Next Article in Journal
DRB1, DRB2 and DRB4 Are Required for an Appropriate miRNA-Mediated Molecular Response to Osmotic Stress in Arabidopsis thaliana
Previous Article in Journal
NMDAR-CaMKII Pathway as a Central Regulator of Aggressiveness: Evidence from Transcriptomic and Metabolomic Analysis in Swimming Crabs Portunus trituberculatus
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review

by
Xiaoyu Fan
,
Jinhong Ye
,
Wanling Zhong
,
Huijuan Shen
,
Huahua Li
,
Zhuyuan Liu
,
Jie Bai
* and
Shouying Du
*
College of Traditional Chinese Medicine, Beijing University of Chinese Medicine, Beijing 102488, China
*
Authors to whom correspondence should be addressed.
Int. J. Mol. Sci. 2024, 25(23), 12561; https://doi.org/10.3390/ijms252312561
Submission received: 18 October 2024 / Revised: 15 November 2024 / Accepted: 21 November 2024 / Published: 22 November 2024
(This article belongs to the Section Molecular Biology)

Abstract

The skin is the first line of defense to protect the host from external environmental damage. When the skin is damaged, the wound provides convenience for the invasion of external substances. The prolonged nonhealing of wounds can also lead to numerous subsequent complications, seriously affecting the quality of life of patients. To solve this problem, proteins and peptide components that promote wound healing have been discovered in animals, which can act on key pathways involved in wound healing, such as the PI3K/AKT, TGF-β, NF-κ B, and JAK/STAT pathways. So far, some formulations for topical drug delivery have been developed, including hydrogels, microneedles, and electrospinning nanofibers. In addition, some high-performance dressings have been utilized, which also have great potential in wound healing. Here, research progress on the promotion of wound healing by animal-derived proteins and peptide components is summarized, and future research directions are discussed.

Graphical Abstract

1. Introduction

The skin, as the largest organ in the human body, is anatomically divided into three layers: the epidermis, dermis, and subcutaneous tissue [1]. It is the first line of defense to protect the host from external environmental damage and plays an important role in maintaining internal balance. Wounds open the door for foreign substances and organisms to enter the human body [2]. If wounds are not well cared for after injury, they can easily develop into chronic wounds (such as diabetic ulcers) [3], and large-scale loss of skin integrity may lead to serious disability or even life-threatening consequences [4]. However, skin damage is becoming increasingly common due to complications caused by burns, infections, scars, genetic diseases, and other diseases [5,6]. Approximately 2% of Americans suffer from chronic wounds, and the annual cost of wounds is as high as 28.1 billion to 96.8 billion dollars [7,8,9].
Skin wound healing refers to a series of dynamic and complex biological processes that restore normal structure and function [10]. The whole process involves four stages: blood clotting, inflammation, proliferation, and tissue remodeling [11]. It requires a variety of repair cells (keratinocytes, fibroblasts, endothelial cells, etc.), cytokines (epidermal growth factor (EGF), vascular endothelial growth factor (VEGF), granulocyte–macrophage colony-stimulating factor, etc.), and the extracellular matrix (ECM) [12]. Although wound healing is a spontaneous behavior of the body, the entire process is comprehensive and time consuming [13]. It may be affected by various factors, resulting in chronic wound healing retardation or delayed ulcer healing. Accelerating the wound healing process will significantly reduce the risk of wound infection [14]. This approach is not only beneficial for patients with severe skin damage caused by lacerations, burns, and accidental injuries but also has important value for the rapid recovery of postoperative patients [13]. Owing to the high morbidity and mortality rates associated with wounds worldwide, accompanied by high costs and low efficacy, wounds have caused severe economic and social damage.
Currently, treatment methods based on growth factors, cytokines, and cell therapy have been applied in the clinic [15]. However, these therapies still have significant shortcomings, such as the lack of long-term integration of cells, incomplete healing, and frequent occurrence of scar tissue. The high production cost makes protein drugs very expensive and difficult to afford. Moreover, they also have many disadvantages such as low stability, complex purification and expression processes, the burst release of wounds, immune rejection, and adverse side effects. At present, there is still a lack of effective wound treatments [15,16,17]. Moreover, with the increasing incidence and large economic burden of wounds, finding effective, economical, and practical drugs is urgently needed. Therefore, people have high expectations for developing drugs or effective treatment methods with potential for wound healing. With the goal of finding effective drugs, many researchers have shifted their attention to natural components [13,18,19], which hope to find natural products obtained from plants and animals as potential therapeutic drugs to accelerate wound healing [20,21].
At present, many active protein components (such as collagen peptides) obtained from animals have been shown to accelerate wound healing and prevent the formation of scars [3,22]. Because it comes from animal protein, it has the advantages of safety, reliability, and low price. Therefore, this article reviews the potential applications of animal proteins and peptide components in promoting wound healing from the perspectives of active components, sources, mechanisms, pathways of action, and related formulations Firstly, an overview of different categories of pro-healing proteins and peptides, animal sources, species, active ingredients, acquisition methods, and their effects on wound healing is shown in Table 1.

2. Components

2.1. Earthworm

Earthworms belong to the annelida phylum (in the animalia kingdom), are decomposers of ecosystems worldwide [60], and are among the earliest organisms on the phylogenetic tree. The coelomic fluid of earthworms is filled with 18 amino acids, fatty acids, microelements, lumbritin, lumbrofebrin, terrestrolum brolysin, purine, choline, cholesterin, and vitamins [61]. Many years ago, earthworms were used to treat various diseases [62]. The practice of extracting and using bioactive compounds from earthworms has widely circulated among indigenous peoples around the world, especially in Asia, including China, India, Myanmar, South Korea, and Vietnam [63]. As a Traditional Chinese Medicine, earthworms have significant medicinal value. The written records of the medicinal use of earthworms can be traced back to 1578 AD, and the medicinal methods of earthworms were recorded in detail in the Compendium of Materia Medica [64,65]. Previous studies have shown that earthworms have antiulcer [66], antioxidation [67], liver protection [68], anti-inflammatory [69], antibacterial [70], anticancer [71], antiapoptotic [72], anticoagulation, and fibrinolytic activities [73]. These properties and effects may contribute to the process of wound healing.
In recent years, with the continuous deepening of research on the ability of earthworms to promote wound healing, the study of their active ingredients has also been refined, from initial protein extracts to protein complexes with determined molecular weights. In addition to studying the whole body of earthworms, researchers have also studied the changes in bioactive components in the body of earthworms after amputation based on the characteristics of earthworm regeneration in order to further and comprehensively study the healing activity of earthworms.
A study of earthworm protein extracts revealed that the glycoprotein complex G90 [23] isolated from earthworm homogenate can improve the wound-healing activity of diabetic rats induced by alloxan, which may be due to increased proliferation of fibroblasts and epithelial cells. In addition, researchers have shown that G-90 has antioxidant, antibacterial and antimitogen activities, which are conducive to wound healing [74]. The biological activity of G-90 may be related to insulin-like growth factor, immunoglobulin-like growth factor [75], two serine peptidases encoding tyrosine [76,77] and EGF-like components [24].
The protein extract was further focused on extracts below 30 kd, and the extract EE [10] was studied through macroscopic observation and histopathological, blood, and immunohistochemical parameter determination methods. EE significantly shortened the wound healing time and reduced inflammation. The extraction method was further improved. After ultrafiltration, the precipitate was resuspended in phosphate-buffered saline and dialyzed to obtain an extraction solution, EE-1, with a protein concentration of 2.56 mg/mL [25]. EE-1 can promote deep second-degree burn wound healing, while the content of hydroxyproline in the skin reflects the collagen content [78], thereby reflecting the effect on the formation of scars [79]. These results show that, in addition to promoting wound healing, it can also accelerate the formation of collagen and ECM and reduce scar formation.
In addition to studying the whole body of earthworms, researchers have also studied the changes in bioactive components in the body of earthworms after amputation, based on the characteristics of regeneration after amputation. Earthworms can regenerate amputated parts of the body and stimulate the synthesis of EGF and VEGF. The effects of earthworms on promoting wound healing and reducing scar formation were significantly better than those of normal earthworms. The G-90′ [26] was extracted from the regenerated tissues of the earthworms after 3 days of tail amputation, after which three protein mixtures were isolated. ES2 promoted wound healing in vivo and in vitro. Its healing effect was significantly better than that of other protein mixtures. The functional proteins in ES2 were subsequently identified via the “bottom-up” proteomic analytic method. A total of 46 proteins were identified. Through cross-identification via LC–MS/MS and transcriptome analyses, 23 functional proteins were obtained. The better healing-promoting activity of earthworms after amputation may be related to the upregulation of the heat shock protein HSP70 and lysozyme genes, suggesting that the heat shock protein HSP70 and lysozyme are functional proteins in earthworms that promote wound healing [27]. A new collagen-like peptide, col4a1, from amputated earthworms was subsequently screened and identified via high-throughput techniques, including transcriptomics, proteomics, and mass spectrometry [13]. Col4a1 was cloned and expressed, and its effects on wound healing and mechanism were comprehensively explored. The results showed that it had a significant effect on wound healing both in vivo and in vitro. Col4a1 effectively enhanced the viability, proliferation, and migration of fibroblasts, the formation of granulation tissue, and the deposition of collagen.
At present, research on the active ingredients that promote wound healing in earthworms has focused mostly on mixtures. The active ingredient is a mixture of proteins and peptides. The simple extraction method leads to a complex composition of the active ingredients obtained. There are currently no reports on specific components, which may be related to the difficulty of further extraction, separation, and purification of proteins, as well as the poor activity of biosynthetic proteins. The inability to determine the specific ingredients presents certain difficulties for further pharmacological and formulation research, so further research on active ingredients is still needed.

2.2. Periplaneta

Periplaneta is one of the most famous health-related insects. It has strong vitality and reproductive ability and is widely distributed in subtropical and tropical regions around the world. Periplaneta americana (PA) is a species of Periplaneta, and an important Traditional Chinese Medicine that promotes blood circulation, eliminates purulent effects, and regulates immunity. Its medicinal components include mainly peptides, proteins, and polyols [80].
Physiological and pharmacological studies have shown that the components of PA have good tissue repair ability. A Traditional Chinese Medicine formulation called Kangfuxin (KFX) was developed from ethanol extracts from the dried body of PA and has been applied in the clinic. It is used to treat various types of injuries, such as burns, scalds, knife wounds, and other types of trauma and refractory ulcers, with significant clinical effects and wide applications.
The ethanol extract of PA (PAL) has been proven to promote wound healing [31,81]. As a marker of vascular endothelial cells, CD31 was specifically expressed [82]. Immunohistochemical results revealed CD31-specific staining was observed in the low- and medium-dose PAL groups. The collagen in each PAL dose group was relatively thick, which clearly distinguished the bundled collagen, and the regeneration and recombination ability of the collagen was better. The results showed that PAL had a certain anti-scar effect [83].
Further research was subsequently conducted on the two proteoglycan complexes, PaPPc2 and PaPPc3, obtained from PA [32,84]. The molecular conformation of PaPPc2 was dominated by the β-strand conformation, whereas that of PaPPc3 was dominated by random coils. PaPPc2 and PaPPc3 can be connected to polysaccharides through O-glycosidic bonds. Further research was subsequently conducted on the pharmacological effects of PaPPc2 and PaPPc3, both of which can promote endothelial cell differentiation, angiogenesis, and collagen synthesis and thus promote wound healing.
At present, although there are drugs with active extracts of PA in clinical application, relatively few studies have investigated their active ingredients. These studies have also focused mostly on the active extract. The products obtained through ethanol extraction [19,31,32] have not been further separated and purified, which also has problems such as complex components and unclear specific active ingredients that take effect.

2.3. Amphibians

Amphibians live in harsh and complex environments, requiring them to adapt to both marine and terrestrial environments. Exposed skin makes them vulnerable to microbes, ultraviolet radiation, and other types of injury [85]. Through long-term natural selection, amphibians have evolved unique and efficient skin peptide defense systems, mainly including antimicrobial peptides, antioxidant peptides, lectins, and protease inhibitors, which can play roles in antibacterial, antioxidant, and immune regulation [86,87,88,89,90,91,92,93,94]. Previous studies have shown that the skin of amphibians can repair itself quickly after injury [95,96]. Therefore, researchers have hypothesized and confirmed the existence of the necessary material basis for promoting wound healing in the skin [96,97,98]. There are various types of amphibians, and it has been proven that the skin secretions of various amphibians have strong healing-promoting activity.
Frogs are a species of amphibians whose ability to secrete active ingredients that promote wound healing has been extensively studied. Odorous frogs can secrete various bioactive peptides [90]. Several bioactive peptides [43,44] extracted from Odorrana Margaretae promoted wound healing in HaCaT cells and HSF cells in a time-dependent and dose-dependent manner and promoted wound healing in a mouse full-thickness skin wound model. The bioactive peptides extracted from Odorrana andersoni [39] also promoted wound healing in HaCaT and HSF cells in a time-dependent and dose-dependent manner. Moreover, it promoted wound healing in a dose- and time-dependent manner in a mouse full-thickness skin wound model while preventing the formation of chronic wounds and scars. Compared with existing small molecule compounds and growth-factor-based wound-healing drugs, it has obvious advantages. Extracting new short peptides from Pelophylax nigromaculatus can promote the migration of HSF cells and accelerate scratch healing in a time-dependent manner [47]. A new peptide was identified from the skin of Nanorana ventripunctata [36], which exhibited strong wound healing-promoting activity in a mouse dermal wound model. It can directly enhance the formation of glial cells, accelerate re-epithelialization at the wound site, and promote the formation of granulation tissue.
In addition to frogs, other amphibians still contain peptides that promote wound healing. TK-CATH was identified from Tylototriton kweichowensis [52]. It can effectively induce the production of a variety of cytokines, chemokines, and growth factors related to wound-healing activity in a mouse full-thickness wound model and accelerate skin wound healing. In addition, it also has strong anti-inflammatory activity. The results suggested that it may influence the inflammatory phase and the new tissue formation phase during wound healing [52].
In recent years, many reports have shown that peptides identified from amphibians significantly affect wound healing, as shown in Table 2. A summary analysis of these peptides reveals that most of them are polypeptides, with only two oligopeptides. The number of amino acids is concentrated between 10 and 30, but no similarities have been found in the amino acid composition. In terms of structural modification, seven peptides contain disulfide bonds in their structures, with fewer N-terminal and C-terminal modifications. Further research is needed on the relationship between its structure and bioactivity.
At present, most studies on amphibian extracts focus on peptides, and the research ideas are relatively systematic and complete. The research approach for peptides in these amphibians can be summarized as extraction, isolation, identification, synthesis, pharmacological, and mechanistic studies. Among them, peptides are separated mainly by gel permeation chromatography, reversed phase high-performance liquid chromatography RP-HPLC, and other methods. The structure of the peptide was subsequently identified via Edman degradation, mass spectrometry, Ladder sequencing, or cDNA sequencing. Finally, the target peptide was commercially synthesized through solid-phase synthesis and other methods. Next, its activity and mechanism were studied. The existing research directions focus mostly on antibacterial, anti-inflammatory, and antioxidant aspects. Although it has been proven to promote wound healing, its mechanism is still related to antibacterial, anti-inflammatory, or antioxidant effects. Its healing-promoting effect is mostly achieved by improving the microbial environment of the wound.

2.4. Marine Organisms

Marine organisms, such as fish, jellyfish, sponges, and other invertebrates, contain large amounts of collagen. As a significant source of collagen, marine organisms have greater advantages than other sources do, such as being metabolically compatible, being able to be utilized free from religious constraints, and being free of animal pathogens [101,102,103]. Moreover, marine organisms have abundant collagen resources and low prices, which are widely found in more than 20 million tons of byproducts, such as fish skin, heads, fins, and viscera [104]. Collagen, an important structural protein in the animal ECM and connective tissue, plays an important role in supporting the formation, tensile strength, and flexibility of joints [105,106,107,108]. Marine collagen can also reduce wrinkles, improve skin elasticity, and enhance the overall structure and appearance of the skin.
Active ingredients that promote wound healing have been found in various marine organisms, including Tilapia Piscidin [18], sea cucumber [53,54,109], Sipunculus nudus [3], Salmon sala [55], Nibea japonica [56], and Theragra chalcograma [57]. These ingredients have all been proven to promote cell migration and proliferation and have shown good performance in vivo. They can accelerate wound healing in mice, can even shorten scar formation and clearance times, and have a scar-free healing effect. They have good biological activity in promoting wound healing and inhibiting scar formation.
Some researchers have directly validated the effectiveness of fish skin collagen and its promoting effect on patients with venous leg ulcers (VLUs) through clinical trials [110]. Compared with the placebo group, the fish in the collagen gel group exhibited greater ulcer healing after administration and significantly improved the quality of life of patients. These findings indicate that fish collagen can indeed improve the condition of VLUs in patients and improve their quality of life.
There are rich and diverse marine species, and marine resources are also enormous. The ingredients that promote wound healing are also diverse. Research on the bioactive components of marine organisms that can promote wound healing has been continuously conducted, and many bioactive components of marine organisms have been proven to have significant effects on promoting wound healing. Marine collagen has been shown to promote skin re-epithelialization, vascularization, fibroblast migration, and healing ability. It even has the effects of increasing skin elasticity, reducing wrinkles, and preventing aging [111]. In recent years, promoting wound healing with natural products has become a trend. Although the healing-promoting active components from marine organisms have been shown to be fully applicable, they are still underutilized natural resources [112]. Therefore, future research on promoting wound healing in marine organisms should focus more on the full utilization of natural resources, in addition to bioactive components.

2.5. Scorpions

Scorpions are ancient chelators with a wide range of habitats [113]. Scorpion venom is a complex and abundant source of active substances. It is an important weapon used by scorpions to defend themselves, deter opponents, and catch prey [114]. Its abundant bioactive substances have also received widespread attention. Two scorpion venom peptides extracted from scorpion venom effectively shorten the wound healing time and have strong anti-inflammatory and antibacterial effects [58,59]. The good healing ability of these peptides is closely related to their antioxidant and antibacterial abilities.
According to the literature, studies on the activity of scorpion venom have focused mostly on insecticidal, antibacterial, antifungal, antiviral, antiparasitic, and antioxidant effects [115,116,117,118,119]. Few studies have investigated the promotion of wound healing [58,59]. However, these reports further improve the research on scorpion venom, suggesting that more attention can be paid to the wound-healing-promoting components in scorpion venom. It is interesting to note that the existing types of animals that have been found to contain protein or peptide components that promote wound healing have smaller body types and a weaker ability to cope with environmental changes. Perhaps this is also why they can secrete various protective ingredients, such as those that can be used to promote wound healing, to cope with harsh and complex living environments, repair damaged wounds, and maintain the stability of their internal environment.
In summary, the ingredients that promote wound healing in earthworms, PA, and marine organisms are mostly concentrated in the extract mixture, and their bioactive ingredients are mainly glycoprotein complexes or collagen. There is relatively few research on single protein components. The components of glycoprotein mixtures are complex and difficult to clarify. Collagen, the major protein in ECM [120,121], is involved mainly in the development and migration of cells and tissues [111,122]. In addition, it significantly improves the wound-healing process by stimulating and promoting the production of keratinocytes and fibroblasts near the wound [122]. Summarizing the existing research on protein monomer components that promote wound healing, only PvESII has been reported to have an accurate glycoprotein structure, with a unique structure such as the EGF domain [28], which is a growth factor analog that can bind to the epidermal growth factor receptor (EGFR). EGF is widely present in human and animal tissues and can promote or inhibit the growth of various cells. Epidermal cells, fibroblasts, and endothelial cells are all targeting cells of EGF. In acute trauma, EGF promotes the proliferation and migration of keratinocytes by regulating the expression of keratin 6 and keratin 16 in the keratinocyte proliferation signaling pathway [123]. It can promote wound regeneration and epithelialization and improve the tensile strength and tension of the wound. Owing to the presence of EGF-like domains, PvE-3 can also bind to EGFR, initiate wound-healing signals, and promote wound regeneration and epithelialization, and this mechanism of action is like that of current clinical treatment methods based on growth factors. There are also reports that proteins such as HSP70 and lysozyme promote healing, both of which are related to the endocytosis pathway and the process of endocytosis. However, their specific structure and active sites have not been elucidated [27].
The current lack of research on monomeric protein components may be due to the limited methods used to study protein components, the low separation efficiency, and the high cost. With the further development of biotechnology and in-depth research on the structure and function of various proteins, separation and purification technology for proteins has also rapidly developed. Commonly used techniques such as salting-out, isoelectric precipitation, organic solvent precipitation, dialysis, and ultrafiltration can separate proteins on a large scale. However, these technologies have the drawbacks of low resolution and high impurity content, requiring subsequent dialysis or ultrafiltration to remove salts or organic solvents. Chromatography and electrophoresis are high-precision separation methods that can further purify proteins, but they are difficult to use for large-scale separation because of limited sample processing. Therefore, it is difficult to obtain sufficient protein components that can be used for activity research. In addition to common separation and purification, biofermentation engineering or protein recombination technology can also be used to prepare proteins, but there are also different problems. Owing to the complexity of protein conformation and different conformations of carbohydrate chain modifications, most proteins produced by biofermentation have poor or no biological activity. Moreover, protein recombination technology has high costs and is difficult to promote further. Owing to limitations in protein separation and purification technology, it is difficult to obtain bioactive proteins from monomers. Therefore, current research on the ability of earthworms, PA, and marine organisms to promote wound healing has focused mostly on extracting mixtures and has not delved into monomer components.
The components that promote wound healing in amphibians and scorpions are mostly peptides with known amino acid sequences. The number of amino acids in these peptide segments ranges from 5 to 81, with the majority being less than 40. Two peptides have C-terminal modifications linked to -NH2. A peptide links -Pyr at the N-terminus. Seven peptides contain disulfide bonds, but no correlation between their structural characteristics and biological activity has yet been found. Compared with protein components, peptides have a simpler conformation, known amino acid sequence, smaller molecular weight, and lower production cost, which makes them potentially widely used in clinical practice. Moreover, the small molecular weight of peptides is more suitable for preparing skin wound formulations for topical administration through biological barriers. As external drugs, small-molecule drugs are more likely to reach higher concentrations in superficial tissues [123]. Moreover, peptides are more likely to maintain their natural structure through N-terminal acetylation or C-terminal amination, increasing their resistance to external enzymes [123]. In addition, cysteine residues can be cyclized by disulfide bonds, improving the stability of the peptide.

3. Mechanism

Skin wound healing involves a series of complex and continuous physiological processes, which are divided into four stages, blood clotting, inflammation, proliferation, and tissue remodeling [11], as shown in Figure 1. This process involves the activation of platelets, neutrophils, macrophages, endothelial cells, keratinocytes, and fibroblasts, as well as the secretion of growth factors, inflammatory factors, chemokines, and other substances [124]. Immediately after skin injury, hemostasis begins, including the vasoconstriction phase, thrombus formation phase, and blood clotting phase, which is the body’s first response to the wound to prevent bleeding and pathogen invasion. The characteristics of this process are vasoconstriction, platelet aggregation, and fibrin formation [125]. The inflammatory phase is subsequently activated by platelet aggregation and the release of inflammatory mediators. During the inflammatory phase, damaged cells guide neutrophils to enter the wound and kill pathogens by increasing damage-associated molecular patterns or by using signals such as hydrogen oxide and chemokines to form gradients [125]. Monocytes migrate to the wound, differentiate into macrophages, and begin to polarize. M1 macrophages promote inflammation, degrade and clear damaged tissue, and further stimulate neovascularization by secreting various chemokines, matrix metalloproteinases (MMPs), and other inflammatory mediators. M2 macrophages can promote the secretion of various growth factors, including VEGF and platelet-derived growth factor [126]. Macrophages also produce important signaling molecules, which subsequently activate keratinocytes, fibroblasts, and endothelial cells [127]. In the late stage of inflammation, T lymphocytes stop interferons-γ to regulate the inflammatory response and allow the wound to progress to the proliferative phase [128,129]. The proliferation phase is characterized by angiogenesis, fibroblast proliferation, myofibroblast differentiation, and collagen deposition. M1 macrophages transform into the M2 subtype and promote proliferation by secreting anti-inflammatory cytokines and collagen precursors, thereby stimulating fibroblast proliferation [130]. Fibroblasts and endothelial cells at the wound begin to proliferate and form ECM-filled granulation tissue, generating blood vessels and a new matrix to fill tissue defects. Keratinocytes proliferate and migrate to wounds, where they initiate epithelialization [30,131,132]. The proliferation phase mainly protects the wound by stimulating the formation of granulation tissue. The final stage of wound healing involves ECM healing and remodeling [133]. During the tissue remodeling phase, collagen fibers and excessive ECM are degraded [131]. This stage begins 2–3 weeks after the formation of the wound or within 1 year of wound formation. In the process of tissue remodeling, TGF-β1 signaling stimulates fibroblasts to differentiate into myofibroblasts, thereby producing type I and type III collagen. Collagen fibers are enhanced through cross-linking under the catalysis of transglutaminases and lysyl oxides. In the later stages of tissue remodeling, MMPs degrade type III collagen, leading to scar formation accompanied by abundant type I collagen [134]. In addition, in chronic wounds, bacteria often colonize microbial membranes to evade the host immune response and the effects of antibiotics. It can also reflexively induce the expression of inflammatory cytokines. Proteinase and reactive oxygen species (ROS) increase, and the degradation of the ECM and growth factors by proteases and ROS delays wound closure. Multiple cells and signaling pathways are involved in the complex process of skin wound healing. To summarize the mechanism of action of existing animal proteins and peptide active ingredients on wound healing, they act on different stages of wound healing through different pathways.

3.1. The TGF-Beta Pathway

The TGF-β signaling pathway is a complex, multifunctional pathway that regulates a variety of cellular processes, such as proliferation, differentiation, migration, apoptosis, and ECM synthesis [135]. The TGF-β signaling pathway is activated by cytokines, growth factors, or mechanical stress, which bind to TGF-β RII and then phosphorylate and activate TGF-β RI. TGF-β RI further activates Smad2/3 and interacts with Smad4. The Smad complex translocates to the nucleus and regulates the transcription of the integrin, E-cadherin, c-Myc, and IL-6 genes [136]. In the TGF-β family, TGF-β1 plays a dominant role in skin wound healing, mainly by mediating pathological healing, such as chronic inflammation and excessive scar formation [137]. During the inflammatory phase, platelets and white blood cells secrete TGF-β as a chemotactic factor, promoting fibroblast proliferation and migration to the wound site [138,139]. During the proliferation phase, TGF-β1 promotes the migration of keratinocytes, angiogenesis, and granulation tissue formation [138]. During the remodeling phase, TGF-β1 stimulates the differentiation of fibroblasts into myofibroblasts, promoting wound contraction and collagen production [140].
SNCP [3], obtained from marine organisms could downregulate the expression levels of TNF-α, IL-1β, TGF-β1, and TGF-β RII and upregulate the expression level of Smad7. TNF-α and IL-1β are important inflammatory factors and indicators of inflammatory response. Inflammation is necessary to resist the invasion of foreign pathogens and clear fragments of tissue, but excessive inflammation can cause damage to normal tissues and lead to fibrotic diseases [141]. Excessive inflammation during wound healing can lead to delayed healing and scar formation [142]. SNCP effectively shortens the inflammatory phase and has anti-inflammatory effects by significantly reducing the expression levels of TNF-α and IL-1β. In addition, TNF-α and IL-1β could dose-dependently reduce collagen synthesis. TNF-α could strongly promote the secretion of MMPs, degrade collagen, and block the mRNA transcription of type I/III pro-collagen [143]. TGF-β1 is an important driving factor in fibrosis and is associated with abnormal scar hyperplasia [144]. Downregulation of TGF-β1 and TNF-α by SNCP could effectively prevent scar hyperplasia. Smad7 is a negative-feedback-regulated inhibitory protein that strongly binds to TGF-βrI, inhibits Smad2/Smad3 phosphorylation, and blocks the TGF-β/Smads signaling pathway [145,146,147]. The TGF-β/Smads signaling pathway is an important pathway that affects scar formation and extracellular matrix deposition after trauma [148]. The significant upregulation of Smad7 expression level inhibits and blocks the TGF-β/Smads signaling pathway. This is also the reason SNCP regulates collagen formation and remodeling and inhibits scar hyperplasia. Therefore, SNCP mainly accelerates the process of wound healing by anti-inflammatory activity and regulates collagen formation and remodeling, affecting the inflammatory, proliferation, and remodeling phases.
The peptide AH-90 [41] obtained from amphibians could promote the expression of TGF-β1, phosphorylated Smad3, and α-SMA, but does not cause upregulation of pro-inflammatory factors such as IL-6 and TNF-α. The results showed that AH-90 could dose-dependently upregulate the expression of TGF-β1. TGF-β1 upregulates the expression of α-SMA by phosphorylating Smad3 [149]. The expression of α-SMA is an important characteristic of fibroblast differentiation into myofibroblasts [150]. The transformation from fibroblasts to myofibroblasts is also an important step in skin healing [151]. Therefore, AH-90 further upregulated the levels of phosphorylated Smad3 and α-SMA by promoting the expression of TGF-β1. Then, it activated the TGF-β pathway to promote the proliferation of myofibroblasts, accelerated the process of wound re epithelialization in mice, and caused faster contraction of granulation tissue compared to the control group. The histological section also confirmed this phenomenon. The expression levels of IL-6 and TNF-α were not affected, indicating that AH-90 activated the TGF-β signaling pathway and promoted wound re-epithelialization and granulation tissue contraction by TGF-β1 but did not cause prolonged activation of the inflammatory phase. On the contrary, the control group was still in the inflammatory phase at this time, and there was still thick granulation tissue on the wound site in the mice.

3.2. The PI3K/AKT Pathway

The PI3K/AKT pathway is one of the most important pathways in wound healing and includes the MAPK signaling pathway, the VEGF signaling pathway, the mTOR signaling pathway, etc. This pathway is closely related to the formation of the epidermal barrier, collagen synthesis, and angiogenesis [152,153]. It is also an important factor involved in the process of acute wound healing and maintaining tissue homeostasis [154]. AKT is a serine/threonine kinase that is an important signaling center for various cellular functions. PI3K-dependent AKT activation further affects the activity of downstream pathways, such as proliferation, angiogenesis, aging, regulation, and cell survival [155,156]. The PI3K/AKT pathway is initiated by the binding of cytokines and growth factors to receptor tyrosine kinases (RTKs) [157]. RTKs activate PI3K and further activate AKT. AKT phosphorylation leads to the activation of mTOR C1, which in turn promotes the translation of several RNA transcripts that promote migration and proliferation, regulate the cell cycle, and affect the process of wound healing. During the process of wound healing, the PI3K/AKT signal is involved in mainly the inflammatory and proliferative phases, which can promote epithelial to mesenchymal transition, cell proliferation, and angiogenesis and reduce the inflammatory response [158,159,160,161]. At present, some animal proteins and peptide components have been proven to be related to the PI3K/AKT pathway in promoting wound healing.
The collagen-like peptide col4a1 [13] obtained from earthworms could bind with integrin α2β1 to activate downstream RAS/MAPK signaling pathways, significantly increasing the expression of collagen I and III and elastin at the wound site. Collagen, as the main protein in ECM, has been shown to accelerate chronic wound healing [120,121]. In most cases, the role of collagen in the healing process is to attract fibroblasts and other cells, providing a natural scaffold or matrix for newly formed tissue [121,162]. The centripetal displacement at the edge of the wound serves as a marker of the healing and proliferation stage, requiring activation and migration of fibroblasts and a large amount of deposited ECM to the damaged tissue [163]. The mice in the col4a1 treatment group showed significantly accelerated wound healing and fibroblast recruitment, which was consistent with the high expression of collagen I and III at the wound site, indicating that col4a1 promotes healing by acting on the proliferative and remodeling phases of wound healing.
In addition, besides earthworms, Bv8-AJ [33] was a peptide identified from amphibian secretions, which also promoted cell proliferation and wound healing through the MAPK signaling pathway. Bv8-AJ could activate the phosphorylation of ERK, JNK, and p38 in KC cells in a dose-dependent manner, thereby activating the MAPK pathway and promoting the secretion of IL-1α and IL-1β. The IL-1 signaling pathway is a key pathway for controlling the proliferation of keratinocytes and fibroblasts. IL-1 activates the expression of mitotic factors by activating the peroxisome proliferator-activated receptor β/δ in fibroblasts [164], thereby directly promoting the proliferation of keratinocytes and fibroblasts and ultimately accelerating the beginning and end of the inflammatory phase. This result was consistent with the histopathological section results. Compared with the control group, the Bv8-AJ group showed earlier infiltration of inflammatory cells and earlier reduction in inflammatory cell infiltration. This indicated that Bv8-AJ promotes wound healing by shortening the inflammatory phase.

3.3. The NF-Kappa B Signaling Pathway

The NF-kappa B signaling pathway is a typical pro-inflammatory signaling pathway. During the wound healing process, it mainly acts on the inflammatory phase through its anti-inflammatory and antioxidant effects, improving the inflammatory microenvironment of the wound or promoting wound healing through the regulation of the immune system [165]. NF-kappa B, an inducible transcription factor, is present in all types of nucleated cells [166]. It regulates the expression of MMPs by activating innate immune responses, cell proliferation, and cell migration. The promotion of wound healing promotes the secretion and stability of cytokines, chemokines, adhesion molecules, growth factors, and pro- or antiapoptotic proteins [165,167,168]. The NF-kappa B signaling pathway functions through two main signaling pathways. The typical (classical) pathway is activated by stimuli such as cytokine receptors, tumor necrosis factor receptors (TNFRs), pattern recognition receptors, T-cell receptors, and B-cell receptors [169]. The atypical (alternative) pathway is activated by a subset of the TNFR superfamily [170]. Among these pathways, the typical pathway is often closely related to wound injury.
SCPs [55] are collagen peptides isolated from marine organisms, which promote the NF-κB signaling pathway by upregulating the secretion of NOD12 and BD14, thereby promoting wound healing. The results of a previous study showed that SCPs could significantly promote NOD2 secretion. NOD2 is closely related to cutaneous microbial colonization, and cutaneous microbial colonization is believed to rigorously regulate the innate immune response of the wound-healing process [164,171,172]. The NOD2/NF-κB pathway plays a crucial role in innate immune regulation [173]. Compared with the control group, the SCPs group showed an increase in NOD2 content at the wound site and a significant change in the wound microbiota. The changes in microbiota further lead to changes in wound immune response. NOD2 undergoes a cascade reaction upon exposure to harmful bacterial stimulus, inducing activation of the NF-κB pathway, immune system, and antibacterial response, such as the release of antibacterial peptide (AMP) [56,174]. After treatment with SCPs, one of the classic members of the AMP family, BD14, significantly increased. BD14 can further regulate the microbial community of wounds [172]. The changes in wound microbiota caused alterations in the levels of inflammatory factors between the SCPs-treated group and the control group, altering the process of wound healing. Ultimately, SCPs upregulate NOD12 to regulate the NF-κB pathway and promote BD14 secretion, thereby controlling the inflammatory phase, increasing angiogenesis and collagen deposition, and promoting wound healing.

3.4. The JAK/STAT Signaling Pathway

The JAK/STAT signaling pathway is a key pathway that mediates cellular responses to various cytokines and growth factors (such as interleukins, interferons, and colony stimulating factors). The JAK/STAT pathway is involved in regulating various aspects of wound healing, such as inflammation, angiogenesis, ECM formation, and cell proliferation and migration [175]. After the binding of cytokines and growth factors to their specific receptors, the phosphorylation of JAKs and STATs activates the JAK/STAT signaling pathway. Phosphorylated STATs then dimerize and are translocated to the nucleus, where they regulate the transcription of target genes [176]. However, this pathway requires strong cellular control, and its loss of control can lead to chronic inflammation [177]. Therefore, in the healing of chronic wounds, normal regulation of the JAK/STAT pathway is particularly important, as it is one of the main signaling pathways involved in the use of growth factors and cytokines [178].
The extract PAE [19] from cockroaches could significantly upregulate the expression levels of p-JAK1, p-JAK2, and their downstream molecule p-STAT3 in both in vitro and in vivo experiments. p-Smad3 was also significantly increased, which promoted healing by activating the JAK/STAT3 signaling pathway. Compared with the control group, the PAE group showed significant fibroblast proliferation and fibrosis, leading to the formation of scar tissue. Histopathological analysis revealed an increase in epithelial repair, follicle regeneration, and additional fibrous tissues in the PAE-treated groups. It showed a significant increase in the wound healing rate compared to the control group.
Although different components act on different targets at different stages of wound healing, they mainly focus on these four pathways. The different pathways through which animal proteins and peptides promote wound healing in existing reports is summarized in Table 3. There is a crosstalk interrelationship between these four pathways, as shown in Figure 2.
Summarizing the existing research, it could be found that the mechanism of animal protein and peptide components was mostly focused on the PI3K/AKT pathway, among which MAPK was currently the most studied pathway in wound healing. This pathway is one of the most important pathways in the wound-healing process, closely related to the formation of the epidermal barrier, collagen synthesis, and angiogenesis [152,153]. It is an important factor involved in acute wound healing and maintaining tissue homeostasis [154]. In future research, it is suggested to focus on the effects of bioactive proteins or peptides on the PI3K/AKT pathway. In addition, related upstream and downstream pathways can be studied to comprehensively elucidate the healing activity and mechanism of the components.

4. Formulation and Dressing

Owing to their instability, proteins and peptide components are highly susceptible to inactivation by pH or various enzymes during systemic administration. When administered orally, they often face the influence of gastrointestinal breakdown or first-pass effects, and when administered by injection, they may be inactivated, owing to their susceptibility to various enzymes and receptors in the blood. Therefore, when protein and peptide components are used to treat skin injuries, topical administration can effectively avoid the problem of protein inactivation, making topical administration a more efficient and appropriate method. Compared with systemic administration, topical administration has significant advantages, as it can directly target the affected area, minimize systemic drug exposure, and, consequently, reduce systemic side effects. At the same time, it can also avoid the liver first-pass effect [179,180,181]. Topical administration can also achieve painless administration and improve compliance for patients with swallowing difficulties, making it more convenient. However, topical administration also faces other challenges, such as the need for repeated administration due to the short stay time at the affected site, the possibility of patient allergies caused by dressings, poor biocompatibility, skin barrier damage leading to transdermal water loss and increased inflammation, susceptibility to secondary infections, fast degradation rate, and poor stability [182,183,184,185,186,187]. Therefore, to solve such problems, various safe and effective formulations have been gradually studied, attempting to improve the wound microenvironment, increase drug retention time, and block microbial invasion.

4.1. Hydrogel

Gel is the most common formulation of animal protein and peptide components used to promote wound healing. It has received increasing attention as a wound dressing. As physical and chemical crosslinking agents with a 3D polymer material network, hydrogels can provide an ideal environment for wound healing.
Hydrogels can provide a moist environment at the wound site, helping to absorb the wound exudate without autolysis. Moreover, they have a high water-holding capacity, do not penetrate bacteria, prevent a large amount of exudation from accumulating on the wound, and provide a suitable growth environment for tissue regeneration. They also allow for gas exchange and can carry and control the release of bioactive molecules. Hydrogels have potential advantages in acute and chronic wound healing [188,189,190,191]. Hydrogels can be prepared by the physical and chemical crosslinking of nanoparticles, nanofibers, and other bioactive compound mixtures in a precursor solution [192]. Active ingredients can be directly loaded on hydrogel materials [193] or loaded on hydrogel materials in the form of nanocrystals [194], microspheres [195], nanoparticles [196], or nanosheets [197]. Moreover, gel materials can be modified accordingly to achieve temperature, pH, light, and other targeting effects. Hydrogels are good drug delivery carriers.
Chen [198] et al. blended polyvinyl alcohol, hydroxypropyl chitosan, and carbomer as materials and glycerin as a plasticizer to embed PA extract in a hydrogel film (PAE/film) via the solution cast method. The prepared PAE/film significantly accelerated the wound healing process in both full-thickness skin defects and scale wound model mice. During the entire experiment, compared with those of the other treatment groups, the wound area was significantly reduced, and the re-epithelialization rate was significantly increased, demonstrating a superior ability to promote wound healing. Its ability to promote healing is closely related to the superior water absorption and permeability of the hydrogel materials. It can effectively absorb wound exudate without autolysis. The high water-holding capacity of this material prevents the accumulation of a large amount of exudate on the wound bed, providing a suitable growth environment for tissue regeneration.
In addition, as physical and chemical crosslinkers with three-dimensional network structures, hydrogels can carry different peptides at the same time to play a synergistic role. Because wounds easily cause bacterial colonization and the formation of microbial membranes to delay wound healing, they can also promote wound healing through the formulation of hydrogels combined with active peptides and antibacterial peptides. Feng [199] et al. extracted collagen from marine fish scales and mixed it with sodium alginate, polymyxin B sulfate, and antimicrobial peptides to prepare a hydrogel dressing. The prepared hydrogel can effectively inhibit Escherichia coli and Staphylococcus aureus, accelerate reepithelization, collagen deposition, and angiogenesis to promote full-layer wound healing in a rat model and effectively ameliorate the bacterial infection problem that easily occurs in skin wounds.

4.2. Microneedles

Microneedles (MNs) are a new type of physical penetration enhancement technology that can directly bypass the stratum corneum and enter the epidermis/dermis to deliver drugs without contacting blood vessels or painful neurons. It has many advantages, such as no pain, minimal invasiveness, simple production, and convenient administration [200,201,202]. It has unique advantages in wound healing and tissue regeneration. The tips of MNs can easily pass through the physical barrier of the wound site, such as blood clots, scars and exudates, and continuously release the drug, which can greatly improve the efficacy of drugs [203]. In addition, it also provides natural mechanical stimulation for tissue regeneration during wound healing. Through tissue penetration and mechanical stimulation, collagen deposition and reorganization are induced [203,204]. MN arrays can support the insertion area and change the local stress environment [205]. These effects are beneficial for reducing scar formation during wound healing. MNs allow for the loading of a wide range of drugs [206,207] and can overcome the drug resistance of biofilms in the wound bed [208]. MNs have developed into various forms, such as solid MNs, coated MNs, hollow MNs, dissolvable MNs, and swelling MNs [209]. Drugs can be loaded directly into the internal channels of hollow MNs in liquid [210], can be made into nanocrystals [211], or can be directly encapsulated in microspheres [212] and polymer micelles [213] and then loaded onto MNs. Alternatively, drugs can be loaded onto nanoparticles and added to MN patches [214]. Nanoparticles can also be used as reinforcing agents and cross-linking centers to make hydrogel MN patches, further enhancing the targeting of the preparation [215]. As a formulation method, MNs can achieve the goals of targeting, sustained release, and prolonging the residence time of the affected area through various forms of formulation. It is a good carrier for healing drug formulations.
Yu [216] et al. established a multifunctional MN patch by investigating the electrostatic and hydrogen bonding interactions between Kang Fuxin, chitosan, and fucoidan MNs (KCFMN). KCFMN has good biocompatibility and antibacterial ability and can penetrate the stratum corneum of rat skin, promote the penetration of KFX, overcome the problem of low transdermal penetration efficiency of traditional drugs, and promote full-layer wound healing in rats by reshaping epithelial tissue. Its healing-promoting activity was significantly greater than that of the KFX group that was directly treated. Therefore, MNs, as a formulation method, can effectively improve the efficiency of healing and are good carriers for promoting the healing of drug formulations, with great application prospects.

4.3. Electrospinning Nanofibers

Electrospinning is a common method for preparing nanofiber membranes. The prepared nanofibers have the advantages of a larger surface area-to-volume ratio, smaller pore size, and higher porosity, which allows for better absorption of exudate, improves wound penetration, and prevents infection [217]. It can also adapt to different wounds through customized structures and directly disperse drugs into various polymers to form ultrafine nanofiber structures, which can act as temporary barriers instead of damaging the skin. It can respond well to various complex diabetes wounds. Moreover, it has good biodegradability and is an ideal way to prepare wound scaffolds [218]. Its low cost and high formulation efficiency can meet the needs of industrial production [219].
Larijani et al. [220] developed an electrospinning collagen scaffold using collagen, which could be used to improve the physical and biological properties of wounds. The prepared formulation had good cell compatibility and superior mechanical properties, biological properties, and wound-healing ability. In the process of wound healing in diabetic rats, it significantly improved the tissue structure of the wounds and the wound healing rate.
At present, few studies have used electrospinning technology to prepare animal proteins or peptides into nanofiber membranes for wound healing, but it has been proven that this technology can be used for the formulation of protein and peptide formulations. Moreover, its customizability, biodegradability, and skin barrier similarity make it a prominent advantage in treating various types of difficult-to-heal and chronic wounds. Therefore, electrospinning nanofiber membranes is an ideal platform and a promising wound dressing for wound-healing applications [221].

4.4. Others

In addition to existing reports on the preparation of animal proteins and peptides into various formulations, there are other formulations and dressings that have great potential in wound healing and have attracted attention. These formulations have their own advantages and features, which are summarized in Table 4.
In recent years, various formulations and dressings have been continuously updated, and various intelligent nano formulation systems have also been widely reported. An ideal wound dressing should have good biocompatibility, protect the wound bed, maintain wound hydration, allow for gas exchange with the environment, remove excess exudate, physically protect against microorganisms, and possess specific mechanical properties such as flexibility [222]. According to this standard for evaluation, various formulations and dressings have their own advantages and features. As a means for bioactive components to better exert therapeutic effects, formulations and dressings can be selected according to the physical and chemical properties of the bioactive components and the characteristics of the target disease so that the formulation can better serve the efficacy of the drug.
Table 4. Comparison of the performance of different formulations and dressings.
Table 4. Comparison of the performance of different formulations and dressings.
Formulation or DressingBiocompatibilityImprove
Penetration
Allow for Gas
Exchange
Against
Microorganisms
Control
Drug Release
Targeted Drug DeliveryOthersRef.
hydrogel++++++ [189,190,191]
microneedles ++++Bypass the stratum corneum and enter the epidermis/dermis layer
Natural mechanical stimulation induces collagen deposition and recombination
Change the local stress environment
Anti scar treatment
[201,202,203,204,205]
electrospinning
nanofibers
++++ Customized structure to adapt to different wounds
Replace damaged skin as a temporary barrier
[218]
nanoparticles ++Packaged in other dressings to make formulations
Some types of nanoparticles have antibacterial properties
[223,224,225,226]
microparticles++ + Packaged in other dressings to make formulations[227,228,229,230]
membranes ++ Easy to use
Allow for inspection of the wound bed without removing the dressing
[231,232,233]
silk fibroin++++ Customized into complex structures to ensure specific requirements
Regulate cell proliferation and migration during inflammation
[234,235,236]
sponges + Multi-porous material support that can restore its shape after mechanical compression or stretching[237]
foam ++ Fix the dressing on the affected area
Painless removal
[232,238,239]

5. Discussions

Skin injury, as a common disease, especially the persistent skin damage caused by various chronic diseases, seriously affects people’s quality of life and even endangers human safety, and it has received widespread attention. In summary, existing research on protein bioactive compounds has mostly focused on bioactive parts, with limited research on individual components. Owing to the complex composition of the active part, there may be side effects and adverse reactions caused by heteroproteins, heteropeptides, or other unknown components, which pose significant challenges for subsequent formulation research. In subsequent formulation research, selecting appropriate indicators for characterization and evaluation of the formulation is difficult, and ensuring the uniformity and stability of the formulation quality is also impossible. In this literature review, we found that there was indeed limited research on this topic. Moreover, in clinical applications, because its impurity components may cause side effects and adverse reactions, it also presents great challenges for quality control, consistency between batches, and the standardization of production, which affects its clinical application. Therefore, follow-up studies should focus on monomer composition as much as possible and develop it into safe, economical, effective, and convenient modern formulations for clinical application. However, considering the low efficiency of extraction, separation, and purification in the study of protein components, it is difficult to clarify the composition of protein extracts. Moreover, protein synthesis is difficult and costly. Obtaining a single protein becomes a challenge. To solve these problems, it may be necessary to improve protein separation and purification or synthesis technologies. Moreover, the inherent instability of proteins also requires the use of formulation methods and special administration methods to deliver drugs to the target site while preventing protein denaturation. Of course, this issue is also one of the difficulties and key points that all protein drug research institutes must face.
Although it is easier to obtain a single component from peptides than from proteins, there are still some obstacles that need to be faced when applying peptides in clinical practice, such as toxicity and stability issues. The toxicity of peptides can be mainly divided into three categories: cytotoxicity (general), hemolytic (toxic to red blood cells), and immunotoxicity (regulating immune responses in an undesirable way) [240]. At the same time, peptide components also face the unstable properties that protein components need to face, such as short half-life, limited oral availability, and susceptibility to plasma degradation [241]. In response to these issues, in addition to conventional methods such as testing toxicity, formulation methods, or adjusting administration methods to improve stability, computer-aided drug design and artificial intelligence can also be used for early prediction to minimize risks during the screening stage of bioactive peptides. With the continuous development of computers and artificial intelligence, computing tools have changed pharmaceuticals at an astonishing speed [242,243]. There have emerged some models and algorithms that can be used to predict peptide toxicity, and peptides with ideal properties can be designed through model building methods, which have great potential in peptide science and computer-aided drug design. These methods have great practicality in accelerating the discovery and application of peptide drugs [244,245].
In addition, during the review process, it was found that some peptides not only promote wound healing but also have antibacterial effects, commonly found in extracts of amphibians. There have also been detailed studies reporting on how to regulate the wound microbiota through antibacterial forms, improve the microenvironment, and thereby affect the secretion of cytokines, adjusting the wound-healing process [56]. This type of dual-acting peptide has unique advantages in the field of wound healing, as it can promote wound healing while being antibacterial, effectively resist microbial invasion, and prevent repeated infections. This multifunctional peptide is attractive due to its unique biological activity and has made some progress [246]. In future research, particular attention can also be paid to multifunctional peptides.
The current research on the mechanism of action is relatively limited and often focuses on a certain signaling pathway. There has been little comprehensive research on the upstream- and downstream-related pathways and their underlying mechanisms of action. However, wound healing is a complex process involving cell proliferation, migration, matrix synthesis, and contraction, which requires the participation of multiple types of cells and pathways. The promotion of wound healing should also be the result of synergistic effects of multiple cells and pathways. Therefore, in addition to focusing on a single pathway, systematic research should be conducted to illustrate the entire process of the component’s action in vivo, guiding more scientific clinical medication.
Finally, topical administration is a common method for treating wounds. Topical administration can greatly avoid the problem of protein and peptide degradation, but it also faces issues such as short wound retention rate. But the continuous innovation of formulation methods and dressings provide more selectivity and possibility for the carrier of wound healing. When choosing the formulation method, it is not only limited to the existing common formulation methods, but suitable formulations can also be selected based on the physical and chemical properties of the active substance and the characteristics of the disease to better serve the drug and further improve its healing effect. In addition, it is also possible to co-load antibacterial ingredients through formulation methods to improve the phenomenon of delayed wound healing caused by bacterial infection in chronic wounds and further improve the efficiency of healing to help humanity overcome the difficult problem of wound healing as soon as possible.

Author Contributions

Conceptualization, J.B.; methodology, X.F.; formal analysis, J.Y., W.Z. and H.S.; resources, H.L. and Z.L.; writing—original draft preparation, X.F.; writing—review and editing, J.B. and S.D.; funding acquisition, J.B. and S.D. All authors have read and agreed to the published version of the manuscript.

Funding

Funding for this work was supported by the National Natural Science Foundation of China (NNSFC) (grant number 82173990); National Administration of Traditional Chinese Medicine High level Construction Discipline (grant number zyyzdxk-2023272).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Falcone, M.; Meier, J.J.; Marini, M.G.; Caccialanza, R.; Aguado, J.M.; Del Prato, S.; Menichetti, F. Diabetes and acute bacterial skin and skin structure infections. Diabetes Res. Clin. Pract. 2021, 174, 108732. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Hameedaldeen, A.; Liu, J.; Batres, A.; Graves, G.S.; Graves, D.T. FOXO1, TGF-β regulation and wound healing. Int. J. Mol. Sci. 2014, 15, 16257–16269. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Lin, H.; Zheng, Z.; Yuan, J.; Zhang, C.; Cao, W.; Qin, X. Collagen Peptides Derived from Sipunculus nudus Accelerate Wound Healing. Molecules 2021, 26, 1385. [Google Scholar] [CrossRef] [Scilit]
  4. Singer, A.J.; Clark, R.A.F. Cutaneous Wound Healing. N. Engl. J. Med. 1999, 341, 738–746. [Google Scholar] [CrossRef] [Scilit]
  5. Woo, K.; Santamaria, N.; Beeckman, D.; Alves, P.; Cullen, B.; Gefen, A.; Lázaro-Martínez, J.L.; Lev-Tov, H.; Najafi, B.; Sharpe, A.; et al. Using patient-reported experiences to inform the use of foam dressings for hard-to-heal wounds: Perspectives from a wound care expert panel. J. Wound Care 2024, 33, 814–822. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Martinengo, L.; Olsson, M.; Bajpai, R.; Soljak, M.; Upton, Z.; Schmidtchen, A.; Car, J.; Järbrink, K. Prevalence of chronic wounds in the general population: Systematic review and meta-analysis of observational studies. Ann. Epidemiol. 2019, 29, 8–15. [Google Scholar] [CrossRef] [Scilit]
  7. Olsson, M.; Järbrink, K.; Divakar, U.; Bajpai, R.; Upton, Z.; Schmidtchen, A.; Car, J. The humanistic and economic burden of chronic wounds: A systematic review. Wound Repair Regen. 2019, 27, 114–125. [Google Scholar] [CrossRef] [Scilit]
  8. Cerutti, C.; Ridley, A.J. Endothelial cell-cell adhesion and signaling. Exp. Cell Res. 2017, 358, 31–38. [Google Scholar] [CrossRef] [Scilit]
  9. Han, J.; Shuvaev, V.V.; Muzykantov, V.R. Catalase and superoxide dismutase conjugated with platelet-endothelial cell adhesion molecule antibody distinctly alleviate abnormal endothelial permeability caused by exogenous reactive oxygen species and vascular endothelial growth factor. J. Pharmacol. Exp. Ther. 2011, 338, 82–91. [Google Scholar] [CrossRef] [Scilit]
  10. Deng, Z.H.; Yin, J.J.; Luo, W.; Kotian, R.N.; Gao, S.S.; Yi, Z.Q.; Xiao, W.F.; Li, W.P.; Li, Y.S. The effect of earthworm extract on promoting skin wound healing. Biosci. Rep. 2018, 38, BSR20171366. [Google Scholar] [CrossRef] [Scilit]
  11. Pattanayak, S.P.; Sunita, P. Wound healing, anti-microbial and antioxidant potential of Dendrophthoe falcata (L.f) Ettingsh. J. Ethnopharmacol. 2008, 120, 241–247. [Google Scholar] [CrossRef] [Scilit]
  12. Martin, P.; Nunan, R. Cellular and molecular mechanisms of repair in acute and chronic wound healing. Br. J. Dermatol. 2015, 173, 370–378. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Du, C.; Li, Y.; Xia, X.; Du, E.; Lin, Y.; Lian, J.; Ren, C.; Li, S.; Wei, W.; Qin, Y. Identification of a novel collagen-like peptide by high-throughput screening for effective wound-healing therapy. Int. J. Biol. Macromol. 2021, 173, 541–553. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Jing, J.; Sun, X.; Zhou, C.; Zhang, Y.; Shen, Y.; Zeng, X.; Yue, B.; Zhang, X. Cloning, Expression and Effects of P. americana Thymosin on Wound Healing. Int. J. Mol. Sci. 2019, 20, 4932. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Dreifke, M.B.; Jayasuriya, A.A.; Jayasuriya, A.C. Current wound healing procedures and potential care. Mater. Sci. Eng. C Mater. Biol. Appl. 2015, 48, 651–662. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Peng, L.H.; Huang, Y.F.; Zhang, C.Z.; Niu, J.; Chen, Y.; Chu, Y.; Jiang, Z.H.; Gao, J.Q.; Mao, Z.W. Integration of antimicrobial peptides with gold nanoparticles as unique non-viral vectors for gene delivery to mesenchymal stem cells with antibacterial activity. Biomaterials 2016, 103, 137–149. [Google Scholar] [CrossRef] [Scilit]
  17. Peng, L.H.; Niu, J.; Zhang, C.Z.; Yu, W.; Wu, J.H.; Shan, Y.H.; Wang, X.R.; Shen, Y.Q.; Mao, Z.W.; Liang, W.Q.; et al. TAT conjugated cationic noble metal nanoparticles for gene delivery to epidermal stem cells. Biomaterials 2014, 35, 5605–5618. [Google Scholar] [CrossRef] [Scilit]
  18. Liu, C.W.; Hsieh, C.Y.; Chen, J.Y. Investigations on the Wound Healing Potential of Tilapia Piscidin (TP)2-5 and TP2-6. Mar. Drugs 2022, 20, 205. [Google Scholar] [CrossRef] [Scilit]
  19. Song, Q.; Xie, Y.; Gou, Q.; Guo, X.; Yao, Q.; Gou, X. JAK/STAT3 and Smad3 activities are required for the wound healing properties of Periplaneta americana extracts. Int. J. Mol. Med. 2017, 40, 465–473. [Google Scholar] [CrossRef] [Scilit]
  20. Jarić, S.; Kostić, O.; Mataruga, Z.; Pavlović, D.; Pavlović, M.; Mitrović, M.; Pavlović, P. Traditional wound-healing plants used in the Balkan region (Southeast Europe). J. Ethnopharmacol. 2018, 211, 311–328. [Google Scholar] [CrossRef] [Scilit]
  21. Agyare, C.; Boakye, Y.D.; Bekoe, E.O.; Hensel, A.; Dapaah, S.O.; Appiah, T. Review: African medicinal plants with wound healing properties. J. Ethnopharmacol. 2016, 177, 85–100. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Zhang, Z.; Wang, J.; Ding, Y.; Dai, X.; Li, Y. Oral administration of marine collagen peptides from Chum Salmon skin enhances cutaneous wound healing and angiogenesis in rats. J. Sci. Food Agric. 2011, 91, 2173–2179. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Goodarzi, G.; Qujeq, D.; Elmi, M.M.; Feizi, F.; Fathai, S. The effect of the glycolipoprotein extract (G-90) from earthworm Eisenia foetida on the wound healing process in alloxan-induced diabetic rats. Cell Biochem. Funct. 2016, 34, 242–249. [Google Scholar] [CrossRef] [Scilit]
  24. Grdisa, M.; Popović, M.; Hrzenjak, T. Stimulation of growth factor synthesis in skin wounds using tissue extract (G-90) from the earthworm Eissenia foetida. Cell Biochem. Funct. 2004, 22, 373–378. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. He, M.; Xie, W.Q.; Cheng, G.; Li, W.P.; Yu, D.J.; Jin, H.F.; Deng, Z.H.; Li, Y.S. The therapeutic effects of earthworm extract on deep second-degree burn wound healing. Ann. Palliat. Med. 2021, 10, 2869–2879. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Yang, Y.; Hu, H.; Wang, W.; Duan, X.; Luo, S.; Wang, X.; Sun, Y. The identification of functional proteins from amputated lumbricus Eisenia fetida on the wound healing process. Biomed. Pharmacother. 2017, 95, 1469–1478. [Google Scholar] [CrossRef] [Scilit]
  27. Yang, Y.; Sun, Y.; Zhang, N.; Li, J.; Zhang, C.; Duan, X.; Ding, Y.; Zhao, R.; Zheng, Z.; Geng, D.; et al. The up-regulation of two identified wound healing specific proteins-HSP70 and lysozyme in regenerated Eisenia fetida through transcriptome analysis. J. Ethnopharmacol. 2019, 237, 64–73. [Google Scholar] [CrossRef] [Scilit]
  28. Wang, W.; Ye, J.; Guo, Z.; Ma, Y.; Yang, Q.; Zhong, W.; Du, S.; Bai, J. A novel glycoprotein from earthworm extract PvE-3: Insights of their characteristics for promoting diabetic wound healing and attenuating methylglyoxal-induced cell damage. Int. J. Biol. Macromol. 2023, 239, 124267. [Google Scholar] [CrossRef] [Scilit]
  29. Li, T.; Sun, Y.; Wang, J.; Zhang, C.; Sun, Y. Promoted Skin Wound Healing by Tail-Amputated Eisenia foetida Proteins via the Ras/Raf/MEK/ERK Signaling Pathway. ACS Omega 2023, 8, 13935–13943. [Google Scholar] [CrossRef] [Scilit]
  30. Song, S.; Wang, Y.; Ji, K.; Liang, H.; Ji, A. Effect of earthworm active protein on fibroblast proliferation and its mechanism. Pharm. Biol. 2016, 54, 732–739. [Google Scholar] [CrossRef] [Scilit]
  31. Li, L.J.; Wang, M.Z.; Yuan, T.J.; Xu, X.H.; Dad, H.A.; Yu, C.L.; Hou, J.; Peng, L.H. The crude ethanol extract of Periplaneta americana L. stimulates wound healing in vitro & in vivo. Chin. Med. 2019, 14, 33. [Google Scholar] [CrossRef] [Scilit]
  32. Liao, Q.; Pang, L.; Li, J.J.; Zhang, C.; Li, J.X.; Zhang, X.; Mao, T.; Wu, D.T.; Ma, X.Y.; Geng, F.N.; et al. Characterization and diabetic wound healing benefits of protein-polysaccharide complexes isolated from an animal ethno-medicine Periplaneta americana L. Int. J. Biol. Macromol. 2022, 195, 466–474. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Chang, J.; He, X.; Hu, J.; Kamau, P.M.; Lai, R.; Rao, D.; Luo, L. Bv8-Like Toxin from the Frog Venom of Amolops jingdongensis Promotes Wound Healing via the Interleukin-1 Signaling Pathway. Toxins 2019, 12, 15. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Shi, Y.; Li, C.; Wang, M.; Chen, Z.; Luo, Y.; Xia, X.S.; Song, Y.; Sun, Y.; Zhang, A.M. Cathelicidin-DM is an Antimicrobial Peptide from Duttaphrynus melanostictus and Has Wound-Healing Therapeutic Potential. ACS Omega 2020, 5, 9301–9310. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Liu, H.; Guo, X.; Yi, T.; Zhu, Y.; Ren, X.; Guo, R.; Dai, Y.; Liang, S. Frog Skin Derived Peptides With Potential Protective Effects on Ultraviolet B-Induced Cutaneous Photodamage. Front. Immunol. 2021, 12, 613365. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Wu, J.; Yang, J.; Wang, X.; Wei, L.; Mi, K.; Shen, Y.; Liu, T.; Yang, H.; Mu, L. A frog cathelicidin peptide effectively promotes cutaneous wound healing in mice. Biochem. J. 2018, 475, 2785–2799. [Google Scholar] [CrossRef] [Scilit]
  37. Feng, G.; Wei, L.; Che, H.; Shen, Y.; Yang, J.; Mi, K.; Liu, J.; Wu, J.; Yang, H.; Mu, L. A Frog Peptide Ameliorates Skin Photoaging Through Scavenging Reactive Oxygen Species. Front. Pharmacol. 2021, 12, 761011. [Google Scholar] [CrossRef] [Scilit]
  38. Bian, W.; Meng, B.; Li, X.; Wang, S.; Cao, X.; Liu, N.; Yang, M.; Tang, J.; Wang, Y.; Yang, X. OA-GL21, a novel bioactive peptide from Odorrana andersonii, accelerated the healing of skin wounds. Biosci. Rep. 2018, 38, BSR20180215. [Google Scholar] [CrossRef] [Scilit]
  39. Song, Y.; Wu, C.; Zhang, X.; Bian, W.; Liu, N.; Yin, S.; Yang, M.; Luo, M.; Tang, J.; Yang, X. A short peptide potentially promotes the healing of skin wound. Biosci. Rep. 2019, 39, BSR20181734. [Google Scholar] [CrossRef] [Scilit]
  40. Zhang, Y.; Wang, Y.; Zeng, L.; Liu, Y.; Sun, H.; Li, S.; Wang, S.; Shu, L.; Liu, N.; Yin, S.; et al. Amphibian-derived peptide homodimer OA-GL17d promotes skin wound regeneration through the miR-663a/TGF-β1/Smad axis. Burns Trauma 2022, 10, tkac032. [Google Scholar] [CrossRef] [Scilit]
  41. Liu, H.; Mu, L.; Tang, J.; Shen, C.; Gao, C.; Rong, M.; Zhang, Z.; Liu, J.; Wu, X.; Yu, H.; et al. A potential wound healing-promoting peptide from frog skin. Int. J. Biochem. Cell Biol. 2014, 49, 32–41. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  42. Liu, H.; Duan, Z.; Tang, J.; Lv, Q.; Rong, M.; Lai, R. A short peptide from frog skin accelerates diabetic wound healing. FEBS J. 2014, 281, 4633–4643. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Li, X.; Wang, Y.; Zou, Z.; Yang, M.; Wu, C.; Su, Y.; Tang, J.; Yang, X. OM-LV20, a novel peptide from odorous frog skin, accelerates wound healing in vitro and in vivo. Chem. Biol. Drug Des. 2018, 91, 126–136. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Cao, X.; Wang, Y.; Wu, C.; Li, X.; Fu, Z.; Yang, M.; Bian, W.; Wang, S.; Song, Y.; Tang, J.; et al. Cathelicidin-OA1, a novel antioxidant peptide identified from an amphibian, accelerates skin wound healing. Sci. Rep. 2018, 8, 943. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. He, X.; Yang, Y.; Mu, L.; Zhou, Y.; Chen, Y.; Wu, J.; Wang, Y.; Yang, H.; Li, M.; Xu, W.; et al. A Frog-Derived Immunomodulatory Peptide Promotes Cutaneous Wound Healing by Regulating Cellular Response. Front. Immunol. 2019, 10, 2421. [Google Scholar] [CrossRef] [Scilit]
  46. Liu, S.; Long, Q.; Xu, Y.; Wang, J.; Xu, Z.; Wang, L.; Zhou, M.; Wu, Y.; Chen, T.; Shaw, C. Assessment of antimicrobial and wound healing effects of Brevinin-2Ta against the bacterium Klebsiella pneumoniae in dermally-wounded rats. Oncotarget 2017, 8, 111369–111385. [Google Scholar] [CrossRef] [Scilit]
  47. Fan, X.L.; Yu, S.S.; Zhao, J.L.; Li, Y.; Zhan, D.J.; Xu, F.; Lin, Z.H.; Chen, J. Brevinin-2PN, an antimicrobial peptide identified from dark-spotted frog (Pelophylax nigromaculatus), exhibits wound-healing activity. Dev. Comp. Immunol. 2022, 137, 104519. [Google Scholar] [CrossRef] [Scilit]
  48. Fu, S.; Du, C.; Zhang, Q.; Liu, J.; Zhang, X.; Deng, M. A Novel Peptide from Polypedates megacephalus Promotes Wound Healing in Mice. Toxins 2022, 14, 753. [Google Scholar] [CrossRef] [Scilit]
  49. Wang, S.; Feng, C.; Yin, S.; Feng, Z.; Tang, J.; Liu, N.; Yang, F.; Yang, X.; Wang, Y. A novel peptide from the skin of amphibian Rana limnocharis with potency to promote skin wound repair. Nat. Prod. Res. 2021, 35, 3514–3518. [Google Scholar] [CrossRef] [Scilit]
  50. Wang, Y.; Feng, Z.; Yang, M.; Zeng, L.; Qi, B.; Yin, S.; Li, B.; Li, Y.; Fu, Z.; Shu, L.; et al. Discovery of a novel short peptide with efficacy in accelerating the healing of skin wounds. Pharmacol. Res. 2021, 163, 105296. [Google Scholar] [CrossRef] [Scilit]
  51. Mu, L.; Tang, J.; Liu, H.; Shen, C.; Rong, M.; Zhang, Z.; Lai, R. A potential wound-healing-promoting peptide from salamander skin. FASEB J. 2014, 28, 3919–3929. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  52. Luo, X.; Ouyang, J.; Wang, Y.; Zhang, M.; Fu, L.; Xiao, N.; Gao, L.; Zhang, P.; Zhou, J.; Wang, Y. A novel anionic cathelicidin lacking direct antimicrobial activity but with potent anti-inflammatory and wound healing activities from the salamander Tylototriton kweichowensis. Biochimie 2021, 191, 37–50. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Zheng, Z.; Li, M.; Jiang, P.; Sun, N.; Lin, S. Peptides derived from sea cucumber accelerate cells proliferation and migration for wound healing by promoting energy metabolism and upregulating the ERK/AKT pathway. Eur. J. Pharmacol. 2022, 921, 174885. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Sun, J.H.; Song, S.; Yang, J.F. Oral administration of sea cucumber (Stichopus japonicus) protein exerts wound healing effects via the PI3K/AKT/mTOR signaling pathway. Food Funct. 2022, 13, 9796–9809. [Google Scholar] [CrossRef] [Scilit]
  55. Mei, F.; Liu, J.; Wu, J.; Duan, Z.; Chen, M.; Meng, K.; Chen, S.; Shen, X.; Xia, G.; Zhao, M. Collagen Peptides Isolated from Salmo salar and Tilapia nilotica Skin Accelerate Wound Healing by Altering Cutaneous Microbiome Colonization via Upregulated NOD2 and BD14. J. Agric. Food Chem. 2020, 68, 1621–1633. [Google Scholar] [CrossRef] [Scilit]
  56. Yang, F.; Jin, S.; Tang, Y. Marine Collagen Peptides Promote Cell Proliferation of NIH-3T3 Fibroblasts via NF-κB Signaling Pathway. Molecules 2019, 24, 4201. [Google Scholar] [CrossRef] [Scilit]
  57. Yang, T.; Zhang, K.; Li, B.; Hou, H. Effects of oral administration of peptides with low molecular weight from Alaska Pollock (Theragra chalcogramma) on cutaneous wound healing. J. Funct. Foods 2018, 48, 682–691. [Google Scholar] [CrossRef] [Scilit]
  58. Wan, T.; Li, L.; Zhu, Z.; Liu, S.; Zhao, Y.; Yu, M. Scorpion Venom Active Polypeptide May Be a New External Drug of Diabetic Ulcer. Evid.-Based Complement. Altern. Med. 2017, 2017, 5161565. [Google Scholar] [CrossRef] [Scilit]
  59. Daniele-Silva, A.; Rodrigues, S.C.S.; Dos Santos, E.C.G.; Queiroz Neto, M.F.; Rocha, H.A.O.; Silva-Júnior, A.A.D.; Resende, J.M.; Araújo, R.M.; Fernandes-Pedrosa, M.F. NMR three-dimensional structure of the cationic peptide Stigmurin from Tityus stigmurus scorpion venom: In vitro antioxidant and in vivo antibacterial and healing activity. Peptides 2021, 137, 170478. [Google Scholar] [CrossRef] [Scilit]
  60. Ishihara, K.; Nakajima, N. Stereoselective reduction of carbonyl compounds using the cell-free extract of the earthworm, Lumbricus rubellus, as a novel source of biocatalyst. Biosci. Biotechnol. Biochem. 2006, 70, 3077–3080. [Google Scholar] [CrossRef] [Scilit]
  61. Zhang, M.; Li, X.; Liu, Y.; Ye, F.; Qiu, G. Effects of extract of dilong (pheretima) on the scalded skin in rats. J. Tradit. Chin. Med. 2006, 26, 68–71. [Google Scholar] [PubMed]
  62. Chen, H.; Takahashi, S.; Imamura, M.; Okutani, E.; Zhang, Z.G.; Chayama, K.; Chen, B.A. Earthworm fibrinolytic enzyme: Anti-tumor activity on human hepatoma cells in vitro and in vivo. Chin. Med. J. 2007, 120, 898–904. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Popović, M.; Hrcenjak, T.M.; Babić, T.; Kos, J.; Grdisa, M. Effect of earthworm (G-90) extract on formation and lysis of clots originated from venous blood of dogs with cardiopathies and with malignant tumors. Pathol. Oncol. Res. 2001, 7, 197–202. [Google Scholar] [CrossRef] [Scilit]
  64. Balamurugan, M.; Parthasarathi, K.; Ranganathan, L.S.; Cooper, E.L. Hypothetical mode of action of earthworm extract with hepatoprotective and antioxidant properties. J. Zhejiang Univ. Sci. B 2008, 9, 141–147. [Google Scholar] [CrossRef] [Scilit]
  65. Liu, Z.; Wang, J.; Zhang, J.; Yu, B.; Niu, B. An extract from the earthworm Eisenia fetida non-specifically inhibits the activity of influenza and adenoviruses. J. Tradit. Chin. Med. 2012, 32, 657–663. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. Prakash, M.; Gunasekaran, G. Gastroprotective effect of earthworm paste (Lampito mauritii, Kinberg) on experimental gastric ulcer in rats. Eur. Rev. Med. Pharmacol. Sci. 2010, 14, 171–176. [Google Scholar] [PubMed]
  67. He, P.; Zhang, Y.; Zhang, Y.; Zhang, L.; Lin, Z.; Sun, C.; Wu, H.; Zhang, M. Isolation, identification of antioxidant peptides from earthworm proteins and analysis of the structure-activity relationship of the peptides based on quantum chemical calculations. Food Chem. 2024, 431, 137137. [Google Scholar] [CrossRef] [Scilit]
  68. Wasunan, P.; Maneewong, C.; Daengprok, W.; Thirabunyanon, M. Bioactive Earthworm Peptides Produced by Novel Protease-Producing Bacillus velezensis PM 35 and Its Bioactivities on Liver Cancer Cell Death via Apoptosis, Antioxidant Activity, Protection Against Oxidative Stress, and Immune Cell Activation. Front. Microbiol. 2022, 13, 892945. [Google Scholar] [CrossRef] [Scilit]
  69. Farouk, A.E.; Fahmy, S.R.; Soliman, A.M.; Ibrahim, S.A.; Sadek, S.A. A nano-Liposomal formulation potentiates antioxidant, anti-inflammatory, and fibrinolytic activities of Allolobophora caliginosa coelomic fluid: Formulation and characterization. BMC Biotechnol. 2023, 23, 28. [Google Scholar] [CrossRef] [Scilit]
  70. Wu, Y.; Deng, S.; Wang, X.; Thunders, M.; Qiu, J.; Li, Y. Discovery and Mechanism of Action of a Novel Antimicrobial Peptide from an Earthworm. Microbiol. Spectr. 2023, 11, e0320622. [Google Scholar] [CrossRef] [Scilit]
  71. Czaplewska, P.; Bogucka, A.; Macur, K.; Rybicka, M.; Rychłowski, M.; Fiołka, M.J. Proteomic response of A549 lung cancer cell line to protein-polysaccharide complex Venetin-1 isolated from earthworm coelomic fluid. Front. Mol. Biosci. 2023, 10, 1128320. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  72. Li, P.C.; Tien, Y.C.; Day, C.H.; Pai, P.; Kuo, W.W.; Chen, T.S.; Kuo, C.H.; Tsai, C.H.; Ju, D.T.; Huang, C.Y. Impact of LPS-induced cardiomyoblast cell apoptosis inhibited by earthworm extracts. Cardiovasc. Toxicol. 2015, 15, 172–179. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  73. Poniedziałek, B.; Rosińska, J.; Rzymski, P.; Fiołka, M. Polysaccharide-protein complex from coelomic fluid of Dendrobaena veneta earthworm exerts a multi-pathway antiplatelet effect without coagulopathy and cytotoxicity. Biomed. Pharmacother. 2022, 151, 113205. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  74. Grdisa, M.; Popovic, M.; Hrzenjak, T. Glycolipoprotein extract (G-90) from earthworm Eisenia foetida exerts some antioxidative activity. Comp. Biochem. Physiol. A Mol. Integr. Physiol. 2001, 128, 821–825. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Hrzenjak, M.; Kobrehel, D.; Levanat, S.; Jurin, M.; Hrzenjak, T. Mitogenicity of the earthworm’s (Eisenia foetida) insulin-like proteins. Comp. Biochem. Physiol. B 1993, 104, 723–729. [Google Scholar] [CrossRef] [Scilit]
  76. Hrzenjak, T.; Popović, M.; Bozić, T.; Grdisa, M.; Kobrehel, D.; Tiska-Rudman, L. Fibrinolytic and anticoagulative activities from the earthworm Eisenia foetida. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 1998, 119, 825–832. [Google Scholar] [CrossRef] [Scilit]
  77. Mihara, H.; Sumi, H.; Yoneta, T.; Mizumoto, H.; Ikeda, R.; Seiki, M.; Maruyama, M. A novel fibrinolytic enzyme extracted from the earthworm, Lumbricus rubellus. Jpn. J. Physiol. 1991, 41, 461–472. [Google Scholar] [CrossRef] [Scilit]
  78. Gorres, K.L.; Raines, R.T. Prolyl 4-hydroxylase. Crit. Rev. Biochem. Mol. Biol. 2010, 45, 106–124. [Google Scholar] [CrossRef] [Scilit]
  79. Qiu, L.; Jin, X.Q.; Xiang, D.L.; Fu, Y.X.; Tian, X.F. Study on the collagen constitution of hyperplastic scar in different ages and its influencing factors. Zhonghua Shao Shang Za Zhi 2003, 19, 236–240. [Google Scholar]
  80. Maslowska, K.H.; Makiela-Dzbenska, K.; Fijalkowska, I.J. The SOS system: A complex and tightly regulated response to DNA damage. Environ. Mol. Mutagen. 2019, 60, 368–384. [Google Scholar] [CrossRef] [Scilit]
  81. Chen, J.; De, S.; Brainard, J.; Byzova, T.V. Metastatic properties of prostate cancer cells are controlled by VEGF. Cell Commun. Adhes. 2004, 11, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  82. Chen, K.; Pan, H.; Ji, D.; Li, Y.; Duan, H.; Pan, W. Curcumin-loaded sandwich-like nanofibrous membrane prepared by electrospinning technology as wound dressing for accelerate wound healing. Mater. Sci. Eng. C Mater. Biol. Appl. 2021, 127, 112245. [Google Scholar] [CrossRef] [Scilit]
  83. Krafts, K.P. Tissue repair: The hidden drama. Organogenesis 2010, 6, 225–233. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Whitmore, L.; Wallace, B.A. Protein secondary structure analyses from circular dichroism spectroscopy: Methods and reference databases. Biopolymers 2008, 89, 392–400. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  85. Xu, X.; Lai, R. The chemistry and biological activities of peptides from amphibian skin secretions. Chem. Rev. 2015, 115, 1760–1846. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  86. Zhou, C.; Wang, Z.; Peng, X.; Liu, Y.; Lin, Y.; Zhang, Z.; Qiu, Y.; Jin, M.; Wang, R.; Kong, D. Discovery of two bombinin peptides with antimicrobial and anticancer activities from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Chem. Biol. Drug Des. 2018, 91, 50–61. [Google Scholar] [CrossRef] [Scilit]
  87. Du, Q.; Wang, H.; Ma, C.; Wu, Y.; Xi, X.; Zhou, M.; Chen, T.; Shaw, C.; Wang, L. Identification of a Novel Vasodilatory Octapeptide from the Skin Secretion of the African Hyperoliid Frog, Kassina senegalensis. Molecules 2017, 22, 1215. [Google Scholar] [CrossRef] [Scilit]
  88. Wu, Y.; Long, Q.; Xu, Y.; Guo, S.; Chen, T.; Wang, L.; Zhou, M.; Zhang, Y.; Shaw, C.; Walker, B. A structural and functional analogue of a Bowman-Birk-type protease inhibitor from Odorrana schmackeri. Biosci. Rep. 2017, 37, BSR20160593. [Google Scholar] [CrossRef] [Scilit]
  89. Zhang, Y. Why do we study animal toxins? Dongwuxue Yanjiu 2015, 36, 183–222. [Google Scholar] [CrossRef] [Scilit]
  90. Yang, X.; Lee, W.H.; Zhang, Y. Extremely abundant antimicrobial peptides existed in the skins of nine kinds of Chinese odorous frogs. J. Proteome Res. 2012, 11, 306–319. [Google Scholar] [CrossRef] [Scilit]
  91. Raaymakers, C.; Verbrugghe, E.; Hernot, S.; Hellebuyck, T.; Betti, C.; Peleman, C.; Claeys, M.; Bert, W.; Caveliers, V.; Ballet, S.; et al. Antimicrobial peptides in frog poisons constitute a molecular toxin delivery system against predators. Nat. Commun. 2017, 8, 1495. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  92. Wang, Y.; Zhang, Y.; Lee, W.H.; Yang, X.; Zhang, Y. Novel Peptides from Skins of Amphibians Showed Broad-Spectrum Antimicrobial Activities. Chem. Biol. Drug Des. 2016, 87, 419–424. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  93. Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.H.; Zhang, Y. Rich diversity and potency of skin antioxidant peptides revealed a novel molecular basis for high-altitude adaptation of amphibians. Sci. Rep. 2016, 6, 19866. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  94. Yu, H.; Qiao, X.; Gao, J.; Wang, C.; Cai, S.; Feng, L.; Wang, H.; Wang, Y.P. Identification and Characterization of Novel Antioxidant Peptides Involved in Redox Homeostasis of Frog, Limnonectes fragilis. Protein Pept. Lett. 2015, 22, 776–784. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  95. Ferris, D.R.; Satoh, A.; Mandefro, B.; Cummings, G.M.; Gardiner, D.M.; Rugg, E.L. Ex vivo generation of a functional and regenerative wound epithelium from axolotl (Ambystoma mexicanum) skin. Dev. Growth Differ. 2010, 52, 715–724. [Google Scholar] [CrossRef] [Scilit]
  96. Rezazade Bazaz, M.; Mashreghi, M.; Mahdavi Shahri, N.; Mashreghi, M.; Asoodeh, A.; Behnam Rassouli, M. Evaluation of Antimicrobial and Healing Activities of Frog Skin on Guinea Pigs Wounds. Jundishapur. J. Microbiol. 2015, 8, e21218. [Google Scholar] [CrossRef] [Scilit]
  97. Mashreghi, M.; Rezazade Bazaz, M.; Mahdavi Shahri, N.; Asoodeh, A.; Mashreghi, M.; Behnam Rassouli, M.; Golmohammadzadeh, S. Topical effects of frog “Rana ridibunda” skin secretions on wound healing and reduction of wound microbial load. J. Ethnopharmacol. 2013, 145, 793–797. [Google Scholar] [CrossRef] [Scilit]
  98. Zhang, M.; Li, X.; Li, S.; Liu, Y.; Hao, L. Electrospun poly(l-lactide)/zein nanofiber mats loaded with Rana chensinensis skin peptides for wound dressing. J. Mater. Sci. Mater. Med. 2016, 27, 136. [Google Scholar] [CrossRef] [Scilit]
  99. Demori, I.; Rashed, Z.E.; Corradino, V.; Catalano, A.; Rovegno, L.; Queirolo, L.; Salvidio, S.; Biggi, E.; Zanotti-Russo, M.; Canesi, L.; et al. Peptides for Skin Protection and Healing in Amphibians. Molecules 2019, 24, 347. [Google Scholar] [CrossRef] [Scilit]
  100. Wang, G.; Chen, Z.; Tian, P.; Han, Q.; Zhang, J.; Zhang, A.M.; Song, Y. Wound healing mechanism of antimicrobial peptide cathelicidin-DM. Front. Bioeng. Biotechnol. 2022, 10, 977159. [Google Scholar] [CrossRef] [Scilit]
  101. Cheng, X.; Shao, Z.; Li, C.; Yu, L.; Raja, M.A.; Liu, C. Isolation, Characterization and Evaluation of Collagen from Jellyfish Rhopilema esculentum Kishinouye for Use in Hemostatic Applications. PLoS ONE 2017, 12, e0169731. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  102. Widdowson, J.P.; Picton, A.J.; Vince, V.; Wright, C.J.; Mearns-Spragg, A. In vivo comparison of jellyfish and bovine collagen sponges as prototype medical devices. J. Biomed. Mater. Res. B Appl. Biomater. 2018, 106, 1524–1533. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  103. Coppola, D.; Oliviero, M.; Vitale, G.A.; Lauritano, C.; D’Ambra, I.; Iannace, S.; de Pascale, D. Marine Collagen from Alternative and Sustainable Sources: Extraction, Processing and Applications. Mar. Drugs 2020, 18, 214. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. Sinthusamran, S.; Benjakul, S.; Kishimura, H. Comparative study on molecular characteristics of acid soluble collagens from skin and swim bladder of seabass (Lates calcarifer). Food Chem. 2013, 138, 2435–2441. [Google Scholar] [CrossRef] [Scilit]
  105. Whelan, A.; Duffy, J.; Gaul, R.T.; O’Reilly, D.; Nolan, D.R.; Gunning, P.; Lally, C.; Murphy, B.P. Collagen fibre orientation and dispersion govern ultimate tensile strength, stiffness and the fatigue performance of bovine pericardium. J. Mech. Behav. Biomed. Mater. 2019, 90, 54–60. [Google Scholar] [CrossRef] [Scilit]
  106. Raz, P.; Brosh, T.; Ronen, G.; Tal, H. Tensile Properties of Three Selected Collagen Membranes. Biomed. Res. Int. 2019, 2019, 5163603. [Google Scholar] [CrossRef] [Scilit]
  107. Zdzieblik, D.; Oesser, S.; Gollhofer, A.; König, D. Improvement of activity-related knee joint discomfort following supplementation of specific collagen peptides. Appl. Physiol. Nutr. Metab. 2017, 42, 588–595. [Google Scholar] [CrossRef] [Scilit]
  108. Clark, K.L.; Sebastianelli, W.; Flechsenhar, K.R.; Aukermann, D.F.; Meza, F.; Millard, R.L.; Deitch, J.R.; Sherbondy, P.S.; Albert, A. 24-Week study on the use of collagen hydrolysate as a dietary supplement in athletes with activity-related joint pain. Curr. Med. Res. Opin. 2008, 24, 1485–1496. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  109. Ma, C.; Sun, N.; Zhang, S.; Zheng, J.; Lin, S. A new dual-peptide strategy for enhancing antioxidant activity and exploring the enhancement mechanism. Food Funct. 2019, 10, 7533–7543. [Google Scholar] [CrossRef] [Scilit]
  110. Mościcka, P.; Cwajda-Białasik, J.; Szewczyk, M.T.; Jawień, A. Healing Process, Pain, and Health-Related Quality of Life in Patients with Venous Leg Ulcers Treated with Fish Collagen Gel: A 12-Week Randomized Single-Center Study. Int. J. Environ. Res. Public Health 2022, 19, 7108. [Google Scholar] [CrossRef] [Scilit]
  111. Geahchan, S.; Baharlouei, P.; Rahman, A. Marine Collagen: A Promising Biomaterial for Wound Healing, Skin Anti-Aging, and Bone Regeneration. Mar. Drugs 2022, 20, 61. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  112. Cadar, E.; Pesterau, A.M.; Sirbu, R.; Negreanu-Pirjol, B.S.; Tomescu, C.L. Jellyfishes-Significant Marine Resources with Potential in the Wound-Healing Process: A Review. Mar. Drugs 2023, 21, 201. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  113. Xia, Z.; He, D.; Wu, Y.; Kwok, H.F.; Cao, Z. Scorpion venom peptides: Molecular diversity, structural characteristics, and therapeutic use from channelopathies to viral infections and cancers. Pharmacol. Res. 2023, 197, 106978. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  114. Sachkova, M.Y.; Landau, M.; Surm, J.M.; Macrander, J.; Singer, S.A.; Reitzel, A.M.; Moran, Y. Toxin-like neuropeptides in the sea anemone Nematostella unravel recruitment from the nervous system to venom. Proc. Natl. Acad. Sci. USA 2020, 117, 27481–27492. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  115. Amorim-Carmo, B.; Parente, A.M.S.; Souza, E.S.; Silva-Junior, A.A.; Araújo, R.M.; Fernandes-Pedrosa, M.F. Antimicrobial Peptide Analogs From Scorpions: Modifications and Structure-Activity. Front. Mol. Biosci. 2022, 9, 887763. [Google Scholar] [CrossRef] [Scilit]
  116. Moradikian, M.; Komijani, M.; Shayestehfar, A. Detection of Staphylococcus aureus and their toxin genes inhabit on the scorpions surface. Arch. Microbiol. 2022, 204, 576. [Google Scholar] [CrossRef] [Scilit]
  117. Almaaytah, A.; Albalas, Q. Scorpion venom peptides with no disulfide bridges: A review. Peptides 2014, 51, 35–45. [Google Scholar] [CrossRef] [Scilit]
  118. Du, Q.; Hou, X.; Ge, L.; Li, R.; Zhou, M.; Wang, H.; Wang, L.; Wei, M.; Chen, T.; Shaw, C. Cationicity-enhanced analogues of the antimicrobial peptides, AcrAP1 and AcrAP2, from the venom of the scorpion, Androctonus crassicauda, display potent growth modulation effects on human cancer cell lines. Int. J. Biol. Sci. 2014, 10, 1097–1107. [Google Scholar] [CrossRef] [Scilit]
  119. Erdeş, E.; Doğan, T.S.; Coşar, I.; Danışman, T.; Kunt, K.B.; Seker, T.; Yücel, M.; Ozen, C. Characterization of Leiurus abdullahbayrami (Scorpiones: Buthidae) venom: Peptide profile, cytotoxicity and antimicrobial activity. J. Venom. Anim. Toxins Incl. Trop. Dis. 2014, 20, 48. [Google Scholar] [CrossRef] [Scilit]
  120. Ruszczak, Z. Effect of collagen matrices on dermal wound healing. Adv. Drug Deliv. Rev. 2003, 55, 1595–1611. [Google Scholar] [CrossRef] [Scilit]
  121. Cen, L.; Liu, W.; Cui, L.; Zhang, W.; Cao, Y. Collagen tissue engineering: Development of novel biomaterials and applications. Pediatr. Res. 2008, 63, 492–496. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  122. Oslan, S.N.H.; Li, C.X.; Shapawi, R.; Mokhtar, R.A.M.; Noordin, W.N.M.; Huda, N. Extraction and Characterization of Bioactive Fish By-Product Collagen as Promising for Potential Wound Healing Agent in Pharmaceutical Applications: Current Trend and Future Perspective. Int. J. Food Sci. 2022, 2022, 9437878. [Google Scholar] [CrossRef] [Scilit]
  123. Mangoni, M.L.; McDermott, A.M.; Zasloff, M. Antimicrobial peptides and wound healing: Biological and therapeutic considerations. Exp. Dermatol. 2016, 25, 167–173. [Google Scholar] [CrossRef] [Scilit]
  124. Jara, C.P.; Mendes, N.F.; Prado, T.P.D.; de Araújo, E.P. Bioactive Fatty Acids in the Resolution of Chronic Inflammation in Skin Wounds. Adv. Wound Care 2020, 9, 472–490. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  125. Shams, F.; Moravvej, H.; Hosseinzadeh, S.; Mostafavi, E.; Bayat, H.; Kazemi, B.; Bandehpour, M.; Rostami, E.; Rahimpour, A.; Moosavian, H. Overexpression of VEGF in dermal fibroblast cells accelerates the angiogenesis and wound healing function: In vitro and in vivo studies. Sci. Rep. 2022, 12, 18529. [Google Scholar] [CrossRef] [Scilit]
  126. Hesketh, M.; Sahin, K.B.; West, Z.E.; Murray, R.Z. Macrophage Phenotypes Regulate Scar Formation and Chronic Wound Healing. Int. J. Mol. Sci. 2017, 18, 1545. [Google Scholar] [CrossRef] [Scilit]
  127. Wynn, T.A.; Vannella, K.M. Macrophages in Tissue Repair, Regeneration, and Fibrosis. Immunity 2016, 44, 450–462. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  128. Pang, Y.; Wang, D.; Hu, X.; Wang, H.; Fu, W.; Fan, Z.; Chen, X.; Yu, F. Effect of volatile oil from Blumea Balsamifera (L.) DC. leaves on wound healing in mice. J. Tradit. Chin. Med. 2014, 34, 716–724. [Google Scholar] [CrossRef] [Scilit]
  129. Sorg, H.; Tilkorn, D.J.; Hager, S.; Hauser, J.; Mirastschijski, U. Skin Wound Healing: An Update on the Current Knowledge and Concepts. Eur. Surg. Res. 2017, 58, 81–94. [Google Scholar] [CrossRef] [Scilit]
  130. Li, M.; Hou, Q.; Zhong, L.; Zhao, Y.; Fu, X. Macrophage Related Chronic Inflammation in Non-Healing Wounds. Front. Immunol. 2021, 12, 681710. [Google Scholar] [CrossRef] [Scilit]
  131. Ogawa, R. Keloid and Hypertrophic Scars Are the Result of Chronic Inflammation in the Reticular Dermis. Int. J. Mol. Sci. 2017, 18, 606. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  132. Ghieh, F.; Jurjus, R.; Ibrahim, A.; Geagea, A.G.; Daouk, H.; El Baba, B.; Chams, S.; Matar, M.; Zein, W.; Jurjus, A. The Use of Stem Cells in Burn Wound Healing: A Review. Biomed. Res. Int. 2015, 2015, 684084. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  133. Diller, R.B.; Tabor, A.J. The Role of the Extracellular Matrix (ECM) in Wound Healing: A Review. Biomimetics 2022, 7, 87. [Google Scholar] [CrossRef] [Scilit]
  134. Bonnici, L.; Suleiman, S.; Schembri-Wismayer, P.; Cassar, A. Targeting Signalling Pathways in Chronic Wound Healing. Int. J. Mol. Sci. 2023, 25, 50. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  135. Massagué, J. TGFβ signalling in context. Nat. Rev. Mol. Cell Biol. 2012, 13, 616–630. [Google Scholar] [CrossRef] [Scilit]
  136. Baba, A.B.; Rah, B.; Bhat, G.R.; Mushtaq, I.; Parveen, S.; Hassan, R.; Hameed Zargar, M.; Afroze, D. Transforming Growth Factor-Beta (TGF-β) Signaling in Cancer-A Betrayal Within. Front. Pharmacol. 2022, 13, 791272. [Google Scholar] [CrossRef] [Scilit]
  137. Meng, X.M.; Nikolic-Paterson, D.J.; Lan, H.Y. TGF-β: The master regulator of fibrosis. Nat. Rev. Nephrol. 2016, 12, 325–338. [Google Scholar] [CrossRef] [Scilit]
  138. Li, Y.; Zhang, J.; Yue, J.; Gou, X.; Wu, X. Epidermal Stem Cells in Skin Wound Healing. Adv. Wound Care 2017, 6, 297–307. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  139. Liarte, S.; Bernabé-García, Á.; Nicolás, F.J. Role of TGF-β in Skin Chronic Wounds: A Keratinocyte Perspective. Cells 2020, 9, 306. [Google Scholar] [CrossRef] [Scilit]
  140. Park, J.U.; Jeong, S.H.; Song, E.H.; Song, J.; Kim, H.E.; Kim, S. Acceleration of the healing process of full-thickness wounds using hydrophilic chitosan-silica hybrid sponge in a porcine model. J. Biomater. Appl. 2018, 32, 1011–1023. [Google Scholar] [CrossRef] [Scilit]
  141. Martin, P.; Leibovich, S.J. Inflammatory cells during wound repair: The good, the bad and the ugly. Trends Cell Biol. 2005, 15, 599–607. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  142. Eming, S.A.; Krieg, T.; Davidson, J.M. Inflammation in wound repair: Molecular and cellular mechanisms. J. Investig. Dermatol. 2007, 127, 514–525. [Google Scholar] [CrossRef] [Scilit]
  143. Mauviel, A.; Heino, J.; Kähäri, V.M.; Hartmann, D.J.; Loyau, G.; Pujol, J.P.; Vuorio, E. Comparative effects of interleukin-1 and tumor necrosis factor-alpha on collagen production and corresponding procollagen mRNA levels in human dermal fibroblasts. J. Investig. Dermatol. 1991, 96, 243–249. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  144. Arno, A.I.; Gauglitz, G.G.; Barret, J.P.; Jeschke, M.G. New molecular medicine-based scar management strategies. Burns 2014, 40, 539–551. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  145. Zhou, R.; Wang, C.; Wen, C.; Wang, D. miR-21 promotes collagen production in keloid via Smad7. Burns 2017, 43, 555–561. [Google Scholar] [CrossRef] [Scilit]
  146. Kamiya, Y.; Miyazono, K.; Miyazawa, K. Smad7 inhibits transforming growth factor-beta family type i receptors through two distinct modes of interaction. J. Biol. Chem. 2010, 285, 30804–30813. [Google Scholar] [CrossRef] [Scilit]
  147. Zhang, Z.; Finnerty, C.C.; He, J.; Herndon, D.N. Smad ubiquitination regulatory factor 2 expression is enhanced in hypertrophic scar fibroblasts from burned children. Burns 2012, 38, 236–246. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  148. Tang, B.; Zhu, B.; Liang, Y.; Bi, L.; Hu, Z.; Chen, B.; Zhang, K.; Zhu, J. Asiaticoside suppresses collagen expression and TGF-β/Smad signaling through inducing Smad7 and inhibiting TGF-βRI and TGF-βRII in keloid fibroblasts. Arch. Dermatol. Res. 2011, 303, 563–572. [Google Scholar] [CrossRef] [Scilit]
  149. Gaudreault, M.; Vigneault, F.; Leclerc, S.; Guérin, S.L. Laminin reduces expression of the human alpha6 integrin subunit gene by altering the level of the transcription factors Sp1 and Sp3. Investig. Ophthalmol. Vis. Sci. 2007, 48, 3490–3505. [Google Scholar] [CrossRef] [Scilit]
  150. Gabbiani, G.; Hirschel, B.J.; Ryan, G.B.; Statkov, P.R.; Majno, G. Granulation tissue as a contractile organ. A study of structure and function. J. Exp. Med. 1972, 135, 719–734. [Google Scholar] [CrossRef] [Scilit]
  151. Darby, I.A.; Hewitson, T.D. Fibroblast differentiation in wound healing and fibrosis. Int. Rev. Cytol. 2007, 257, 143–179. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  152. He, J.; Peng, H.; Wang, M.; Liu, Y.; Guo, X.; Wang, B.; Dai, L.; Cheng, X.; Meng, Z.; Yuan, L.; et al. Isoliquiritigenin inhibits TGF-β1-induced fibrogenesis through activating autophagy via PI3K/AKT/mTOR pathway in MRC-5 cells. Acta Biochim. Biophys. Sin. 2020, 52, 810–820. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  153. Tang, M.; Bian, W.; Cheng, L.; Zhang, L.; Jin, R.; Wang, W.; Zhang, Y. Ginsenoside Rg3 inhibits keloid fibroblast proliferation, angiogenesis and collagen synthesis in vitro via the TGF-β/Smad and ERK signaling pathways. Int. J. Mol. Med. 2018, 41, 1487–1499. [Google Scholar] [CrossRef] [Scilit]
  154. Squarize, C.H.; Castilho, R.M.; Bugge, T.H.; Gutkind, J.S. Accelerated wound healing by mTOR activation in genetically defined mouse models. PLoS ONE 2010, 5, e10643. [Google Scholar] [CrossRef] [Scilit]
  155. Li, T.; Wang, G. Computer-aided targeting of the PI3K/Akt/mTOR pathway: Toxicity reduction and therapeutic opportunities. Int. J. Mol. Sci. 2014, 15, 18856–18891. [Google Scholar] [CrossRef] [Scilit]
  156. Hoke, G.D.; Ramos, C.; Hoke, N.N.; Crossland, M.C.; Shawler, L.G.; Boykin, J.V. Atypical Diabetic Foot Ulcer Keratinocyte Protein Signaling Correlates with Impaired Wound Healing. J. Diabetes Res. 2016, 2016, 1586927. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  157. Jere, S.W.; Houreld, N.N.; Abrahamse, H. Role of the PI3K/AKT (mTOR and GSK3β) signalling pathway and photobiomodulation in diabetic wound healing. Cytokine Growth Factor Rev. 2019, 50, 52–59. [Google Scholar] [CrossRef] [Scilit]
  158. Xiao, W.; Tang, H.; Wu, M.; Liao, Y.; Li, K.; Li, L.; Xu, X. Ozone oil promotes wound healing by increasing the migration of fibroblasts via PI3K/Akt/mTOR signaling pathway. Biosci. Rep. 2017, 37, BSR20170658. [Google Scholar] [CrossRef] [Scilit]
  159. Hou, B.; Cai, W.; Chen, T.; Zhang, Z.; Gong, H.; Yang, W.; Qiu, L. Vaccarin hastens wound healing by promoting angiogenesis via activation of MAPK/ERK and PI3K/AKT signaling pathways in vivo. Acta Cir. Bras. 2020, 34, e201901202. [Google Scholar] [CrossRef] [Scilit]
  160. Yu, T.; Gao, M.; Yang, P.; Liu, D.; Wang, D.; Song, F.; Zhang, X.; Liu, Y. Insulin promotes macrophage phenotype transition through PI3K/Akt and PPAR-γ signaling during diabetic wound healing. J. Cell. Physiol. 2019, 234, 4217–4231. [Google Scholar] [CrossRef] [Scilit]
  161. Gao, Y.L.; Liu, C.S.; Zhao, R.; Wang, L.L.; Li, S.S.; Liu, M.; Zhang, M.; Jiang, S.K.; Tian, Z.L.; Wang, M.; et al. Effects of PI3K/Akt Pathway in Wound Healing Process of Mice Skin. Fa Yi Xue Za Zhi 2016, 32, 7–12. [Google Scholar] [PubMed]
  162. Chattopadhyay, S.; Raines, R.T. Review collagen-based biomaterials for wound healing. Biopolymers 2014, 101, 821–833. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  163. Banerjee, P.; Suguna, L.; Shanthi, C. Wound healing activity of a collagen-derived cryptic peptide. Amino Acids 2015, 47, 317–328. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  164. Chong, H.C.; Tan, M.J.; Philippe, V.; Tan, S.H.; Tan, C.K.; Ku, C.W.; Goh, Y.Y.; Wahli, W.; Michalik, L.; Tan, N.S. Regulation of epithelial-mesenchymal IL-1 signaling by PPARbeta/delta is essential for skin homeostasis and wound healing. J. Cell Biol. 2009, 184, 817–831. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  165. Su, L.; Li, X.; Wu, X.; Hui, B.; Han, S.; Gao, J.; Li, Y.; Shi, J.; Zhu, H.; Zhao, B.; et al. Simultaneous deactivation of FAK and Src improves the pathology of hypertrophic scar. Sci. Rep. 2016, 6, 26023. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  166. Wang, S.; Liu, Z.; Wang, L.; Zhang, X. NF-kappaB signaling pathway, inflammation and colorectal cancer. Cell. Mol. Immunol. 2009, 6, 327–334. [Google Scholar] [CrossRef] [Scilit]
  167. Herrington, F.D.; Carmody, R.J.; Goodyear, C.S. Modulation of NF-κB Signaling as a Therapeutic Target in Autoimmunity. J. Biomol. Screen. 2016, 21, 223–242. [Google Scholar] [CrossRef] [Scilit]
  168. Taniguchi, K.; Karin, M. NF-κB, inflammation, immunity and cancer: Coming of age. Nat. Rev. Immunol. 2018, 18, 309–324. [Google Scholar] [CrossRef] [Scilit]
  169. Liu, T.; Zhang, L.; Joo, D.; Sun, S.C. NF-κB signaling in inflammation. Signal Transduct. Target Ther. 2017, 2, 17023. [Google Scholar] [CrossRef] [Scilit]
  170. Brown, K.D.; Claudio, E.; Siebenlist, U. The roles of the classical and alternative nuclear factor-kappaB pathways: Potential implications for autoimmunity and rheumatoid arthritis. Arthritis Res. Ther. 2008, 10, 212. [Google Scholar] [CrossRef] [Scilit]
  171. Canesso, M.C.; Vieira, A.T.; Castro, T.B.; Schirmer, B.G.; Cisalpino, D.; Martins, F.S.; Rachid, M.A.; Nicoli, J.R.; Teixeira, M.M.; Barcelos, L.S. Skin wound healing is accelerated and scarless in the absence of commensal microbiota. J. Immunol. 2014, 193, 5171–5180. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  172. Williams, H.; Campbell, L.; Crompton, R.A.; Singh, G.; McHugh, B.J.; Davidson, D.J.; McBain, A.J.; Cruickshank, S.M.; Hardman, M.J. Microbial Host Interactions and Impaired Wound Healing in Mice and Humans: Defining a Role for BD14 and NOD2. J. Investig. Dermatol. 2018, 138, 2264–2274. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  173. Bielig, H.; Zurek, B.; Kutsch, A.; Menning, M.; Philpott, D.J.; Sansonetti, P.J.; Kufer, T.A. A function for AAMP in Nod2-mediated NF-kappaB activation. Mol. Immunol. 2009, 46, 2647–2654. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  174. Liu, Y.; Yang, H.; Liu, L.X.; Yan, W.; Guo, H.J.; Li, W.J.; Tian, C.; Li, H.H.; Wang, H.X. NOD2 contributes to myocardial ischemia/reperfusion injury by regulating cardiomyocyte apoptosis and inflammation. Life Sci. 2016, 149, 10–17. [Google Scholar] [CrossRef] [Scilit]
  175. Yang, B.; Lin, Y.; Huang, Y.; Zhu, N.; Shen, Y.Q. Extracellular vesicles modulate key signalling pathways in refractory wound healing. Burns Trauma 2023, 11, tkad039. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  176. Hu, X.; Li, J.; Fu, M.; Zhao, X.; Wang, W. The JAK/STAT signaling pathway: From bench to clinic. Signal Transduct. Target. Ther. 2021, 6, 402. [Google Scholar] [CrossRef] [Scilit]
  177. Hunckler, J.; de Mel, A. A current affair: Electrotherapy in wound healing. J. Multidiscip. Healthc. 2017, 10, 179–194. [Google Scholar] [CrossRef] [Scilit]
  178. Jere, S.W.; Abrahamse, H.; Houreld, N.N. The JAK/STAT signaling pathway and photobiomodulation in chronic wound healing. Cytokine Growth Factor Rev. 2017, 38, 73–79. [Google Scholar] [CrossRef] [Scilit]
  179. Matos, C.; Lobão, P. Non-Steroidal Anti-Inflammatory Drugs Loaded Liposomes for Topical Treatment of Inflammatory and Degenerative Conditions. Curr. Med. Chem. 2020, 27, 3809–3829. [Google Scholar] [CrossRef] [Scilit]
  180. Leppert, W.; Malec-Milewska, M.; Zajaczkowska, R.; Wordliczek, J. Transdermal and Topical Drug Administration in the Treatment of Pain. Molecules 2018, 23, 681. [Google Scholar] [CrossRef] [Scilit]
  181. Touitou, E.; Natsheh, H. Topical Administration of Drugs Incorporated in Carriers Containing Phospholipid Soft Vesicles for the Treatment of Skin Medical Conditions. Pharmaceutics 2021, 13, 2129. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  182. Marwah, H.; Garg, T.; Goyal, A.K.; Rath, G. Permeation enhancer strategies in transdermal drug delivery. Drug Deliv. 2016, 23, 564–578. [Google Scholar] [CrossRef] [Scilit]
  183. Natsheh, H.; Touitou, E. Phospholipid Vesicles for Dermal/Transdermal and Nasal Administration of Active Molecules: The Effect of Surfactants and Alcohols on the Fluidity of Their Lipid Bilayers and Penetration Enhancement Properties. Molecules 2020, 25, 2959. [Google Scholar] [CrossRef] [Scilit]
  184. Lau, W.M.; White, A.W.; Gallagher, S.J.; Donaldson, M.; McNaughton, G.; Heard, C.M. Scope and limitations of the co-drug approach to topical drug delivery. Curr. Pharm. Des. 2008, 14, 794–802. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  185. Ramos Campos, E.V.; Proença, P.L.F.; Doretto-Silva, L.; Andrade-Oliveira, V.; Fraceto, L.F.; de Araujo, D.R. Trends in nanoformulations for atopic dermatitis treatment. Expert Opin. Drug Deliv. 2020, 17, 1615–1630. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  186. Seykora, J.; Dentchev, T.; Margolis, D.J. Filaggrin-2 barrier protein inversely varies with skin inflammation. Exp. Dermatol. 2015, 24, 720–722. [Google Scholar] [CrossRef] [Scilit]
  187. Anastasi, A.; Erspamer, V.; Bucci, M. Isolation and amino acid sequences of alytesin and bombesin, two analogous active tetradecapeptides from the skin of European discoglossid frogs. Arch Biochem. Biophys. 1972, 148, 443–446. [Google Scholar] [CrossRef] [Scilit]
  188. Sun, G.; Shen, Y.I.; Harmon, J.W. Engineering Pro-Regenerative Hydrogels for Scarless Wound Healing. Adv. Healthc. Mater. 2018, 7, e1800016. [Google Scholar] [CrossRef] [Scilit]
  189. Griffin, D.R.; Weaver, W.M.; Scumpia, P.O.; Di Carlo, D.; Segura, T. Accelerated wound healing by injectable microporous gel scaffolds assembled from annealed building blocks. Nat. Mater. 2015, 14, 737–744. [Google Scholar] [CrossRef] [Scilit]
  190. Shafique, M.; Sohail, M.; Minhas, M.U.; Khaliq, T.; Kousar, M.; Khan, S.; Hussain, Z.; Mahmood, A.; Abbasi, M.; Aziz, H.C.; et al. Bio-functional hydrogel membranes loaded with chitosan nanoparticles for accelerated wound healing. Int. J. Biol. Macromol. 2021, 170, 207–221. [Google Scholar] [CrossRef] [Scilit]
  191. Chouhan, D.; Lohe, T.U.; Samudrala, P.K.; Mandal, B.B. In Situ Forming Injectable Silk Fibroin Hydrogel Promotes Skin Regeneration in Full Thickness Burn Wounds. Adv. Healthc. Mater. 2018, 7, e1801092. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  192. Chen, Y.; Li, Y.; Yang, X.; Cao, Z.; Nie, H.; Bian, Y.; Yang, G. Glucose-triggered in situ forming keratin hydrogel for the treatment of diabetic wounds. Acta Biomater. 2021, 125, 208–218. [Google Scholar] [CrossRef] [Scilit]
  193. Klubthawee, N.; Bovone, G.; Marco-Dufort, B.; Guzzi, E.A.; Aunpad, R.; Tibbitt, M.W. Biopolymer Nano-Network for Antimicrobial Peptide Protection and Local Delivery. Adv. Healthc. Mater. 2022, 11, e2101426. [Google Scholar] [CrossRef] [Scilit]
  194. Vázquez-González, M.; Willner, I. Stimuli-Responsive Biomolecule-Based Hydrogels and Their Applications. Angew. Chem. Int. Ed. Engl. 2020, 59, 15342–15377. [Google Scholar] [CrossRef] [Scilit]
  195. Fan, F.; Saha, S.; Hanjaya-Putra, D. Biomimetic Hydrogels to Promote Wound Healing. Front. Bioeng. Biotechnol. 2021, 9, 718377. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  196. Cifuentes, A.; Gómez-Gil, V.; Ortega, M.A.; Asúnsolo, Á.; Coca, S.; Román, J.S.; Álvarez-Mon, M.; Buján, J.; García-Honduvilla, N. Chitosan hydrogels functionalized with either unfractionated heparin or bemiparin improve diabetic wound healing. Biomed. Pharmacother. 2020, 129, 110498. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  197. Simões, D.; Miguel, S.P.; Ribeiro, M.P.; Coutinho, P.; Mendonça, A.G.; Correia, I.J. Recent advances on antimicrobial wound dressing: A review. Eur. J. Pharm. Biopharm. 2018, 127, 130–141. [Google Scholar] [CrossRef] [Scilit]
  198. Chen, Z.; Hu, Y.; Li, J.; Zhang, C.; Gao, F.; Ma, X.; Zhang, J.; Fu, C.; Geng, F. A feasible biocompatible hydrogel film embedding Periplaneta americana extract for acute wound healing. Int. J. Pharm. 2019, 571, 118707. [Google Scholar] [CrossRef] [Scilit]
  199. Feng, X.; Zhang, X.; Li, S.; Zheng, Y.; Shi, X.; Li, F.; Guo, S.; Yang, J. Preparation of aminated fish scale collagen and oxidized sodium alginate hybrid hydrogel for enhanced full-thickness wound healing. Int. J. Biol. Macromol. 2020, 164, 626–637. [Google Scholar] [CrossRef] [Scilit]
  200. Amani, H.; Shahbazi, M.A.; D’Amico, C.; Fontana, F.; Abbaszadeh, S.; Santos, H.A. Microneedles for painless transdermal immunotherapeutic applications. J. Control Release 2021, 330, 185–217. [Google Scholar] [CrossRef] [Scilit]
  201. Zhu, J.; Zhou, X.; Kim, H.J.; Qu, M.; Jiang, X.; Lee, K.; Ren, L.; Wu, Q.; Wang, C.; Zhu, X.; et al. Gelatin Methacryloyl Microneedle Patches for Minimally Invasive Extraction of Skin Interstitial Fluid. Small 2020, 16, e1905910. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  202. Ramalheiro, A.; Paris, J.L.; Silva, B.F.B.; Pires, L.R. Rapidly dissolving microneedles for the delivery of cubosome-like liquid crystalline nanoparticles with sustained release of rapamycin. Int. J. Pharm. 2020, 591, 119942. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  203. Lyu, S.; Dong, Z.; Xu, X.; Bei, H.P.; Yuen, H.Y.; James Cheung, C.W.; Wong, M.S.; He, Y.; Zhao, X. Going below and beyond the surface: Microneedle structure, materials, drugs, fabrication, and applications for wound healing and tissue regeneration. Bioact. Mater. 2023, 27, 303–326. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  204. Aust, M.C.; Reimers, K.; Kaplan, H.M.; Stahl, F.; Repenning, C.; Scheper, T.; Jahn, S.; Schwaiger, N.; Ipaktchi, R.; Redeker, J.; et al. Percutaneous collagen induction-regeneration in place of cicatrisation? J. Plast. Reconstr. Aesthetic Surg. 2011, 64, 97–107. [Google Scholar] [CrossRef] [Scilit]
  205. Zhang, Q.; Shi, L.; He, H.; Liu, X.; Huang, Y.; Xu, D.; Yao, M.; Zhang, N.; Guo, Y.; Lu, Y.; et al. Down-Regulating Scar Formation by Microneedles Directly via a Mechanical Communication Pathway. ACS Nano 2022, 16, 10163–10178. [Google Scholar] [CrossRef] [Scilit]
  206. Tsioris, K.; Raja, W.K.; Pritchard, E.M.; Panilaitis, B.; Kaplan, D.L.; Omenetto, F.G. Fabrication of Silk Microneedles for Controlled-Release Drug Delivery. Adv. Funct. Mater. 2012, 22, 330–335. [Google Scholar] [CrossRef] [Scilit]
  207. Gao, B.; Guo, M.; Lyu, K.; Chu, T.; He, B. Intelligent Silk Fibroin Based Microneedle Dressing (i-SMD). Adv. Funct. Mater. 2021, 31, 2006839. [Google Scholar] [CrossRef] [Scilit]
  208. Jamaledin, R.; Yiu, C.K.Y.; Zare, E.N.; Niu, L.N.; Vecchione, R.; Chen, G.; Gu, Z.; Tay, F.R.; Makvandi, P. Advances in Antimicrobial Microneedle Patches for Combating Infections. Adv. Mater. 2020, 32, e2002129. [Google Scholar] [CrossRef] [Scilit]
  209. Li, W.X.; Zhang, X.P.; Chen, B.Z.; Fei, W.M.; Cui, Y.; Zhang, C.Y.; Guo, X.D. An update on microneedle-based systems for diabetes. Drug Deliv. Transl. Res. 2022, 12, 2275–2286. [Google Scholar] [CrossRef] [Scilit]
  210. Szabó, A.; De Decker, I.; Semey, S.; Claes, K.E.; Blondeel, P.; Monstrey, S.; Dorpe, J.V.; Van Vlierberghe, S. Photo-crosslinkable polyester microneedles as sustained drug release systems toward hypertrophic scar treatment. Drug Deliv. 2024, 31, 2305818. [Google Scholar] [CrossRef] [Scilit]
  211. Aziz, A.Y.R.; Mahfufah, U.; Syahirah, N.A.; Habibie; Asri, R.M.; Yulianty, R.; Kastian, R.F.; Sari, Y.W.; Chabib, L.; Hamzah, H.; et al. Dual delivery systems combining nanocrystals and dissolving microneedles for improved local vaginal delivery of fluconazole. Drug Deliv. Transl. Res. 2024, 14, 1678–1692. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  212. Sun, B.; Zhang, T.; Chen, H.; Gao, W.; Zhou, J.; Chen, Y.; Ding, W.; Yin, X.; Ren, J.; Hua, C.; et al. Microneedle delivery system with rapid dissolution and sustained release of bleomycin for the treatment of hemangiomas. J. Nanobiotechnol. 2024, 22, 372. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  213. Ou Yang, M.W.; Hu, L.F.; Feng, Y.H.; Li, X.; Peng, J.; Yu, R.; Zhang, C.Y.; Chen, B.Z.; Guo, X.D. Hybrid Microneedle-Mediated Transdermal Delivery of Atorvastatin Calcium-Loaded Polymeric Micelles for Hyperlipidemia Therapy. ACS Appl. Bio Mater. 2024, 7, 4051–4061. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  214. Cai, G.; Li, R.; Chai, X.; Cai, X.; Zheng, K.; Wang, Y.; Fan, K.; Guo, Z.; Guo, J.; Jiang, W. Catalase-templated nanozyme-loaded microneedles integrated with polymyxin B for immunoregulation and antibacterial activity in diabetic wounds. J. Colloid Interface Sci. 2024, 667, 529–542. [Google Scholar] [CrossRef] [Scilit]
  215. Zhou, X.; Liu, H.; Yu, Z.; Yu, H.; Meng, D.; Zhu, L.; Li, H. Direct 3D printing of triple-responsive nanocomposite hydrogel microneedles for controllable drug delivery. J. Colloid Interface Sci. 2024, 670, 1–11. [Google Scholar] [CrossRef] [Scilit]
  216. Yu, X.; Wang, C.; Wang, Y.; Li, L.; Gao, X.; Zhu, T.; An, P.; Meng, Z.; Wang, W.; Wu, T.; et al. Microneedle Array Patch Made of Kangfuxin/Chitosan/Fucoidan Complex Enables Full-Thickness Wound Healing. Front. Chem. 2022, 10, 838920. [Google Scholar] [CrossRef] [Scilit]
  217. Abou Zekry, S.S.; Abdellatif, A.; Azzazy, H.M.E. Fabrication of pomegranate/honey nanofibers for use as antibacterial wound dressings. Wound Med. 2020, 28, 100181. [Google Scholar] [CrossRef] [Scilit]
  218. Chen, S.; Wang, H.; Su, Y.; John, J.V.; McCarthy, A.; Wong, S.L.; Xie, J. Mesenchymal stem cell-laden, personalized 3D scaffolds with controlled structure and fiber alignment promote diabetic wound healing. Acta Biomater. 2020, 108, 153–167. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  219. Naeimi, A.; Payandeh, M.; Ghara, A.R.; Ghadi, F.E. In vivo evaluation of the wound healing properties of bio-nanofiber chitosan/polyvinyl alcohol incorporating honey and Nepeta dschuparensis. Carbohydr. Polym. 2020, 240, 116315. [Google Scholar] [CrossRef] [Scilit]
  220. Larijani, G.; Parivar, K.; Hayati Roodbari, N.; Yaghmaei, P.; Amini, N. Fortified electrospun collagen utilizing biocompatible Poly Glycerol Sebacate prepolymer (PGSp) and zink oxide nanoparticles (ZnO NPs) for diabetics wound healing: Physical, biological and animal studies. Regen. Ther. 2024, 26, 102–113. [Google Scholar] [CrossRef] [Scilit]
  221. Li, X.; Jiang, F.; Duan, Y.; Li, Q.; Qu, Y.; Zhao, S.; Yue, X.; Huang, C.; Zhang, C.; Pan, X. Chitosan electrospun nanofibers derived from Periplaneta americana residue for promoting infected wound healing. Int. J. Biol. Macromol. 2023, 229, 654–667. [Google Scholar] [CrossRef] [Scilit]
  222. Costa, N.N.; de Faria Lopes, L.; Ferreira, D.F.; de Prado, E.M.L.; Severi, J.A.; Resende, J.A.; de Paula Careta, F.; Ferreira, M.C.P.; Carreira, L.G.; de Souza, S.O.L.; et al. Polymeric films containing pomegranate peel extract based on PVA/starch/PAA blends for use as wound dressing: In vitro analysis and physicochemical evaluation. Mater. Sci. Eng. C Mater. Biol. Appl. 2020, 109, 110643. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  223. Huang, S.; Fu, X. Naturally derived materials-based cell and drug delivery systems in skin regeneration. J. Control. Release 2010, 142, 149–159. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  224. Bonifácio, B.V.; Silva, P.B.; Ramos, M.A.; Negri, K.M.; Bauab, T.M.; Chorilli, M. Nanotechnology-based drug delivery systems and herbal medicines: A review. Int. J. Nanomed. 2014, 9, 1–15. [Google Scholar] [CrossRef] [Scilit]
  225. Lopes Rocha Correa, V.; Assis Martins, J.; Ribeiro de Souza, T.; de Castro Nunes Rincon, G.; Pacheco Miguel, M.; Borges de Menezes, L.; Correa Amaral, A. Melatonin loaded lecithin-chitosan nanoparticles improved the wound healing in diabetic rats. Int. J. Biol. Macromol. 2020, 162, 1465–1475. [Google Scholar] [CrossRef] [Scilit]
  226. Kumar, M.; Mahmood, S.; Chopra, S.; Bhatia, A. Biopolymer based nanoparticles and their therapeutic potential in wound healing—A review. Int. J. Biol. Macromol. 2024, 267, 131335. [Google Scholar] [CrossRef] [Scilit]
  227. Farshidfar, N.; Iravani, S.; Varma, R.S. Alginate-Based Biomaterials in Tissue Engineering and Regenerative Medicine. Mar. Drugs 2023, 21, 189. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  228. Kato, Y.; Onishi, H.; Machida, Y. Application of chitin and chitosan derivatives in the pharmaceutical field. Curr. Pharm. Biotechnol. 2003, 4, 303–309. [Google Scholar] [CrossRef] [Scilit]
  229. Mndlovu, H.; du Toit, L.C.; Kumar, P.; Choonara, Y.E.; Marimuthu, T.; Kondiah, P.P.D.; Pillay, V. Bioplatform Fabrication Approaches Affecting Chitosan-Based Interpolymer Complex Properties and Performance as Wound Dressings. Molecules 2020, 25, 222. [Google Scholar] [CrossRef] [Scilit]
  230. Hussain, Z.; Thu, H.E.; Shuid, A.N.; Katas, H.; Hussain, F. Recent Advances in Polymer-based Wound Dressings for the Treatment of Diabetic Foot Ulcer: An Overview of State-of-the-art. Curr. Drug Targets 2018, 19, 527–550. [Google Scholar] [CrossRef] [Scilit]
  231. Hafezi, F.; Scoutaris, N.; Douroumis, D.; Boateng, J. 3D printed chitosan dressing crosslinked with genipin for potential healing of chronic wounds. Int. J. Pharm. 2019, 560, 406–415. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  232. Weller, C.D.; Team, V.; Sussman, G. First-Line Interactive Wound Dressing Update: A Comprehensive Review of the Evidence. Front. Pharmacol. 2020, 11, 155. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  233. Chang, W.; Chen, L.; Chen, K. The bioengineering application of hyaluronic acid in tissue regeneration and repair. Int. J. Biol. Macromol. 2024, 270, 132454. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  234. Hassan, M.A.; Basha, A.A.; Eraky, M.; Abbas, E.; El-Samad, L.M. Advancements in silk fibroin and silk sericin-based biomaterial applications for cancer therapy and wound dressing formulation: A comprehensive review. Int. J. Pharm. 2024, 662, 124494. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  235. Monika, P.; Chandraprabha, M.N.; Radhakrishnan, V.; Somayaji, P.; Sabu, L. Therapeutic potential of silkworm sericin in wound healing applications. Wound Repair Regen. 2024. ahead of print. [Google Scholar] [CrossRef] [Scilit]
  236. González-Restrepo, D.; Zuluaga-Vélez, A.; Orozco, L.M.; Sepúlveda-Arias, J.C. Silk fibroin-based dressings with antibacterial and anti-inflammatory properties. Eur. J. Pharm. Sci. 2024, 195, 106710. [Google Scholar] [CrossRef] [Scilit]
  237. Mehrabani, M.G.; Karimian, R.; Rakhshaei, R.; Pakdel, F.; Eslami, H.; Fakhrzadeh, V.; Rahimi, M.; Salehi, R.; Kafil, H.S. Chitin/silk fibroin/TiO2 bio-nanocomposite as a biocompatible wound dressing bandage with strong antimicrobial activity. Int. J. Biol. Macromol. 2018, 116, 966–976. [Google Scholar] [CrossRef] [Scilit]
  238. Norman, G.; Westby, M.J.; Rithalia, A.D.; Stubbs, N.; Soares, M.O.; Dumville, J.C. Dressings and topical agents for treating venous leg ulcers. Cochrane Database Syst. Rev. 2018, 6, Cd012583. [Google Scholar] [CrossRef] [Scilit]
  239. Jiang, P.; Li, Q.; Luo, Y.; Luo, F.; Che, Q.; Lu, Z.; Yang, S.; Yang, Y.; Chen, X.; Cai, Y. Current status and progress in research on dressing management for diabetic foot ulcer. Front. Endocrinol. 2023, 14, 1221705. [Google Scholar] [CrossRef] [Scilit]
  240. Chaudhary, K.; Kumar, R.; Singh, S.; Tuknait, A.; Gautam, A.; Mathur, D.; Anand, P.; Varshney, G.C.; Raghava, G.P. A Web Server and Mobile App for Computing Hemolytic Potency of Peptides. Sci. Rep. 2016, 6, 22843. [Google Scholar] [CrossRef] [Scilit]
  241. Muttenthaler, M.; King, G.F.; Adams, D.J.; Alewood, P.F. Trends in peptide drug discovery. Nat. Rev. Drug Discov. 2021, 20, 309–325. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  242. Basith, S.; Manavalan, B.; Hwan Shin, T.; Lee, G. Machine intelligence in peptide therapeutics: A next-generation tool for rapid disease screening. Med. Res. Rev. 2020, 40, 1276–1314. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  243. Zhou, P.; Wang, C.; Ren, Y.; Yang, C.; Tian, F. Computational peptidology: A new and promising approach to therapeutic peptide design. Curr. Med. Chem. 2013, 20, 1985–1996. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  244. Robles-Loaiza, A.A.; Pinos-Tamayo, E.A.; Mendes, B.; Ortega-Pila, J.A.; Proaño-Bolaños, C.; Plisson, F.; Teixeira, C.; Gomes, P.; Almeida, J.R. Traditional and Computational Screening of Non-Toxic Peptides and Approaches to Improving Selectivity. Pharmaceuticals 2022, 15, 323. [Google Scholar] [CrossRef] [Scilit]
  245. Goles, M.; Daza, A.; Cabas-Mora, G.; Sarmiento-Varón, L.; Sepúlveda-Yañez, J.; Anvari-Kazemabad, H.; Davari, M.D.; Uribe-Paredes, R.; Olivera-Nappa, Á.; Navarrete, M.A.; et al. Peptide-based drug discovery through artificial intelligence: Towards an autonomous design of therapeutic peptides. Brief Bioinform. 2024, 25, bbae275. [Google Scholar] [CrossRef] [Scilit]
  246. Thapa, R.K.; Diep, D.B.; Tønnesen, H.H. Topical antimicrobial peptide formulations for wound healing: Current developments and future prospects. Acta Biomater. 2020, 103, 52–67. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Schematic diagram of each stage of wound healing. Hemostasis phase: vasoconstriction, platelet aggregation, and fibrin formation. Inflammatory phase: monocytes migrate to the wound and differentiate into M1 macrophages. M1 macrophages secrete inflammatory mediators and transform into M2 macrophages. M2 macrophages secrete growth factors. Proliferation phase: angiogenesis, fibroblast proliferation, myofibroblast differentiation, and collagen deposition. Remodeling period: fibroblasts differentiate into myofibroblasts, producing type I and III collagen. In the later stage, MMPs degrade type III collagen, and type I collagen forms scars.
Figure 1. Schematic diagram of each stage of wound healing. Hemostasis phase: vasoconstriction, platelet aggregation, and fibrin formation. Inflammatory phase: monocytes migrate to the wound and differentiate into M1 macrophages. M1 macrophages secrete inflammatory mediators and transform into M2 macrophages. M2 macrophages secrete growth factors. Proliferation phase: angiogenesis, fibroblast proliferation, myofibroblast differentiation, and collagen deposition. Remodeling period: fibroblasts differentiate into myofibroblasts, producing type I and III collagen. In the later stage, MMPs degrade type III collagen, and type I collagen forms scars.
Ijms 25 12561 g001
Figure 2. Crosstalk relationships between signaling pathways. The TGF-β signaling pathway is activated by cytokines, growth factors, or mechanical stress, regulating various cellular processes such as proliferation, differentiation, migration, apoptosis, and ECM synthesis. The PI3K/AKT pathway is initiated by the binding of cytokines and growth factors to RTKs and is related to the formation of the epidermal barrier, collagen synthesis, and angiogenesis. The typical pathway of the NF-κB signaling pathway closely related to wounds is activated by stimuli such as cytokine receptors, TNFR, PRRs, TCR, and BCR, which improve the inflammatory microenvironment of wounds and regulate the immune system through their anti-inflammatory and antioxidant effects. The JAK/STAT signaling pathway is activated by the binding of cytokines and growth factors to their specific receptors, the phosphorylation of JAKs and STATs, and is involved in regulating inflammation, angiogenesis, cell proliferation and migration, and ECM formation. The four key pathways interact with each other and work together at various stages of wound healing.
Figure 2. Crosstalk relationships between signaling pathways. The TGF-β signaling pathway is activated by cytokines, growth factors, or mechanical stress, regulating various cellular processes such as proliferation, differentiation, migration, apoptosis, and ECM synthesis. The PI3K/AKT pathway is initiated by the binding of cytokines and growth factors to RTKs and is related to the formation of the epidermal barrier, collagen synthesis, and angiogenesis. The typical pathway of the NF-κB signaling pathway closely related to wounds is activated by stimuli such as cytokine receptors, TNFR, PRRs, TCR, and BCR, which improve the inflammatory microenvironment of wounds and regulate the immune system through their anti-inflammatory and antioxidant effects. The JAK/STAT signaling pathway is activated by the binding of cytokines and growth factors to their specific receptors, the phosphorylation of JAKs and STATs, and is involved in regulating inflammation, angiogenesis, cell proliferation and migration, and ECM formation. The four key pathways interact with each other and work together at various stages of wound healing.
Ijms 25 12561 g002
Table 1. Summary of proteins and peptides from animal sources that promote wound healing.
Table 1. Summary of proteins and peptides from animal sources that promote wound healing.
SourceSpeciesActive IngredientAcquisition MethodEffect on Wound HealingRef.
EarthwormEisenia foetidaG-90Remove impurities with chloroform
Extract with methanol and water
Promote EGF generation
Promote proliferation of fibroblasts and epithelial cells
[23,24]
Ohira the 2ndEEUltrafiltrationStimulate cytokine secretion
Anti-inflammatory
Increase the synthesis of collagen
Promote blood capillary
Promote fibroblast proliferation
[10]
Ohira the 2ndEE-1Ultrafiltration, dialysisActivate angiogenesis
Activate epithelial regeneration
Inhibite fibrosis
Inhibite of scar formation
[25]
Eisenia foetidaES-2Homogenize, dialysis, salting outStimulate VEGF production
Promote proliferation of fibroblasts and keratinocytes
[26]
Eisenia foetidaG-90′Homogenize, dialysis, salting outUpregulate expression of proteins HSP70 and lysozyme[27]
Eisenia Andreicol4a1Sonication, centrifuge, filterActivate the RAS/MAPK signaling pathway
Activate the proliferation of fibroblasts
[13]
Pheretima vulgaris ChenPvE-3Extracted by water
Precipitated by ethanol
Anti-inflammatory
Stimulate granulation formation
Enhance the secretion of α-SMA
Promote the neovascularization and collagen fiber synthesis
[28]
Eisenia foetidaES2Dialysis, centrifugePromote the secretion of cytokines
Promote the synthesis and accumulation of collagen
[29]
earthwormEAP——Accelerate the proliferation of NIH3T3
Promote the expression of cyclins
[30]
Periplaneta Periplaneta americana L. PALEthanol extractionRegulate cell cycle
Promote cytokine secretion
Accelerate epithelial cell growth
Promote angiogenesis
[31]
Periplaneta americanaPaPPc2 and PaPPc3Reflux extracted by water
Precipitated by ethanol
Anion exchange chromatography
Promote angiogenesis
Promote collagen synthesis
[32]
Periplaneta americanaPAEEthanol extraction, filterEnhance epithelial repair, follicle regeneration, and fibrous tissue proliferation[19]
AmphibiansAmolops jingdongensisBv8-AJLadder sequencing determines amino acid sequence
Synthetic peptides
Anti-inflammatory
Promote IL-1 generation
Promote proliferation of fibroblasts and keratinocytes
[33]
Duttaphrynus melanostictuscathelicidin-DMcDNAs synthesis for determining amino acid
Sequences of synthetic peptides
Facilitate the proliferation of human umbilical vein endothelial
cells (HUVECs), human skin fibroblasts (HSFs), and human immortalized epidermal cells (HaCaTs)
Promote the migration of HUVEC and HSF cells
Promote the differentiation of fibroblasts into myofibroblasts
[34]
Hyla annectansFW-1 and FW-2cDNAs synthesis for determining Amino AcidAnti-inflammatory
Antioxidant
[35]
Nanorana ventripunctataCathelicidin-NVLadder sequencing determines amino acid sequence
Synthetic peptides
Promote the expression of cytokine
Enhance the proliferation of keratinocyte and fibroblast cells
Promte the differentiation of fibroblasts to myofibroblasts
Promote collagen production
[36]
Nanorana ventripunctataAntioxidin-NVLadder sequencing and cDNAs synthesis determines amino acid sequence
Synthetic peptides
Anti-inflammatory
Antioxidant
Alleviate DNA damage
Alleviate cell apoptosis
[37]
Odorrana andersoniiOA-GL21Ladder sequencing and cDNAs synthesis determines amino acid sequence
Synthetic peptides
Induce the migration of HaCaT and HSF cells
Promote re-epithelialization
Promote formation of granulation tissue
[38]
Odorrana andersoniiOA-GL12cDNA synthesis, Illumina MiSeq sequencing,
Synthetic peptides
Promote the expression of cytokine
Anti-inflammatory
Antioxidant
[39]
Odorrana andersoniiOA-GL17dDNA cloning, mass spectrometry and Edman degradation determines amino acid sequence.
Synthetic peptides
Promote the expression of TGF-β1[40]
Odorrana grahamiAH90Solid-phase synthesisInduce the release of TGF-β1[41]
Odorrana grahamiCW49Solid-phase synthesisAnti-inflammatory
Promote angiogenesis
[42]
Odorrana margaretaeOM-LV20Edman degradation and cDNA cloning determines amino acid sequence.
Synthetic peptides
Induce the proliferation of HaCaTs[43]
Odorrana andersoniiCathelicidin-OA1Ladder sequencing and cDNAs synthesis determines amino acid sequence
Synthetic peptides
Enhance the recruitment of macrophages
Accelerating re-epithelialization
Enhance granulation tissue formation
[44]
Odorrana tormota.Ot-WHPSynthetic peptidesElicite the production of regulatory factors
Initiate and accelerate the inflammatory phase
Promote keratinocyte migration
[45]
Pelophylax kl. EsculentusBrevinin-2TaDNA cloning, and mass spectrometry determines amino acid sequence
Solid-phase synthesis
Anti-inflammatory
Promote epithelial migration
Promote angiogenesis
[46]
Pelophylax nigromaculatusBrevinin-2PNcDNA sequencing determines amino acid sequence.Accelerate the healing of HSF scratches
Enhance cell migration
Stimulate gene expression of growth factors
[47]
Polypedates megacephalusPM-7Ladder sequencing determines amino acid sequenceEnhance proliferation and migration in HUVECs and HSFs[48]
Rana limnocharisRL-RL10——Promote proliferation and migration of keratinocytes[49]
Rana limnocharisRL-QN15Ladder sequencing determines amino acid sequence
Synthetic peptides
Modulate the secretion of cytokines
Regulate the generation of TGF-β1 and TGF-β3
Accelerated re-epithelialization and granulation tissue formation
[50]
Tylototriton verrucosusTylotoinLadder sequencing and cDNA synthesis determines amino acid sequence
Synthetic peptides
Promote the release of TGF-β1 and IL-6
Enhance the motility and proliferation of keratinocytes vascular endothelial cells, and fibroblasts
Accelerate re-epithelialization and granulation tissue formation
[51]
salamander Tylototriton kweichowensisTK-CATHcDNAs synthesis determines amino acid sequence
Synthetic peptides
Anti-inflammatory
Promote the expression of cytokines
Promote the motility and proliferation of keratinocytes
[52]
Marine organismsOreochromis niloticusTP2-5 and TP2-6Solid-phase synthesisPromote the motility and proliferation of cells
Promote neovascularization
Promote the release of cytokines
[18]
Sea cucumberVTPY and VLLYSynthetic peptidesPromote the proliferation and migration of HSFs and HUVECs
Increase mitochondrial respiratory capacity
Block the binding of MKP to ERK2 and PHLPP to AKT
[53]
sea cucumber (S. japonicus)SCPAlkali soluble acid precipitation method
Anion ion exchange chromatography
Boost epithelialization, dermis integrity, vascularization, and collagen deposition
Adjust the immune cells
[54]
Sipunculus
nudus
SNCPHydrolyzed with acetic acid solution with pepsinReduce inflammation
Improve collagen deposition and recombination
Blockade of the TGF-β/Smads signaling pathway
[3]
Salmon salarSs-SCPHydrolyzed with collagenase and compound proteaseUpregulate wound NOD2 and BD14
Implicate in microflora colonization regulation
Control inflammatory reaction
Increase wound angiogenesis and collagen deposition
[55]
Tilapia niloticaTn-SCP——Upregulate wound NOD2 and BD14
Implicate in microflora colonization regulation
Control inflammatory reaction
Increase wound angiogenesis and collagen deposition
[55]
Nibea japonicaMCPsHydrolyzed with neutral proteaseIncrease the protein levels of NF-κB p65, IKKα and IKKβ
Increase the expression of EGF, FGF, VEGF, and TGF-β
[56]
Theragra chalcogrammaPCPEnzymolysis, ultrafiltrationPromote the expression of cytokines
Increase wound healing rate, hydroxylproline content, collagen deposition and tensile strength
[57]
Theragra chalcogrammaFPPHydrolyzed with trypsin and alkaline proteasePromote the expression of cytokines
Increase wound healing rate, hydroxylproline content, collagen deposition and tensile strength
[57]
ScorpionsScorpionSVAP——Anti-inflammatory
Anti-infective
[58]
Tityus stigmurus.StigmurinSynthetic peptidesAntioxidant
Antibacterial
[59]
Table 2. Wound-healing peptides relevant for amphibian skin defense.
Table 2. Wound-healing peptides relevant for amphibian skin defense.
PeptideAA SequencesLength
(AA)
N-ModificationC-ModificationDisulfide BondSpeciesRef.
Bv8-AJAVITGACERDVQCGGGTCCAVSLWMQGLRICTPLGRQGENCHPASRKVPFAGLRLHNSCPCQSNLACKTLPNGKYQCMPS81 +Amolops jingdongensis[33]
BombesinQRLGNQWAVGHLM13Pyr Bombina bombina
Bombina variegata
Bombina orientalis
[99]
Cathelicidin-DMSSRRKPCKGWLCKLKLRGGYTLIGSATNLNRPTYVRA37 +Duttaphrynus melanostictus[34,100]
FW-1FWPLI5 NH2 Hyla annectans[35]
FW-2FWPMI5 NH2 Hyla annectans[35]
Cathelicidin-NVARGKKECKDDRCRLLMKRGSFSYV24 +Nanorana ventripunctata[36]
Antioxidin-NVGWANTLKNVAGGLCKMTGAA21 Nanorana ventripunctata[37]
OA-GL21dGLLSGHYGRVVSTQSGHYGRG21 Odorrana andersonii[38]
OA-GL12GLLSGINAEWPC12 Odorrana andersonii[39]
OA-GL17GLFKWHPRCGEEQSMWT17 Odorrana andersonii[40]
AH-90ATAWDFGPHGLLPIRPIRIRPLCG25 Odorrana grahami[41]
CW49APFRMGICTTN11 Odorrana grahami[42]
Cathelicidin-OA1IGRDPTWSHLAASCLKCIFDDLPKTHN27 Odorrana margaretae[44]
Ot-WHPATAWDLGPHGIRPLRPIRIRPLCG24 Odorrana tormota[45]
Brevinin-2TaGILDTLKNLAKTAGKGILKSLVNTASCKLSGQC33 +Pelophylax kl. Esculentus[46]
Brevinin-2PNGLMDSLKGLAATAGKTVLQGLLKTASCKLEKTC33 +Pelophylax nigromaculatus[47]
PM-7FLNWRRILFLKVVR14 Polypedates megacephalus[48]
RL-RL10RLFKCWKKDS10 Rana limnocharis[49]
RL-QN15QNSYADLWCQFHYMC15 +Rana limnocharis[50]
TylotoinKCVRQNNKRVCK14 +Tylototriton verrucosus[51]
TK-CATHGGQDTGKEGETGKKKKSDNWFMNLLNKFLELIGLKEAGDD
SEPFCFTCIFDMFSQ
55 Tylototriton
kweichowensis
[52]
Table 3. Pathways by which animal protein and peptide components promote wound healing.
Table 3. Pathways by which animal protein and peptide components promote wound healing.
Signaling PathwayComponents
PI3K/AKTEAP [30], ES2 [29], col4a1 [13], PvESII [28], Tylotoin [51], TK-CATH [52], AH-90 [41], Ot-WHP [45], Bv8-AJ [33], RL-QN15 [50], VTPY and VLLY [53], SCP [54]
TGF-BetaAH-90 [41], SNCP [3], Ot-WHP [45], RL-QN15 [50], PAE [19], Antioxidin-NV [37], OA-GL17d [80]
NF-κBAH-90 [41], Ot-WHP [45], FW-1 [35], FW-2 [35], MCPs [56]
JAK/STATPAE [19]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Fan, X.; Ye, J.; Zhong, W.; Shen, H.; Li, H.; Liu, Z.; Bai, J.; Du, S. The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. Int. J. Mol. Sci. 2024, 25, 12561. https://doi.org/10.3390/ijms252312561

AMA Style

Fan X, Ye J, Zhong W, Shen H, Li H, Liu Z, Bai J, Du S. The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. International Journal of Molecular Sciences. 2024; 25(23):12561. https://doi.org/10.3390/ijms252312561

Chicago/Turabian Style

Fan, Xiaoyu, Jinhong Ye, Wanling Zhong, Huijuan Shen, Huahua Li, Zhuyuan Liu, Jie Bai, and Shouying Du. 2024. "The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review" International Journal of Molecular Sciences 25, no. 23: 12561. https://doi.org/10.3390/ijms252312561

APA Style

Fan, X., Ye, J., Zhong, W., Shen, H., Li, H., Liu, Z., Bai, J., & Du, S. (2024). The Promoting Effect of Animal Bioactive Proteins and Peptide Components on Wound Healing: A Review. International Journal of Molecular Sciences, 25(23), 12561. https://doi.org/10.3390/ijms252312561

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop