Therapeutic peptides have emerged as a promising frontier in the development of anti-cancer agents, classified into three main groups: antimicrobial/pore-forming peptides, cell-permeable peptides, and tumor-targeting peptides. This classification, delineates the diverse cellular targets of these peptides, offering a comprehensive perspective on their potential applications in cancer treatment. Antimicrobial/pore-forming peptides (AMPs) represent a subset of these therapeutic peptides with natural occurrences across living organisms, integral to the innate immune defense mechanism. This study focuses on a bioassay-guided fractionation approach to purify a bioactive peptide (PAP) from the soft body tissue of marine gastropod T. radiatus, highlighting its multifaceted properties, and utilizing sequential procedures such as ammonium sulfate precipitation, cation exchange chromatography, and gel filtration chromatography. The purified antibacterial peptide (PAP), exhibited exceptional efficacy against both Gram-positive and Gram-negative bacteria, demonstrating particular sensitivity towards E. faecium, K. pneumoniae, and S. dysenteriae. Further characterization revealed PAP’s stability across broad pH and temperature ranges, serum stability, and the ability to form membrane pores, as evidenced by SEM analysis. PAP displayed stability across diverse conditions and the ability to form membrane pores, suggesting a potent antimicrobial mechanism. Significantly, PAP demonstrated noteworthy anticancer activities by inhibiting proliferation in lung cancer cell lines (A549 and NCI-H460) in a concentration-dependent manner, while exhibiting non-cytotoxicity to normal cells. This selective anticancer effect was further evidenced by the promotion of angiogenesis in chick embryos. The amino acid sequence of PAP (MSMGSFGFALAVMVLAVLVASAAGAPNTNLVSSACNGNKIPSGNPFFNNLGALLVDLEK) and its three-helix structure with an extended loop were determined through MALDI-TOF-MS/MS analysis and in-silico modeling, respectively.
In conclusion, this research unveils the multifaceted nature of the bioactive peptide from T. radiatus, emphasizing its dual-action as a potent antimicrobial agent and a selective anticancer drug candidate. These findings underscore the potential therapeutic significance of marine peptides in addressing global health challenges, particularly in the context of antimicrobial resistance and cancer treatment.
Author Contributions
K.N. conceived and designed the study, analyzed data, drafted and revised the manuscript; L.S. contributed to data analysis, manuscript drafting, and revision; S.P. provided guidance, supervised the study, and critically revised the manuscript. All authors approved the final version for publication.
Funding
This research received financial support from the Government of India through the Science and Engineering Research Board, EMEQ grant no.: SB/EMEQ-034/2014, dated 06.07.2015, and the University Grants Commission, Lr.No.: F1-17.1/2017-18/RGNF-2017-18-SC-TAM-45554, dated 16.08.2017, under the scheme National Fellowship for Scheduled Caste. We sincerely thank both organizations for their generous support.
Institutional Review Board Statement
Not applicable; the study did not require ethical approval.
Informed Consent Statement
Not applicable; no human participants were involved in this study.
Data Availability Statement
The data that support the findings of this study are available from the corresponding author upon reasonable request.
Conflicts of Interest
The authors declare no conflicts of interest.
| Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
