Self-Assembled Peptide Hydrogels PPI45 and PPI47: Novel Drug Candidates for Staphylococcus aureus Infection Treatment
Abstract
1. Introduction
2. Results and Discussion
2.1. Peptide Design and Analysis
2.2. Expression and Purification of Derived Peptides
2.3. Self-Assembly Gelation Analysis
2.4. In Vitro Bacteriostatic Efficacy and Safety
2.5. The Mechanism of Peptides on Cell Membranes
2.6. Effect of Peptides on Metabolic Activity
3. Conclusions
4. Materials and Methods
4.1. Reagents
4.2. Equipments
4.3. Strains
4.4. Expression and Purification of PPI42 and Its Derived Peptides
4.5. Concentration- and pH-Responsive Gelation
4.6. Viscosity
4.7. ANS Fluorescence Spectra and CMC
4.8. TEM Observation of Self-Assembled AMPs
4.9. MIC Assay
4.10. MBC Assay
4.11. Time-Dependent Bactericidal Kinetic Curve
4.12. PAE Assay
4.13. Hemolytic
4.14. Cytotoxicity Analysis
4.15. Cell Membrane Integrity Analysis
4.16. SEM Observations
4.17. Membrane Potential
4.18. Bacterial Metabolic Activity
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Holmes, A.H.; Moore, L.S.P.; Sundsfjord, A.; Steinbakk, M.; Regmi, S.; Karkey, A.; Guerin, P.J.; Piddock, L.J.V. Understanding the Mechanisms and Drivers of Antimicrobial Resistance. Lancet 2016, 387, 176–187. [Google Scholar] [CrossRef]
- Antimicrobial Resistance Collaborators. Global Burden of Bacterial Antimicrobial Resistance in 2019: A Systematic Analysis. Lancet 2022, 399, 629–655. [Google Scholar] [CrossRef]
- Nizet, V. Antimicrobial Peptide Resistance Mechanisms of Human Bacterial Pathogens. Curr. Issues. Mol. Bio. 2006, 8, 11–26. [Google Scholar]
- Gallo, E.; Diaferia, C.; Balasco, N.; Sibillano, T.; Roviello, V.; Giannini, C.; Vitagliano, L.; Morelli, G.; Accardo, A. Fabrication of Fluorescent Nanospheres by Heating PEGylated Tetratyrosine Nanofibers. Sci. Rep. 2021, 11, 2470. [Google Scholar] [CrossRef] [PubMed]
- Shenoy, D.; Chivukula, S.; Erdogan, N.; Chiesa, E.; Pellegrino, S.; Reches, M.; Genta, I. Self-assembled Peptide-based Nanofibers for Cardiovascular Tissue Regeneration. J. Mater. Chem. B 2025. [Google Scholar] [CrossRef]
- Tarabout, C.; Roux, S.; Gobeaux, F.; Fay, N.; Pouget, E.; Meriadec, C.; Ligeti, M.; Thomas, D.; Ijsselstijn, M.; Besselievre, F.; et al. Control of Peptide Nanotube Diameter by Chemical Modifications of an Aromatic Residue Involved in a Single Close Contact. Proc. Natl. Acad. Sci. USA 2011, 108, 7679–7684. [Google Scholar] [CrossRef] [PubMed]
- Yu, W.K.; Sun, Y.; Li, W.Y.; Guo, X.; Liu, X.S.; Wu, W.P.; Yu, W.Q.; Wang, J.J.; Shan, A.S. Self-Assembly of Antimicrobial Peptide-Based Micelles Breaks the Limitation of Trypsin. ACS Appl. Mater. Interfaces 2023, 15, 494–510. [Google Scholar] [CrossRef]
- Reches, M.; Gazit, E. Casting Metal Nanowires within Discrete Self-assembled Peptide Nanotubes. Science 2003, 300, 625–627. [Google Scholar] [CrossRef] [PubMed]
- Mart, R.J.; Osborne, R.D.; Stevens, M.M.; Ulijn, R.V. Peptide-based Stimuli-responsive Biomaterials. Soft Matter 2006, 2, 822–835. [Google Scholar] [CrossRef] [PubMed]
- Richardson, J.J.; Bjoernmalm, M.; Caruso, F. Technology-driven Layer-by-layer Assembly of Nanofilms. Science 2015, 348, aaa2491. [Google Scholar] [CrossRef]
- Salick, D.A.; Pochan, D.J.; Schneider, J.P. Design of an Injectable β-Hairpin Peptide Hydrogel That Kills Methicillin-Resistant Staphylococcus aureus. Adv. Mater. 2009, 21, 4120. [Google Scholar] [CrossRef]
- Schneider, J.P.; Pochan, D.J.; Ozbas, B.; Rajagopal, K.; Pakstis, L.; Kretsinger, J. Responsive Hydrogels from the Intramolecular Folding and Self-assembly of a Designed Peptide. J. Am. Chem. Soc. 2002, 124, 15030–15037. [Google Scholar] [CrossRef]
- Green, B.D.; Gault, V.A.; Mooney, M.H.; Irwin, N.; Harriott, P.; Greer, B.; Bailey, C.J.; Oharte, F.P.M.; Flatt, P.R. Degradation, Receptor Binding, Insulin Secreting and Antihyperglycaemic Actions of Palmitate-derivatised Native and Ala8-substituted GLP-1 Analogues. Biol. Chem. 2004, 385, 169–177. [Google Scholar] [CrossRef]
- Tu, Z.; Ha, J.; Kharldia, R.; Meng, X.G.; Liang, J.F. Improved Stability and Selectivity of Lytic Peptides through Self-assembly. Biochem. Biophys. Res. Commun. 2007, 361, 712–717. [Google Scholar] [CrossRef]
- Chen, L.; Liang, J.F. Peptide Fibrils with Altered Stability, Activity, and Cell Selectivity. Biomacromolecules 2013, 14, 2326–2331. [Google Scholar] [CrossRef] [PubMed]
- Schneider, T.; Kruse, T.; Wimmer, R.; Wiedemann, I.; Sass, V.; Pag, U.; Jansen, A.; Nielsen, A.K.; Mygind, P.H.; Ravents, D.S.; et al. Plectasin, a Fungal Defensin, Targets the Bacterial Cell Wall Precursor Lipid II. Science 2010, 328, 1168–1172. [Google Scholar] [CrossRef] [PubMed]
- Cao, S.; Liu, Y.; Shang, H.; Li, S.; Jiang, J.; Zhu, X.; Zhang, P.; Wang, X.; Li, J. Supramolecular Nanoparticles of Calcitonin and Dipeptide for Long-term Controlled Release. J. Control. Release 2017, 256, 182–192. [Google Scholar] [CrossRef]
- Rahman, M.A.; Bam, M.; Luat, E.; Jui, M.S.; Ganewatta, M.S.; Shokfai, T.; Nagarkatti, M.; Decho, A.W.; Tang, C. Macromolecular-clustered Facial Amphiphilic Antimicrobials. Nat. Commun. 2018, 9, 5231. [Google Scholar] [CrossRef]
- Al-Ahmad, A.; Laird, D.; Zou, P.; Tomakidi, P.; Steinberg, T.; Lienkamp, K. Nature-Inspired Antimicrobial Polymers—Assessment of Their Potential for Biomedical Applications. PLoS ONE 2013, 8, e73812. [Google Scholar] [CrossRef]
- Sha, X.; Li, P.; Feng, Y.; Xia, D.; Tian, X.; Wang, Z.; Yang, Y.; Mao, X.; Liu, L. Self-Assembled Peptide Nanofibrils Designed to Release Membrane-Lysing Antimicrobial Peptides. ACS Appl. Bio Mater. 2020, 3, 3648–3655. [Google Scholar] [CrossRef] [PubMed]
- Morton, L.M.; Phillips, T.J. Wound Healing and Treating Wounds Differential Diagnosis and Evaluation of Chronic Wounds. J. Am. Acad. Dermatol. 2016, 74, 589–605. [Google Scholar] [CrossRef] [PubMed]
- Xu, T.; Tian, Y.; Zhang, R.; Yu, B.; Cong, H.; Shen, Y. Hydrogel Vectors Based on Peptide and Peptide-like Substances: For Treating Bacterial Infections and Promoting Wound Healing. Appl. Mater Today 2021, 25, 101224. [Google Scholar] [CrossRef]
- Ghelich, P.; Samandari, M.; Najafabadi, A.H.; Tanguay, A.; Quint, J.; Menon, N.; Ghanbariamin, D.; Saeedinejad, F.; Alipanah, F.; Chidambaram, R.; et al. Dissolvable Immunomodulatory Microneedles for Treatment of Skin Wounds. Advhealthmat 2024, 13, 2302836. [Google Scholar] [CrossRef]
- Mygind, P.H.; Fischer, R.L.; Schnorr, K.M.; Hansen, M.T.; Sönksen, C.P.; Ludvigsen, S.; Raventós, D.; Buskov, S.; Christensen, B.; De Maria, L.; et al. Plectasin Is a Peptide Antibiotic with Therapeutic Potential from a Saprophytic Fungus. Nature 2005, 437, 975–980. [Google Scholar] [CrossRef] [PubMed]
- Pohl, C.; Effantin, G.; Kandiah, E.; Meier, S.; Zeng, G.; Streicher, W.; Segura, D.R.; Mygind, P.H.; Sandvang, D.; Nielsen, L.A.; et al. pH- and Concentration-dependent Supramolecular Assembly of a Fungal Defensin Plectasin Variant into Helical Non-amyloid Fibrils. Nat. Commun. 2022, 13, 3162. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Hao, Y.; Yang, N.; Mao, R.; Teng, D.; Wang, J. Plectasin: From Evolution to Truncation, Expression, and Better Druggability. Front. Microbiol. 2023, 14, 1304825. [Google Scholar] [CrossRef]
- Truong, N.P.; Quinn, J.F.; Whittaker, M.R.; Davis, T.P. Polymeric Filomicelles and Nanoworms: Two Decades of Synthesis and Application. Polym. Chem. 2016, 7, 4295–4312. [Google Scholar] [CrossRef]
- Truong, N.P.; Quinn, J.F.; Anastasaki, A.; Rolland, M.; Vu, M.N.; Haddleton, D.M.; Whittaker, M.R.; Davis, T.P. Surfactant-free RAFT Emulsion Polymerization Using a Novel Biocompatible Thermoresponsive Polymer. Polym. Chem. 2017, 8, 1353–1363. [Google Scholar] [CrossRef]
- Pasc, A.; Akong, F.O.; Cosgun, S.; Gerardin, C. Differences between β-Ala and Gly-Gly in the Design of Amino Acids-based Hydrogels. Beilstein J. Org. Chem. 2010, 6, 973–977. [Google Scholar]
- Koc, M.H.; Ciftci, G.C.; Baday, S.; Castelletto, V.; Hamley, I.W.; Guler, M.O. Hierarchical Self-Assembly of Histidine-Functionalized Peptide Amphiphiles into Supramolecular Chiral Nanostructures. Langmuir 2017, 33, 7947–7956. [Google Scholar]
- Bakota, E.L.; Wang, Y.; Danesh, F.R.; Hartgerink, J.D. Injectable Multidomain Peptide Nanofiber Hydrogel as a Delivery Agent for Stem Cell Secretome. Biomacromolecules 2011, 12, 1651–1657. [Google Scholar] [CrossRef] [PubMed]
- Koda, D.; Maruyama, T.; Minakuchi, N.; Nakashima, K.; Goto, M. Proteinase-mediated Drastic Morphological Change of Peptide-amphiphile to Induce Supramolecular Hydrogelation. Chem. Commun. 2010, 46, 979–981. [Google Scholar] [CrossRef]
- Mura, S.; Nicolas, J.; Couvreur, P. Stimuli-responsive Nanocarriers for Drug Delivery. Nat. Mater 2013, 12, 991–1003. [Google Scholar] [CrossRef] [PubMed]
- Yuan, Y.Y.; Mao, C.Q.; Du, X.J.; Du, J.Z.; Wang, F.; Wang, J. Surface Charge Switchable Nanoparticles Based on Zwitterionic Polymer for Enhanced Drug Delivery to Tumor. Adv. Mater. 2012, 24, 5476–5480. [Google Scholar] [CrossRef]
- Matulis, D.; Baumann, C.G.; Bloomfield, V.A.; Lovrien, R.E. 1-anilino-8-naphthalene Sulfonate as a Protein Conformational Tightening Agent. Biopolymers 1999, 49, 451–458. [Google Scholar] [CrossRef]
- Syakhovich, V.E.; Parul, D.A.; Ruta, E.Y.; Bushuk, B.A.; Bokut, S.B. 1,8-anilinonaphthalene Sulfonate Binds to Central Cavity of Human Hemoglobin. Biochem. Biophys. Res. Commun. 2004, 317, 761–767. [Google Scholar] [CrossRef]
- Xing, R.; Li, S.; Zhang, N.; Shen, G.; Mohwald, H.; Yan, X. Self-Assembled Injectable Peptide Hydrogels Capable of Triggering Antitumor Immune Response. Biomacromolecules 2017, 18, 3514–3523. [Google Scholar] [CrossRef]
- Arias, M.; Piga, K.B.; Hyndman, M.E.; Vogel, H.J. Improving the Activity of Trp-Rich Antimicrobial Peptides by Arg/Lys Substitutions and Changing the Length of Cationic Residues. Biomolecules 2018, 8, 19. [Google Scholar] [CrossRef]
- Chan, D.I.; Prenner, E.J.; Vogel, H.J. Tryptophan- and Arginine-rich Antimicrobial Peptides: Structures and Mechanisms of Action. Biochim. Biophys. Acta (BBA)-Biomembr. 2006, 1758, 1184–1202. [Google Scholar] [CrossRef] [PubMed]
- Li, J.; Koh, J.J.; Liu, S.; Lakshminarayanan, R.; Verma, C.S.; Beuerman, R.W. Membrane Active Antimicrobial Peptides: Translating Mechanistic Insights to Design. Front. Neurosci. 2017, 11, 73. [Google Scholar] [CrossRef] [PubMed]
- Baumann, G.; Mueller, P. A Molecular Model of Membrane Excitability. J. Am. Chem. Soc. 1974, 2, 538–557. [Google Scholar] [CrossRef] [PubMed]
- Leontiadou, H.; Mark, A.E.; Marrink, S.J. Antimicrobial Peptides in Action. J. Am. Chem. Soc. 2006, 128, 12156–12161. [Google Scholar] [CrossRef]
- Pouny, Y.; Rapaport, D.; Mor, A.; Nicolas, P.; Shai, Y. Interaction of Antimicrobial Dermaseptin and Its Fluorescently Labeled Analogues with Phospholipid Membranes. Biochemistry 1992, 31, 12416–12423. [Google Scholar] [CrossRef]
- Kohanski, M.A.; Dwyer, D.J.; Collins, J.J. How Antibiotics Kill Bacteria: From Targets to Networks. Nat. Rev. Microbiol. 2010, 8, 423–435. [Google Scholar] [CrossRef]
- Zhang, J.; Yang, Y.; Teng, D.; Tian, Z.; Wang, S.; Wang, J. Expression of Plectasin in Pichia Pastoris and Its Characterization as a New Antimicrobial Peptide against Staphyloccocus and Streptococcus. Protein Expr. Purif. 2011, 78, 189–196. [Google Scholar] [CrossRef]
- Luciano, C.G.; Tessaro, L.; Lourenco, R.V.; Bittante, A.M.Q.B.; Fernandes, A.M.; Moraes, I.C.F.; do Amaral Sobral, P.J. Effects of Nisin Concentration on Properties of Gelatin Film-forming Solutions and Their Films. Int. J. Food Sci. Technol. 2021, 56, 587–599. [Google Scholar] [CrossRef]
- Tram, N.D.T.; Xu, J.; Mukherjee, D.; Obanel, A.E.; Mayandi, V.; Selvarajan, V.; Zhu, X.; Teo, J.; Barathi, V.A.; Lakshminarayanan, R.; et al. Bacteria-Responsive Self-Assembly of Antimicrobial Peptide Nanonets for Trap-and-Kill of Antibiotic-Resistant Strains. Adv. Funct. Mater. 2023, 33, 2210858. [Google Scholar] [CrossRef]
- Zou, P.; Liu, J.; Li, X.; Yaseen, M.; Yao, J.; Liu, L.; Luo, L.; Wang, H.; Shi, X.; Li, Z.; et al. A Membrane Curvature Modulated Lipopeptide to Broadly Combat Multidrug—Resistant Bacterial Pneumonia with Low Resistance Risk. ACS Nano 2022, 16, 20545–20558. [Google Scholar] [CrossRef] [PubMed]
- Guenther, J.; Petzl, W.; Bauer, I.; Ponsuksili, S.; Zerbe, H.; Schuberth, H.J.; Brunner, R.M.; Seyfert, H.M. Differentiating Staphylococcus aureus from Escherichia coli Mastitis: S. aureus Triggers Unbalanced Immune-dampening and Host Cell Invasion Immediately after Udder Infection. Sci. Rep. 2017, 7, 4811. [Google Scholar] [CrossRef]
- Li, T.; Yang, N.; Teng, D.; Mao, R.; Hao, Y.; Wang, X.; Wang, J. C-terminal Mini-PEGylation of a Marine Peptide N6 had Potent Antibacterial and Anti-inflammatory Properties against Escherichia coli and Salmonella Strains in Vitro and in Vivo. BMC Microbiol. 2022, 22, 128. [Google Scholar] [CrossRef] [PubMed]
- Wu, Y.; Yang, N.; Mao, R.; Hao, Y.; Teng, D.; Wang, J. In Vitro Pharmacodynamics and Bactericidal Mechanism of Fungal Defensin-Derived Peptides NZX and P2 against Streptococcus agalactiae. Microorganisms 2022, 10, 881. [Google Scholar] [CrossRef] [PubMed]
- el Battioui, K.; Chakraborty, S.; Wacha, A.; Molnar, D.; Queme-Pena, M.; Szigyarto, I.C.; Szabo, C.L.; Bodor, A.; Horvati, K.; Gyulai, G.; et al. In Situ Captured Antibacterial Action of Membrane-incising Peptide Lamellae. Nat. Commun. 2024, 15, 3424. [Google Scholar] [CrossRef] [PubMed]
- Ma, Z.; Liu, X.; Nie, J.; Zhao, H.; Li, W. Nano-Antimicrobial Peptides Based on Constitutional Isomerism-Dictated Self-Assembly. Biomacromolecules 2022, 23, 1302–1313. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Q.; Yang, N.; Mao, R.; Hao, Y.; Ma, X.; Teng, D.; Fan, H.; Wang, J. A Recombinant Fungal Defensin-like Peptide-P2 Combats Streptococcus dysgalactiae and Biofilms. Appl. Microbiol. Biotechnol. 2021, 105, 1489–1504. [Google Scholar] [CrossRef]
- Thieme, V.; Jolly, N.; Madsen, A.N.; Bellmann-Sickert, K.; Schwartz, T.W.; Holst, B.; Cox, H.M.; Beck-Sickinger, A.G. High Molecular Weight PEGylation of Human Pancreatic Polypeptide Atposition 22 Improves Stability and Reduces Food Intake in Mice. Br. J. Pharmacol. 2016, 173, 3208–3221. [Google Scholar] [CrossRef]
- Lall, N.; Henley-Smith, C.J.; De Canha, M.N.; Oosthuizen, C.B.; Berrington, D. Viability Reagent, PrestoBlue, in Comparison with Other Available Reagents, Utilized in Cytotoxicity and Antimicrobial Assays. Int. J. Microbiol. 2013, 2013, 420601. [Google Scholar] [CrossRef]
Name | Sequence | Length | MW (Da) | pI | Charge | GRAVY | Instability Index | |
---|---|---|---|---|---|---|---|---|
1 | PPI42 | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4394.05 | 8.61 | +3 | −0.647 | 22.41 |
2 | PPI43 | GFGCNGPWSEDDLKCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4376.01 | 8.61 | +3 | −0.600 | 20.29 |
3 | PPI44 | GFGCNGPWNEDDMRCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4449.09 | 8.62 | +3 | −0.730 | 18.79 |
4 | PPI45 | GFGCNGPWNEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4421.07 | 8.61 | +3 | −0.715 | 20.68 |
5 | PPI46 | GFGCNGPWSEDDMR- CHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4376.01 | 8.61 | +3 | −0.600 | 20.29 |
6 | PPI47 | GFGCNGPWSEDDLRCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4404.03 | 8.62 | +3 | −0.615 | 27.22 |
7 | PPI48 | GFGCNGPWNEDDLKCHNHCKSIKGYKGGYCAKGGFLCKCY | 40 | 4403.04 | 8.61 | +3 | −0.667 | 18.56 |
Strain | MIC (µg/mL) | MBC (µg/mL) | ||||
---|---|---|---|---|---|---|
PPI42 | PPI45 | PPI47 | PPI42 | PPI45 | PPI47 | |
Gram-positive bacteria | ||||||
Staphylococcus aureus ATCC 43300 | 8 | 4 | 4 | 8 | 4 | 8 |
S. aureus ATCC 25923 | 8 | 16 | 16 | 16 | 16 | 16 |
S. aureus CVCC 546 | 2 | 4 | 4 | 4 | 4 | 4 |
Staphylococcus epidermidis ATCC 12228 | 4 | 4 | 4 | 8 | 4 | 8 |
S. epidermidis ATCC 35984 | 2 | 16 | 16 | 8 | 16 | 16 |
Streptococcus agalactiae ATCC 13813 | 0.5 | 0.5 | 0.5 | 0.5 | 0.5 | 0.5 |
Streptococcus dysgalactiae CVCC 3938 | 4 | 1 | 2 | 4 | 4 | 4 |
Gram-negative bacteria | ||||||
Escherichia coli ATCC 25922 | >64 | >64 | >64 | >64 | >64 | >64 |
Pseudomonas aeruginosa ATCC 10104 | >64 | >64 | >64 | >64 | >64 | >64 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Wu, Q.; Deng, M.; Mao, R.; Yang, N.; Hao, Y.; Cao, M.; Teng, D.; Wang, J. Self-Assembled Peptide Hydrogels PPI45 and PPI47: Novel Drug Candidates for Staphylococcus aureus Infection Treatment. Gels 2025, 11, 63. https://doi.org/10.3390/gels11010063
Wu Q, Deng M, Mao R, Yang N, Hao Y, Cao M, Teng D, Wang J. Self-Assembled Peptide Hydrogels PPI45 and PPI47: Novel Drug Candidates for Staphylococcus aureus Infection Treatment. Gels. 2025; 11(1):63. https://doi.org/10.3390/gels11010063
Chicago/Turabian StyleWu, Quanlong, Mengyin Deng, Ruoyu Mao, Na Yang, Ya Hao, Manli Cao, Da Teng, and Jianhua Wang. 2025. "Self-Assembled Peptide Hydrogels PPI45 and PPI47: Novel Drug Candidates for Staphylococcus aureus Infection Treatment" Gels 11, no. 1: 63. https://doi.org/10.3390/gels11010063
APA StyleWu, Q., Deng, M., Mao, R., Yang, N., Hao, Y., Cao, M., Teng, D., & Wang, J. (2025). Self-Assembled Peptide Hydrogels PPI45 and PPI47: Novel Drug Candidates for Staphylococcus aureus Infection Treatment. Gels, 11(1), 63. https://doi.org/10.3390/gels11010063