV20 | Edman degradation and cDNA cloning determines amino acid sequence. Synthetic peptides | Induce the proliferation of HaCaTs | [43] | |
Odorrana andersonii | Cathelicidin-OA1 | Ladder sequencing and cDNAs synthesis determines amino acid sequence Synthetic peptides | Enhance the recruitment of macrophages Accelerating re-epithelialization Enhance granulation tissue formation | [44] | |
Odorrana tormota. | Ot-WHP | Synthetic peptides | Elicite the production of regulatory factors Initiate and accelerate the inflammatory phase Promote keratinocyte migration | [45] | |
Pelophylax kl. Esculentus | Brevinin-2Ta | DNA cloning, and mass spectrometry determines amino acid sequence Solid-phase synthesis | Anti-inflammatory Promote epithelial migration Promote angiogenesis | [46] | |
Pelophylax nigromaculatus | Brevinin-2PN | cDNA sequencing determines amino acid sequence. | Accelerate the healing of HSF scratches Enhance cell migration Stimulate gene expression of growth factors | [47] | |
Polypedates megacephalus | PM-7 | Ladder sequencing determines amino acid sequence | Enhance proliferation and migration in HUVECs and HSFs | [48] | |
Rana limnocharis | RL-RL10 | —— | Promote proliferation and migration of keratinocytes | [49] | |
Rana limnocharis | RL-QN15 | Ladder sequencing determines amino acid sequence Synthetic peptides | Modulate the secretion of cytokines Regulate the generation of TGF-β1 and TGF-β3 Accelerated re-epithelialization and granulation tissue formation | [50] | |
Tylototriton verrucosus | Tylotoin | Ladder sequencing and cDNA synthesis determines amino acid sequence Synthetic peptides | Promote the release of TGF-β1 and IL-6 Enhance the motility and proliferation of keratinocytes vascular endothelial cells, and fibroblasts Accelerate re-epithelialization and granulation tissue formation | [51] | |
salamander Tylototriton kweichowensis | TK-CATH | cDNAs synthesis determines amino acid sequence Synthetic peptides | Anti-inflammatory Promote the expression of cytokines Promote the motility and proliferation of keratinocytes | [52] | |
Marine organisms | Oreochromis niloticus | TP2-5 and TP2-6 | Solid-phase synthesis | Promote the motility and proliferation of cells Promote neovascularization Promote the release of cytokines | [18] |
Sea cucumber | VTPY and VLLY | Synthetic peptides | Promote the proliferation and migration of HSFs and HUVECs Increase mitochondrial respiratory capacity Block the binding of MKP to ERK2 and PHLPP to AKT | [53] | |
sea cucumber (S. japonicus) | SCP | Alkali soluble acid precipitation method Anion ion exchange chromatography | Boost epithelialization, dermis integrity, vascularization, and collagen deposition Adjust the immune cells | [54] | |
Sipunculus nudus | SNCP | Hydrolyzed with acetic acid solution with pepsin | Reduce inflammation Improve collagen deposition and recombination Blockade of the TGF-β/Smads signaling pathway | [3] | |
Salmon salar | Ss-SCP | Hydrolyzed with collagenase and compound protease | Upregulate wound NOD2 and BD14 Implicate in microflora colonization regulation Control inflammatory reaction Increase wound angiogenesis and collagen deposition | [55] | |
Tilapia nilotica | Tn-SCP | —— | Upregulate wound NOD2 and BD14 Implicate in microflora colonization regulation Control inflammatory reaction Increase wound angiogenesis and collagen deposition | [55] | |
Nibea japonica | MCPs | Hydrolyzed with neutral protease | Increase the protein levels of NF-κB p65, IKKα and IKKβ Increase the expression of EGF, FGF, VEGF, and TGF-β | [56] | |
Theragra chalcogramma | PCP | Enzymolysis, ultrafiltration | Promote the expression of cytokines Increase wound healing rate, hydroxylproline content, collagen deposition and tensile strength | [57] | |
Theragra chalcogramma | FPP | Hydrolyzed with trypsin and alkaline protease | Promote the expression of cytokines Increase wound healing rate, hydroxylproline content, collagen deposition and tensile strength | [57] | |
Scorpions | Scorpion | SVAP | —— | Anti-inflammatory Anti-infective | [58] |
Tityus stigmurus. | Stigmurin | Synthetic peptides | Antioxidant Antibacterial | [59] |
Peptide | AA Sequences | Length (AA) | N-Modification | C-Modification | Disulfide Bond | Species | Ref. |
---|---|---|---|---|---|---|---|
Bv8-AJ | AVITGACERDVQCGGGTCCAVSLWMQGLRICTPLGRQGENCHPASRKVPFAGLRLHNSCPCQSNLACKTLPNGKYQCMPS | 81 | + | Amolops jingdongensis | [33] | ||
Bombesin | QRLGNQWAVGHLM | 13 | Pyr | Bombina bombina Bombina variegata Bombina orientalis | [99] | ||
Cathelicidin-DM | SSRRKPCKGWLCKLKLRGGYTLIGSATNLNRPTYVRA | 37 | + | Duttaphrynus melanostictus | [34,100] | ||
FW-1 | FWPLI | 5 | NH2 | Hyla annectans | [35] | ||
FW-2 | FWPMI | 5 | NH2 | Hyla annectans | [35] | ||
Cathelicidin-NV | ARGKKECKDDRCRLLMKRGSFSYV | 24 | + | Nanorana ventripunctata | [36] | ||
Antioxidin-NV | GWANTLKNVAGGLCKMTGAA | 21 | Nanorana ventripunctata | [37] | |||
OA-GL21d | GLLSGHYGRVVSTQSGHYGRG | 21 | Odorrana andersonii | [38] | |||
OA-GL12 | GLLSGINAEWPC | 12 | Odorrana andersonii | [39] | |||
OA-GL17 | GLFKWHPRCGEEQSMWT | 17 | Odorrana andersonii | [40] | |||
AH-90 | ATAWDFGPHGLLPIRPIRIRPLCG | 25 | Odorrana grahami | [41] | |||
CW49 | APFRMGICTTN | 11 | Odorrana grahami | [42] | |||
Cathelicidin-OA1 | IGRDPTWSHLAASCLKCIFDDLPKTHN | 27 | Odorrana margaretae | [44] | |||
Ot-WHP | ATAWDLGPHGIRPLRPIRIRPLCG | 24 | Odorrana tormota | [45] | |||
Brevinin-2Ta | GILDTLKNLAKTAGKGILKSLVNTASCKLSGQC | 33 | + | Pelophylax kl. Esculentus | [46] | ||
Brevinin-2PN | GLMDSLKGLAATAGKTVLQGLLKTASCKLEKTC | 33 | + | Pelophylax nigromaculatus | [47] | ||
PM-7 | FLNWRRILFLKVVR | 14 | Polypedates megacephalus | [48] | |||
RL-RL10 | RLFKCWKKDS | 10 | Rana limnocharis | [49] | |||
RL-QN15 | QNSYADLWCQFHYMC | 15 | + | Rana limnocharis | [50] | ||
Tylotoin | KCVRQNNKRVCK | 14 | + | Tylototriton verrucosus | [51] | ||
TK-CATH | GGQDTGKEGETGKKKKSDNWFMNLLNKFLELIGLKEAGDD SEPFCFTCIFDMFSQ | 55 | Tylototriton kweichowensis | [52] |
Signaling Pathway | Components |
---|---|
PI3K/AKT | EAP [30], ES2 [29], col4a1 [13], PvESII [28], Tylotoin [51], TK-CATH [52], AH-90 [41], Ot-WHP [45], Bv8-AJ [33], RL-QN15 [50], VTPY and VLLY [53], SCP [54] |
TGF-Beta | AH-90 [41], SNCP [3], Ot-WHP [45], RL-QN15 [50], PAE [19], Antioxidin-NV [37], OA-GL17d [80] |
NF-κB | AH-90 [41], Ot-WHP [45], FW-1 [35], FW-2 [35], MCPs [56] |
JAK/STAT | PAE [19] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Fan, X.; Ye, J.; Zhong, W.; Shen, H.; Li, H.; Liu, Z.; Bai, J.; Du, S. The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. Int. J. Mol. Sci. 2024, 25, 12561. https://doi.org/10.3390/ijms252312561
Fan X, Ye J, Zhong W, Shen H, Li H, Liu Z, Bai J, Du S. The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. International Journal of Molecular Sciences. 2024; 25(23):12561. https://doi.org/10.3390/ijms252312561
Chicago/Turabian StyleFan, Xiaoyu, Jinhong Ye, Wanling Zhong, Huijuan Shen, Huahua Li, Zhuyuan Liu, Jie Bai, and Shouying Du. 2024. "The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review" International Journal of Molecular Sciences 25, no. 23: 12561. https://doi.org/10.3390/ijms252312561
APA StyleFan, X., Ye, J., Zhong, W., Shen, H., Li, H., Liu, Z., Bai, J., & Du, S. (2024). The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. International Journal of Molecular Sciences, 25(23), 12561. https://doi.org/10.3390/ijms252312561