An Immunoinformatic Approach for Identifying and Designing Conserved Multi-Epitope Vaccines for Coronaviruses
Abstract
1. Introduction
2. Materials and Methods
2.1. Coronaviral S Gene Sequence Retrieval and Sequence Conservation Analysis
2.2. The Flow of Prediction of Conserved HTL, CTL and Linear B-Lymphocyte (LBL) Epitopes of Coronaviral S Glycoproteins
2.2.1. Prediction of Conserved CTL Epitopes
2.2.2. Prediction of Conserved HTL Epitopes
2.2.3. Prediction of Conserved LBL Epitopes
2.3. Alignment of the Predicted Conserved CTL, HTL and LBL Epitopes and Allergenicity Prediction
2.4. Population Coverage Analysis
2.5. Structural Visualisation of Assembled Epitopes
2.6. Molecular Docking of the Assembled Epitopes to TLR4 and TLR2 Receptors
2.7. Immune Simulation Using C-IMMSIM Server
3. Results
3.1. Conserved Regions in the S Glycoproteins of Bat and Pangolin CoV, hCoVs, SARS-CoV-2, SARS-CoV, and MERS-CoV
3.2. Prediction and Screening of Conserved CTL Epitopes of S Glycoprotein
3.3. Prediction and Screening of Conserved HTL Epitopes
3.4. Prediction and Screening of Conserved LBL Epitopes
3.5. Alignment and Assembly of the Identified HTL, CTL T, and LBL Epitopes
3.6. Population Coverage
3.7. Identification of the Locations of the Conserved Epitopes in Coronaviral S Glycoprotein
3.8. Molecular Docking of the Assembled Epitopes to TLR2 and TLR4 Receptors
3.8.1. Docking of TLR2 with Epi1 and Epi2
3.8.2. Docking of TLR4 with Epi1 and Epi2
3.9. Immune Simulation
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Pormohammad, A.; Ghorbani, S.; Khatami, A.; Farzi, R.; Baradaran, B.; Turner, D.L.; Turner, R.J.; Bahr, N.C.; Idrovo, J.P. Comparison of confirmed COVID-19 with SARS and MERS cases—Clinical characteristics, laboratory findings, radiographic signs and outcomes: A systematic review and meta-analysis. Rev. Med. Virol. 2020, 30, e2112. [Google Scholar] [CrossRef]
- Hui, D.S.; Perlman, S.; Zumla, A. Spread of MERS to South Korea and China. Lancet Respir. Med. 2015, 3, 509–510. [Google Scholar] [CrossRef] [PubMed]
- WHO Director-General’s Opening Remarks at the Media Briefing on COVID-19—11 March 2020. Available online: https://www.who.int/director-general/speeches/detail/who-director-general-s-opening-remarks-at-the-media-briefing-on-covid-19---11-march-2020 (accessed on 14 August 2024).
- COVID-19 Cases|WHO COVID-19 Dashboard. Available online: https://data.who.int/dashboards/covid19/cases (accessed on 14 August 2024).
- Andrews, N.; Stowe, J.; Kirsebom, F.; Toffa, S.; Rickeard, T.; Gallagher, E.; Gower, C.; Kall, M.; Groves, N.; O’Connell, A.-M.; et al. COVID-19 Vaccine Effectiveness against the Omicron (B.1.1.529) Variant. N. Engl. J. Med. 2022, 386, 1532–1546. [Google Scholar] [CrossRef]
- Greaney, A.J.; Starr, T.N.; Gilchuk, P.; Zost, S.J.; Binshtein, E.; Loes, A.N.; Hilton, S.K.; Huddleston, J.; Eguia, R.; Crawford, K.H.D.; et al. Complete Mapping of Mutations to the SARS-CoV-2 Spike Receptor-Binding Domain that Escape Antibody Recognition. Cell Host Microbe 2021, 29, 44–57.e9. [Google Scholar] [CrossRef] [PubMed]
- Harvey, W.T.; Carabelli, A.M.; Jackson, B.; Gupta, R.K.; Thomson, E.C.; Harrison, E.M.; Ludden, C.; Reeve, R.; Rambaut, A.; Peacock, S.J.; et al. SARS-CoV-2 variants, spike mutations and immune escape. Nat. Rev. Microbiol. 2021, 19, 409–424. [Google Scholar] [CrossRef] [PubMed]
- Malik, J.A.; Ahmed, S.; Mir, A.; Shinde, M.; Bender, O.; Alshammari, F.; Ansari, M.; Anwar, S. The SARS-CoV-2 mutations versus vaccine effectiveness: New opportunities to new challenges. J. Infect. Public Health 2022, 15, 228–240. [Google Scholar] [CrossRef]
- McLean, G.; Kamil, J.; Lee, B.; Moore, P.; Schulz, T.F.; Muik, A.; Sahin, U.; Türeci, Ö.; Pather, S. The Impact of Evolving SARS-CoV-2 Mutations and Variants on COVID-19 Vaccines. mBio 2022, 13, e02979–21. [Google Scholar] [CrossRef]
- Prakash, S.; Srivastava, R.; Coulon, P.-G.; Dhanushkodi, N.R.; Chentoufi, A.A.; Tifrea, D.F.; Edwards, R.A.; Figueroa, C.J.; Schubl, S.D.; Hsieh, L.; et al. Genome-Wide B Cell, CD4+, and CD8+ T Cell Epitopes That Are Highly Conserved between Human and Animal Coronaviruses, Identified from SARS-CoV-2 as Targets for Preemptive Pan-Coronavirus Vaccines. J. Immunol. 2021, 206, 2566–2582. [Google Scholar] [CrossRef]
- Bagherzadeh, M.A.; Izadi, M.; Baesi, K.; Jahromi, M.A.M.; Pirestani, M. Considering epitopes conservity in targeting SARS-CoV-2 mutations in variants: A novel immunoinformatics approach to vaccine design. Sci. Rep. 2022, 12, 14017. [Google Scholar] [CrossRef]
- Jaiswal, V.; Lee, H.J. Conservation and Evolution of Antigenic Determinants of SARS-CoV-2: An Insight for Immune Escape and Vaccine Design. Front. Immunol. 2022, 13, 832106. [Google Scholar] [CrossRef]
- Ahmed, S.F.; Quadeer, A.A.; McKay, M.R. Preliminary Identification of Potential Vaccine Targets for the COVID-19 Coronavirus (SARS-CoV-2) Based on SARS-CoV Immunological Studies. Viruses 2020, 12, 254. [Google Scholar] [CrossRef] [PubMed]
- Ismail, S.; Ahmad, S.; Azam, S.S. Immunoinformatics characterization of SARS-CoV-2 spike glycoprotein for prioritization of epitope based multivalent peptide vaccine. J. Mol. Liq. 2020, 314, 113612. [Google Scholar] [CrossRef] [PubMed]
- Maleki, A.; Russo, G.; Parasiliti Palumbo, G.A.; Pappalardo, F. In silico design of recombinant multi-epitope vaccine against influenza A virus. BMC Bioinform. 2022, 22, 617. [Google Scholar] [CrossRef] [PubMed]
- Russo, G.; Crispino, E.; Maleki, A.; Di Salvatore, V.; Stanco, F.; Pappalardo, F. Beyond the state of the art of reverse vaccinology: Predicting vaccine efficacy with the universal immune system simulator for influenza. BMC Bioinform. 2023, 24, 231. [Google Scholar] [CrossRef] [PubMed]
- Jiang, S.; Wu, S.; Zhao, G.; He, Y.; Guo, X.; Zhang, Z.; Hou, J.; Ding, Y.; Cheng, A.; Wang, B. Identification of a promiscuous conserved CTL epitope within the SARS-CoV-2 spike protein. Emerg. Microbes Infect. 2022, 11, 730. [Google Scholar] [CrossRef] [PubMed]
- Smith, T.R.F.; Patel, A.; Ramos, S.; Elwood, D.; Zhu, X.; Yan, J.; Gary, E.N.; Walker, S.N.; Schultheis, K.; Purwar, M.; et al. Immunogenicity of a DNA vaccine candidate for COVID-19. Nat. Commun. 2020, 11, 2601. [Google Scholar] [CrossRef]
- Meyer, S.; Blaas, I.; Bollineni, R.C.; Delic-Sarac, M.; Tran, T.T.; Knetter, C.; Dai, K.-Z.; Madssen, T.S.; Vaage, J.T.; Gustavsen, A.; et al. Prevalent and immunodominant CD8 T cell epitopes are conserved in SARS-CoV-2 variants. Cell Rep. 2023, 42, 111995. [Google Scholar] [CrossRef]
- Mishra, N.; Huang, X.; Joshi, S.; Guo, C.; Ng, J.; Thakkar, R.; Wu, Y.; Dong, X.; Li, Q.; Pinapati, R.S.; et al. Immunoreactive peptide maps of SARS-CoV-2. Commun. Biol. 2021, 4, 225. [Google Scholar] [CrossRef]
- Wang, H.; Wu, X.; Zhang, X.; Hou, X.; Liang, T.; Wang, D.; Teng, F.; Dai, J.; Duan, H.; Guo, S.; et al. SARS-CoV-2 Proteome Microarray for Mapping COVID-19 Antibody Interactions at Amino Acid Resolution. ACS Cent. Sci. 2020, 6, 2238–2249. [Google Scholar] [CrossRef]
- Sikora, M.; von Bülow, S.; Blanc, F.E.C.; Gecht, M.; Covino, R.; Hummer, G. Computational epitope map of SARS-CoV-2 spike protein. PLoS Comput. Biol. 2021, 17, e1008790. [Google Scholar] [CrossRef]
- Schwarz, T.; Heiss, K.; Mahendran, Y.; Casilag, F.; Kurth, F.; Sander, L.E.; Wendtner, C.-M.; Hoechstetter, M.A.; Müller, M.A.; Sekul, R.; et al. SARS-CoV-2 Proteome-Wide Analysis Revealed Significant Epitope Signatures in COVID-19 Patients. Front. Immunol. 2021, 12, 629185. [Google Scholar] [CrossRef] [PubMed]
- Paul, S.; Arlehamn, C.S.L.; Scriba, T.J.; Dillon, M.B.C.; Oseroff, C.; Hinz, D.; McKinney, D.M.; Pro, S.C.; Sidney, J.; Peters, B.; et al. Development and validation of a broad scheme for prediction of HLA class II restricted T cell epitopes. J. Immunol. Methods 2015, 422, 28–34. [Google Scholar] [CrossRef] [PubMed]
- Patel, M.C.; Shirey, K.A.; Pletneva, L.M.; Boukhvalova, M.S.; Garzino-Demo, A.; Vogel, S.N.; Blanco, J.C. Novel drugs targeting Toll-like receptors for antiviral therapy. Future Virol. 2014, 9, 811–829. [Google Scholar] [CrossRef] [PubMed]
- Chen, J.; Ng, M.M.-L.; Chu, J.J.H. Activation of TLR2 and TLR6 by Dengue NS1 Protein and Its Implications in the Immunopathogenesis of Dengue Virus Infection. PLoS Pathog. 2015, 11, e1005053. [Google Scholar] [CrossRef]
- Vangone, A.; Bonvin, A.M. Contacts-based prediction of binding affinity in protein–protein complexes. eLife 2015, 4, e07454. [Google Scholar] [CrossRef]
- Xue, L.C.; Rodrigues, J.P.; Kastritis, P.L.; Bonvin, A.M.; Vangone, A. PRODIGY: A web server for predicting the binding affinity of protein–protein complexes. Bioinformatics 2016, 32, 3676–3678. [Google Scholar] [CrossRef]
- Rapin, N.; Lund, O.; Bernaschi, M.; Castiglione, F. Computational Immunology Meets Bioinformatics: The Use of Prediction Tools for Molecular Binding in the Simulation of the Immune System. PLoS ONE 2010, 5, e9862. [Google Scholar] [CrossRef]
- Chenavas, S.; Estrozi, L.F.; Slama-Schwok, A.; Delmas, B.; Primo, C.D.; Baudin, F.; Li, X.; Crépin, T.; Ruigrok, R.W.H. Monomeric Nucleoprotein of Influenza A Virus. PLoS Pathog. 2013, 9, e1003275. [Google Scholar] [CrossRef]
- Kirchdoerfer, R.N.; Cottrell, C.A.; Wang, N.; Pallesen, J.; Yassine, H.M.; Turner, H.L.; Corbett, K.S.; Graham, B.S.; McLellan, J.S.; Ward, A.B. Pre-fusion structure of a human coronavirus spike protein. Nature 2016, 531, 118–121. [Google Scholar] [CrossRef]
- Li, Z.; Tomlinson, A.C.A.; Wong, A.H.M.; Zhou, D.; Desforges, M.; Talbot, P.J.; Benlekbir, S.; Rubinstein, J.L.; Rini, J.M. The human coronavirus HCoV-229E S-protein structure and receptor binding. eLife 2019, 8, e51230. [Google Scholar] [CrossRef]
- Wang, C.; Hesketh, E.L.; Shamorkina, T.M.; Li, W.; Franken, P.J.; Drabek, D.; van Haperen, R.; Townend, S.; van Kuppeveld, F.J.M.; Grosveld, F.; et al. Antigenic structure of the human coronavirus OC43 spike reveals exposed and occluded neutralizing epitopes. Nat. Commun. 2022, 13, 2921. [Google Scholar] [CrossRef] [PubMed]
- Huang, Y.; Yang, C.; Xu, X.; Xu, W.; Liu, S. Structural and functional properties of SARS-CoV-2 spike protein: Potential antivirus drug development for COVID-19. Acta Pharmacol. Sin. 2020, 41, 1141–1149. [Google Scholar] [CrossRef] [PubMed]
- Xia, X. Domains and Functions of Spike Protein in SARS-CoV-2 in the Context of Vaccine Design. Viruses 2021, 13, 109. [Google Scholar] [CrossRef]
- Zheng, Z.; Monteil, V.M.; Maurer-Stroh, S.; Yew, C.W.; Leong, C.; Mohd-Ismail, N.K.; Arularasu, S.C.; Chow, V.T.K.; Lin, R.T.P.; Mirazimi, A.; et al. Monoclonal antibodies for the S2 subunit of spike of SARS-CoV-1 cross-react with the newly-emerged SARS-CoV-2. Eurosurveillance 2020, 25, 19–28. [Google Scholar] [CrossRef]
- Boni, M.F.; Lemey, P.; Jiang, X.; Lam, T.T.-Y.; Perry, B.W.; Castoe, T.A.; Rambaut, A.; Robertson, D.L. Evolutionary origins of the SARS-CoV-2 sarbecovirus lineage responsible for the COVID-19 pandemic. Nat. Microbiol. 2020, 5, 1408–1417. [Google Scholar] [CrossRef]
- Li, X.; Giorgi, E.E.; Marichannegowda, M.H.; Foley, B.; Xiao, C.; Kong, X.-P.; Chen, Y.; Gnanakaran, S.; Korber, B.; Gao, F. Emergence of SARS-CoV-2 through recombination and strong purifying selection. Sci. Adv. 2020, 6, eabb9153. [Google Scholar] [CrossRef]
- Sajini, A.A.; Alkayyal, A.A.; Mubaraki, F.A. The Recombination Potential between SARS-CoV-2 and MERS-CoV from Cross-Species Spill-over Infections. J. Epidemiol. Glob. Health 2021, 11, 155–159. [Google Scholar] [CrossRef] [PubMed]
- Larsen, M.V.; Lundegaard, C.; Lamberth, K.; Buus, S.; Lund, O.; Nielsen, M. Large-scale validation of methods for cytotoxic T-lymphocyte epitope prediction. BMC Bioinform. 2007, 8, 424. [Google Scholar] [CrossRef]
- Larsen, M.V.; Lundegaard, C.; Lamberth, K.; Buus, S.; Brunak, S.; Lund, O.; Nielsen, M. An integrative approach to CTL epitope prediction: A combined algorithm integrating MHC class I binding, TAP transport efficiency, and proteasomal cleavage predictions. Eur. J. Immunol. 2005, 35, 2295–2303. [Google Scholar] [CrossRef]
- Sidney, J.; Grey, H.M.; Kubo, R.T.; Sette, A. Practical, biochemical and evolutionary implications of the discovery of HLA class I supermotifs. Immunol. Today 1996, 17, 261–266. [Google Scholar] [CrossRef]
- Sidney, J.; Peters, B.; Frahm, N.; Brander, C.; Sette, A. HLA class I supertypes: A revised and updated classification. BMC Immunol. 2008, 9, 1. [Google Scholar] [CrossRef] [PubMed]
- dos Santos Francisco, R.; Buhler, S.; Nunes, J.M.; Bitarello, B.D.; França, G.S.; Meyer, D.; Sanchez-Mazas, A. HLA supertype variation across populations: New insights into the role of natural selection in the evolution of HLA-A and HLA-B polymorphisms. Immunogenetics 2015, 67, 651–663. [Google Scholar] [CrossRef] [PubMed]
- Andreatta, M.; Trolle, T.; Yan, Z.; Greenbaum, J.A.; Peters, B.; Nielsen, M. An automated benchmarking platform for MHC class II binding prediction methods. Bioinformatics 2018, 34, 1522–1528. [Google Scholar] [CrossRef] [PubMed]
- Wang, P.; Sidney, J.; Dow, C.; Mothé, B.; Sette, A.; Peters, B. A Systematic Assessment of MHC Class II Peptide Binding Predictions and Evaluation of a Consensus Approach. PLoS Comput. Biol. 2008, 4, e1000048. [Google Scholar] [CrossRef] [PubMed]
- Greenbaum, J.; Sidney, J.; Chung, J.; Brander, C.; Peters, B.; Sette, A. Functional classification of class II human leukocyte antigen (HLA) molecules reveals seven different supertypes and a surprising degree of repertoire sharing across supertypes. Immunogenetics 2011, 63, 325–335. [Google Scholar] [CrossRef]
- Regenmortel, M.H.V. What Is a B-Cell Epitope? In Epitope Mapping Protocols; Schutkowski, M., Reineke, U., Eds.; Humana Press: Totowa, NJ, USA, 2009; pp. 3–20. [Google Scholar]
- Sanchez-Trincado, J.L.; Gomez-Perosanz, M.; Reche, P.A. Fundamentals and Methods for T- and B-Cell Epitope Prediction. J. Immunol. Res. 2017, 2017, 2680160. [Google Scholar] [CrossRef]
- Chaudhary, N.; Wesemann, D.R. Analyzing Immunoglobulin Repertoires. Front Immunol. 2018, 9. [Google Scholar] [CrossRef]
- Raybould, M.I.J.; Rees, A.R.; Deane, C.M. Current strategies for detecting functional convergence across B-cell receptor repertoires. MAbs 2021, 13, 1996732. [Google Scholar] [CrossRef]
- Briney, B.; Inderbitzin, A.; Joyce, C.; Burton, D.R. Commonality despite exceptional diversity in the baseline human antibody repertoire. Nature 2019, 566, 393–397. [Google Scholar] [CrossRef]
- Soto, C.; Bombardi, R.G.; Branchizio, A.; Kose, N.; Matta, P.; Sevy, A.M.; Sinkovits, R.S.; Gilchuk, P.; Finn, J.A.; Crowe, J.E. High frequency of shared clonotypes in human B cell receptor repertoires. Nature 2019, 566, 398–402. [Google Scholar] [CrossRef]
- Galanis, K.A.; Nastou, K.C.; Papandreou, N.C.; Petichakis, G.N.; Iconomidou, V.A. Linear B-Cell Epitope Prediction: A Performance Review of Currently Available Methods. 2019. Available online: https://www.biorxiv.org/content/10.1101/833418v1 (accessed on 14 August 2024).
- Yao, B.; Zhang, L.; Liang, S.; Zhang, C. SVMTriP: A Method to Predict Antigenic Epitopes Using Support Vector Machine to Integrate Tri-Peptide Similarity and Propensity. PLoS ONE 2012, 7, e45152. [Google Scholar] [CrossRef] [PubMed]
- Scheurer, S.; Son, D.Y.; Boehm, M.; Karamloo, F.; Franke, S.; Hoffmann, A.; Haustein, D.; Vieths, S. Cross-reactivity and epitope analysis of Pru a 1, the major cherry allergen. Mol. Immunol. 1999, 36, 155–167. [Google Scholar] [CrossRef]
- Neudecker, P.; Lehmann, K.; Nerkamp, J.; Haase, T.; Wangorsch, A.; Fötisch, K.; Hoffmann, S.; Rösch, P.; Vieths, S.; Scheurer, S. Mutational epitope analysis of Pru av 1 and Api g 1, the major allergens of cherry (Prunus avium) and celery (Apium graveolens): Correlating IgE reactivity with three-dimensional structure. Biochem. J. 2003, 376, 97–107. [Google Scholar] [CrossRef] [PubMed]
- Zhang, B.; Xu, S.; Liu, M.; Wei, Y.; Wang, Q.; Shen, W.; Lei, C.Q.; Zhu, Q. The nucleoprotein of influenza A virus inhibits the innate immune response by inducing mitophagy. Autophagy 2023, 19, 1916. [Google Scholar] [CrossRef]
- Jiao, C.; Wang, B.; Chen, P.; Jiang, Y.; Liu, J. Analysis of the conserved protective epitopes of hemagglutinin on influenza A viruses. Front. Immunol. 2023, 14, 1086297. [Google Scholar] [CrossRef]
- Corti, D.; Lanzavecchia, A. Broadly neutralizing antiviral antibodies. Annu. Rev. Immunol. 2013, 31, 705–742. [Google Scholar] [CrossRef] [PubMed]
- Carty, M.; Bowie, A.G. Recent insights into the role of Toll-like receptors in viral infection. Clin. Exp. Immunol. 2010, 161, 397–406. [Google Scholar] [CrossRef]
- Lester, S.N.; Li, K. Toll-like receptors in antiviral innate immunity. J. Mol. Biol. 2014, 426, 1246–1264. [Google Scholar] [CrossRef]
- Elgert, K.D. Immunology; Wiley-Blackwell: Hoboken, NJ, USA, 2009. [Google Scholar]
- Krammer, F. SARS-CoV-2 vaccines in development. Nature 2020, 586, 516–527. [Google Scholar] [CrossRef]
- Kyriakidis, N.C.; López-Cortés, A.; González, E.V.; Grimaldos, A.B.; Prado, E.O. SARS-CoV-2 vaccines strategies: A comprehensive review of phase 3 candidates. NPJ Vaccines 2021, 6, 28. [Google Scholar] [CrossRef]
- Martínez-Flores, D.; Zepeda-Cervantes, J.; Cruz-Reséndiz, A.; Aguirre-Sampieri, S.; Sampieri, A.; Vaca, L. SARS-CoV-2 Vaccines Based on the Spike Glycoprotein and Implications of New Viral Variants. Front. Immunol. 2021, 12, 701501. [Google Scholar] [CrossRef] [PubMed]
- Samrat, S.K.; Tharappel, A.M.; Li, Z.; Li, H. Prospect of SARS-CoV-2 spike protein: Potential role in vaccine and therapeutic development. Virus Res. 2020, 288, 198141. [Google Scholar] [CrossRef]
- Sulbaran, G.; Maisonnasse, P.; Amen, A.; Effantin, G.; Guilligay, D.; Dereuddre-Bosquet, N.; Burger, J.A.; Poniman, M.; Grobben, M.; Buisson, M.; et al. Immunization with synthetic SARS-CoV-2 S glycoprotein virus-like particles protects macaques from infection. Cell Rep. Med. 2022, 3, 100528. [Google Scholar] [CrossRef]
- Wrapp, D.; Wang, N.; Corbett, K.S.; Goldsmith, J.A.; Hsieh, C.-L.; Abiona, O.; Graham, B.S.; McLellan, J.S. Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation. Science 2020, 367, 1260–1263. [Google Scholar] [CrossRef]
- Sternberg, A.; Naujokat, C. Structural features of coronavirus SARS-CoV-2 spike protein: Targets for vaccination. Life Sci. 2020, 257, 118056. [Google Scholar] [CrossRef]
- Cao, Y.; Yisimayi, A.; Jian, F.; Song, W.; Xiao, T.; Wang, L.; Du, S.; Wang, J.; Li, Q.; Chen, X.; et al. BA.2.12.1, BA.4 and BA.5 escape antibodies elicited by Omicron infection. Nature 2022, 608, 593–602. [Google Scholar] [CrossRef]
- Greaney, A.J.; Loes, A.N.; Crawford, K.H.D.; Starr, T.N.; Malone, K.D.; Chu, H.Y.; Bloom, J.D. Comprehensive mapping of mutations in the SARS-CoV-2 receptor-binding domain that affect recognition by polyclonal human plasma antibodies. Cell Host Microbe 2021, 29, 463–476.e6. [Google Scholar] [CrossRef] [PubMed]
- Greaney, A.J.; Starr, T.N.; Barnes, C.O.; Weisblum, Y.; Schmidt, F.; Caskey, M.; Gaebler, C.; Cho, A.; Agudelo, M.; Finkin, S.; et al. Mutational Escape from the Polyclonal Antibody Response to SARS-CoV-2 Infection Is Largely Shaped by a Single Class of Antibodies. 2021. Available online: https://www.biorxiv.org/content/10.1101/2021.03.17.435863v1 (accessed on 14 August 2024).
- Weisblum, Y.; Schmidt, F.; Zhang, F.; DaSilva, J.; Poston, D.; Lorenzi, J.C.C.; Muecksch, F.; Rutkowska, M.; Hoffmann, H.-H.; Michailidis, E.; et al. Escape from neutralizing antibodies by SARS-CoV-2 spike protein variants. eLife 2020, 9, e61312. [Google Scholar] [CrossRef] [PubMed]
- Röltgen, K.; Nielsen, S.C.A.; Silva, O.; Younes, S.F.; Zaslavsky, M.; Costales, C.; Yang, F.; Wirz, O.F.; Solis, D.; Hoh, R.A.; et al. Immune imprinting, breadth of variant recognition, and germinal center response in human SARS-CoV-2 infection and vaccination. Cell 2022, 185, 1025–1040.e14. [Google Scholar] [CrossRef]
- Wheatley, A.K.; Fox, A.; Tan, H.-X.; Juno, J.A.; Davenport, M.P.; Subbarao, K.; Kent, S.J. Immune imprinting and SARS-CoV-2 vaccine design. Trends Immunol. 2021, 42, 956–959. [Google Scholar] [CrossRef]
- Li, Y.; Ma, M.; Lei, Q.; Wang, F.; Hong, W.; Lai, D.; Hou, H.; Xu, Z.; Zhang, B.; Chen, H.; et al. Linear epitope landscape of the SARS-CoV-2 Spike protein constructed from 1,051 COVID-19 patients. Cell Rep. 2021, 34, 108915. [Google Scholar] [CrossRef] [PubMed]
- Zhang, B.; Hu, Y.; Chen, L.; Yau, T.; Tong, Y.; Hu, J.; Cai, J.; Chan, K.-H.; Dou, Y.; Deng, J.; et al. Mining of epitopes on spike protein of SARS-CoV-2 from COVID-19 patients. Cell Res. 2020, 30, 702–704. [Google Scholar] [CrossRef] [PubMed]
- Zhang, B.-Z.; Chu, H.; Han, S.; Shuai, H.; Deng, J.; Hu, Y.; Gong, H.; Lee, A.C.-Y.; Zou, Z.; Yau, T.; et al. SARS-CoV-2 infects human neural progenitor cells and brain organoids. Cell Res. 2020, 30, 928–931. [Google Scholar] [CrossRef] [PubMed]
- Gilbert, C.; Tengs, T. No species-level losses of s2m suggests critical role in replication of SARS-related coronaviruses. Sci. Rep. 2021, 11, 16145. [Google Scholar] [CrossRef]
- Corman, V.M.; Muth, D.; Niemeyer, D.; Drosten, C. Hosts and Sources of Endemic Human Coronaviruses. Adv. Virus Res. 2018, 100, 163–188. [Google Scholar] [CrossRef]
- Flerlage, T.; Boyd, D.F.; Meliopoulos, V.; Thomas, P.G.; Schultz-Cherry, S. Influenza virus and SARS-CoV-2: Pathogenesis and host responses in the respiratory tract. Nat. Rev. Microbiol. 2021, 19, 425–441. [Google Scholar] [CrossRef]
- Traherne, J.A. Human MHC architecture and evolution: Implications for disease association studies. Int. J. Immunogenet. 2008, 35, 179–192. [Google Scholar] [CrossRef]
- Gartland, A.J.; Li, S.; McNevin, J.; Tomaras, G.D.; Gottardo, R.; Janes, H.; Fong, Y.; Morris, D.; Geraghty, D.E.; Kijak, G.H.; et al. Analysis of HLA A*02 Association with Vaccine Efficacy in the RV144 HIV-1 Vaccine Trial. J. Virol. 2014, 88, 8242–8255. [Google Scholar] [CrossRef]
- Liu, Y.; Guo, T.; Yu, Q.; Zhang, H.; Du, J.; Zhang, Y.; Xia, S.; Yang, H.; Li, Q. Association of human leukocyte antigen alleles and supertypes with immunogenicity of oral rotavirus vaccine given to infants in China. Medicine 2018, 97, e12706. [Google Scholar] [CrossRef]
- Mentzer, A.J.; O’Connor, D.; Bibi, S.; Chelysheva, I.; Clutterbuck, E.A.; Demissie, T.; Dinesh, T.; Edwards, N.J.; Felle, S.; Feng, S.; et al. Human leukocyte antigen alleles associate with COVID-19 vaccine immunogenicity and risk of breakthrough infection. Nat. Med. 2023, 29, 147–157. [Google Scholar] [CrossRef]
- Milich, D.R.; Leroux-Roels, G.G. Immunogenetics of the response to HBsAg vaccination. Autoimmun. Rev. 2003, 2, 248–257. [Google Scholar] [CrossRef] [PubMed]
- Nielsen, C.M.; Vekemans, J.; Lievens, M.; Kester, K.E.; Regules, J.A.; Ockenhouse, C.F. RTS,S malaria vaccine efficacy and immunogenicity during Plasmodium falciparum challenge is associated with HLA genotype. Vaccine 2018, 36, 1637–1642. [Google Scholar] [CrossRef] [PubMed]
- Nishida, N.; Sugiyama, M.; Sawai, H.; Nishina, S.; Sakai, A.; Ohashi, J.; Khor, S.; Kakisaka, K.; Tsuchiura, T.; Hino, K.; et al. Key HLA-DRB1-DQB1 haplotypes and role of the BTNL2 gene for response to a hepatitis B vaccine. Hepatology 2018, 68, 848–858. [Google Scholar] [CrossRef] [PubMed]
- O’connor, D.; Png, E.; Khor, C.C.; Snape, M.D.; Hill, A.V.; van der Klis, F.; Hoggart, C.; Levin, M.; Hibberd, M.L.; Pollard, A.J. Common Genetic Variations Associated with the Persistence of Immunity following Childhood Immunization. Cell Rep. 2019, 27, 3241–3253.e4. [Google Scholar] [CrossRef]
- Posteraro, B.; Pastorino, R.; Di Giannantonio, P.; Ianuale, C.; Amore, R.; Ricciardi, W.; Boccia, S. The link between genetic variation and variability in vaccine responses: Systematic review and meta-analyses. Vaccine 2014, 32, 1661–1669. [Google Scholar] [CrossRef]
- Ovsyannikova, I.G.; Haralambieva, I.H.; Vierkant, R.A.; O’Byrne, M.M.; Jacobson, R.M.; Poland, G.A. The Association of CD46, SLAM and CD209 Cellular Receptor Gene SNPs with Variations in Measles Vaccine-Induced Immune Responses: A Replication Study and Examination of Novel Polymorphisms. Hum. Hered. 2011, 72, 206. [Google Scholar] [CrossRef]
- Arrieta-Bolaños, E.; Hernández-Zaragoza, D.I.; Barquera, R. An HLA map of the world: A comparison of HLA frequencies in 200 worldwide populations reveals diverse patterns for class I and class II. Front. Genet. 2023, 14, 866407. [Google Scholar] [CrossRef]
- Potocnakova, L.; Bhide, M.; Pulzova, L.B. An Introduction to B-Cell Epitope Mapping and In Silico Epitope Prediction. J. Immunol. Res. 2016, 2016, 6760830. [Google Scholar] [CrossRef]
- Aboudounya, M.M.; Heads, R.J. COVID-19 and Toll-Like Receptor 4 (TLR4): SARS-CoV-2 May Bind and Activate TLR4 to Increase ACE2 Expression, Facilitating Entry and Causing Hyperinflammation. Mediat. Inflamm. 2021, 2021, 8874339. [Google Scholar] [CrossRef]
- Khan, S.; Shafiei, M.S.; Longoria, C.; Schoggins, J.W.; Savani, R.C.; Zaki, H. SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway. eLife 2021, 10, e68563. [Google Scholar] [CrossRef]
- Sahanic, S.; Hilbe, R.; Dünser, C.; Tymoszuk, P.; Löffler-Ragg, J.; Rieder, D.; Trajanoski, Z.; Krogsdam, A.; Demetz, E.; Yurchenko, M.; et al. SARS-CoV-2 activates the TLR4/MyD88 pathway in human macrophages: A possible correlation with strong pro-inflammatory responses in severe COVID-19. Heliyon 2023, 9, e21893. [Google Scholar] [CrossRef] [PubMed]
- Fontes-Dantas, F.L.; Fernandes, G.G.; Gutman, E.G.; De Lima, E.V.; Antonio, L.S.; Hammerle, M.B.; Mota-Araujo, H.P.; Colodeti, L.C.; Araújo, S.M.B.; Froz, G.M.; et al. SARS-CoV-2 Spike protein induces TLR4-mediated long-term cognitive dysfunction recapitulating post-COVID-19 syndrome in mice. Cell Rep. 2023, 42, 112189. [Google Scholar] [CrossRef] [PubMed]
- Tyrkalska, S.D.; Martínez-López, A.; Pedoto, A.; Candel, S.; Cayuela, M.L.; Mulero, V. The Spike protein of SARS-CoV-2 signals via Tlr2 in zebrafish. Dev. Comp. Immunol. 2023, 140, 104626. [Google Scholar] [CrossRef] [PubMed]
- Vaure, C.; Liu, Y. A comparative review of toll-like receptor 4 expression and functionality in different animal species. Front. Immunol. 2014, 5, 316. [Google Scholar] [CrossRef] [PubMed]
- Eicher, S.D.; McMunn, K.A.; Hammon, H.M.; Donkin, S.S. Toll-like receptors 2 and 4, and acute phase cytokine gene expression in dexamethasone and growth hormone treated dairy calves. Vet. Immunol. Immunopathol. 2004, 98, 115–125. [Google Scholar] [CrossRef]
- Su, S.B.; Tao, L.; Deng, Z.P.; Chen, W.; Qin, S.Y.; Jiang, H.X. TLR10: Insights, controversies and potential utility as a therapeutic target. Scand. J. Immunol. 2020, 93, e12988. [Google Scholar] [CrossRef]
- Wang, Y.C.; Zhou, Y.; Fang, H.; Lin, S.; Wang, P.F.; Xiong, R.P.; Chen, J.; Xiong, X.Y.; Lv, F.L.; Liang, Q.L.; et al. Toll-like receptor 2/4 heterodimer mediates inflammatory injury in intracerebral hemorrhage. Ann. Neurol. 2014, 75, 876–889. [Google Scholar] [CrossRef]
- Ozinsky, A.; Underhill, D.M.; Fontenot, J.D.; Hajjar, A.M.; Smith, K.D.; Wilson, C.B.; Schroeder, L.; Aderem, A. The repertoire for pattern recognition of pathogens by the innate immune system is defined by cooperation between Toll-like receptors. Proc. Natl. Acad. Sci. USA 2000, 97, 13766. [Google Scholar] [CrossRef]
- Colleselli, K.; Stierschneider, A.; Wiesner, C. An Update on Toll-like Receptor 2, Its Function and Dimerization in Pro- and Anti-Inflammatory Processes. Int. J. Mol. Sci. 2023, 24, 12464. [Google Scholar] [CrossRef]
- Kurt-Jones, E.A.; Popova, L.; Kwinn, L.; Haynes, L.M.; Jones, L.P.; Tripp, R.A.; Walsh, E.E.; Freeman, M.W.; Golenbock, D.T.; Anderson, L.J.; et al. Pattern recognition receptors TLR4 and CD14 mediate response to respiratory syncytial virus. Nat. Immunol. 2000, 1, 398–401. [Google Scholar] [CrossRef]
- Ge, Y.; Mansell, A.; Ussher, J.E.; Brooks, A.E.S.; Manning, K.; Wang, C.J.H.; Taylor, J.A. Rotavirus NSP4 Triggers Secretion of Proinflammatory Cytokines from Macrophages via Toll-Like Receptor 2. J. Virol. 2013, 87, 11160. [Google Scholar] [CrossRef] [PubMed]
- Bieback, K.; Lien, E.; Klagge, I.M.; Avota, E.; Schneider-Schaulies, J.; Duprex, W.P.; Wagner, H.; Kirschning, C.J.; ter Meulen, V.; Schneider-Schaulies, S. Hemagglutinin Protein of Wild-Type Measles Virus Activates Toll-Like Receptor 2 Signaling. J. Virol. 2002, 76, 8729. [Google Scholar] [CrossRef] [PubMed]
- Mogensen, T.H.; Paludan, S.R. Reading the viral signature by Toll-like receptors and other pattern recognition receptors. J. Mol. Med. 2005, 83, 180–192. [Google Scholar] [CrossRef] [PubMed]
- Lin, S.C.; Lo, Y.C.; Wu, H. Helical assembly in the MyD88:IRAK4:IRAK2 complex in TLR/IL-1R signaling. Nature 2010, 465, 885. [Google Scholar] [CrossRef]
- Kawasaki, T.; Kawai, T. Toll-Like Receptor Signaling Pathways. Front. Immunol. 2014, 5, 461. [Google Scholar] [CrossRef]
- Kawai, T.; Akira, S. The role of pattern-recognition receptors in innate immunity: Update on Toll-like receptors. Nat. Immunol. 2010, 11, 373–384. [Google Scholar] [CrossRef]
- Alberts, B.; Johnson, A.; Lewis, J.; Raff, M.; Roberts, K.; Walter, P. T Cells and MHC Proteins; Garland Science: New York, NY, USA, 2002. [Google Scholar]
- Boyman, O.; Sprent, J. The role of interleukin-2 during homeostasis and activation of the immune system. Nat. Rev. Immunol. 2012, 12, 180–190. [Google Scholar] [CrossRef]
- Rokade, S.; Damani, A.M.; Oft, M.; Emmerich, J. IL-2 based cancer immunotherapies: An evolving paradigm. Front. Immunol. 2024, 15, 1433989. [Google Scholar] [CrossRef]
- Matsushita, H.; Hosoi, A.; Ueha, S.; Abe, J.; Fujieda, N.; Tomura, M.; Maekawa, R.; Matsushima, K.; Ohara, O.; Kakimi, K. Cytotoxic T lymphocytes block tumor growth both by lytic activity and IFNγ-Dependent Cell-cycle arrest. Cancer Immunol. Res. 2015, 3, 26–36. [Google Scholar] [CrossRef]
- Jorgovanovic, D.; Song, M.; Wang, L.; Zhang, Y. Roles of IFN-γ in tumor progression and regression: A review. Biomark. Res. 2020, 8, 49. [Google Scholar] [CrossRef]
- Jawad, B.; Adhikari, P.; Podgornik, R.; Ching, W.Y. Key Interacting Residues between RBD of SARS-CoV-2 and ACE2 Receptor: Combination of Molecular Dynamics Simulation and Density Functional Calculation. J. Chem. Inf. Model. 2021, 61, 4425–4441. [Google Scholar] [CrossRef] [PubMed]
- Borkotoky, S.; Dey, D.; Hazarika, Z. Interactions of angiotensin-converting enzyme-2 (ACE2) and SARS-CoV-2 spike receptor-binding domain (RBD): A structural perspective. Mol. Biol. Rep. 2023, 50, 2713. [Google Scholar] [CrossRef]
- Yi, C.; Sun, X.; Ye, J.; Ding, L.; Liu, M.; Yang, Z.; Lu, X.; Zhang, Y.; Ma, L.; Gu, W.; et al. Key residues of the receptor binding motif in the spike protein of SARS-CoV-2 that interact with ACE2 and neutralizing antibodies. Cell. Mol. Immunol. 2020, 17, 621–630. [Google Scholar] [CrossRef]
- Sun, C.; Kang, Y.F.; Liu, Y.T.; Kong, X.W.; Xu, H.Q.; Xiong, D.; Xie, C.; Liu, Y.H.; Peng, S.; Feng, G.K.; et al. Parallel profiling of antigenicity alteration and immune escape of SARS-CoV-2 Omicron and other variants. Signal Transduct. Target. Ther. 2022, 7, 42. [Google Scholar] [CrossRef]
- Verkhivker, G.; Alshahrani, M.; Gupta, G. Balancing Functional Tradeoffs between Protein Stability and ACE2 Binding in the SARS-CoV-2 Omicron BA.2, BA.2.75 and XBB Lineages: Dynamics-Based Network Models Reveal Epistatic Effects Modulating Compensatory Dynamic and Energetic Changes. Viruses 2023, 15, 1143. [Google Scholar] [CrossRef]
- Kumar, S.; Thambiraja, T.S.; Karuppanan, K.; Subramaniam, G. Omicron and Delta variant of SARS-CoV-2: A comparative computational study of spike protein. J. Med. Virol. 2022, 94, 1641–1649. [Google Scholar] [CrossRef]
- Wu, X.; Li, W.; Rong, H.; Pan, J.; Zhang, X.; Hu, Q.; Shi, Z.-L.; Zhang, X.-E.; Cui, Z. A Nanoparticle Vaccine Displaying Conserved Epitopes of the Preexisting Neutralizing Antibody Confers Broad Protection against SARS-CoV-2 Variants. ACS Nano 2024, 18, 17749–17763. [Google Scholar] [CrossRef] [PubMed]
- He, L.; Lin, X.; Wang, Y.; Abraham, C.; Sou, C.; Ngo, T.; Zhang, Y.; Wilson, I.A.; Zhu, J. Single-component, self-assembling, protein nanoparticles presenting the receptor binding domain and stabilized spike as SARS-CoV-2 vaccine candidates. Sci. Adv. 2021, 7, eabf1591. [Google Scholar] [CrossRef] [PubMed]
- Ng, A.K.-L.; Zhang, H.; Tan, K.; Li, Z.; Liu, J.; Chan, P.K.-S.; Li, S.-M.; Chan, W.-Y.; Au, S.W.-N.; Joachimiak, A.; et al. Structure of the influenza virus A H5N1 nucleoprotein: Implications for RNA binding, oligomerization, and vaccine design. FASEB J. 2008, 22, 3638. [Google Scholar] [CrossRef]
- Wu, F.; Huang, J.-H.; Yuan, X.-Y.; Huang, W.-S.; Chen, Y.-H. Characterization of immunity induced by M2e of influenza virus. Vaccine 2007, 25, 8868–8873. [Google Scholar] [CrossRef]
- Gao, X.; Wang, W.; Li, Y.; Zhang, S.; Duan, Y.; Xing, L.; Zhao, Z.; Zhang, P.; Li, Z.; Li, R.; et al. Enhanced Influenza VLP vaccines comprising matrix-2 ectodomain and nucleoprotein epitopes protects mice from lethal challenge. Antiviral Res. 2013, 98, 4–11. [Google Scholar] [CrossRef] [PubMed]
Nomenclature | Lineage | Accession Number |
---|---|---|
SARS-CoV-2-Wuhan-Hu-1 strain | NC_045512.2 | |
Alpha | B.1.1.7 | OK340744.1 |
Beta | B.1.351 | OQ341818.1 |
Delta | B.1.617.2 | OQ314763.1 |
Gamma | P.1 | OQ316323.1 |
Omicron | B.1.1.529 | OQ344199.1 |
Omicron | BA.1 | OQ355083.1 |
Omicron | BA.1.1 | OQ352636.1 |
Omicron | BA.2 | OQ341824.1 |
Omicron | BA.2.12.1 | OQ355080.1 |
Omicron | BA.2.75 | OQ215893.1 |
Omicron | BA.2.75.2 | OQ346937.1 |
Omicron | BA.4 | OQ333888.1 |
Omicron | BA.4.6 | OQ349323.1 |
Omicron | BA.5 | OQ343976.1 |
Omicron | BA.5.2.6 | OQ346806.1 |
Omicron | BF.11 | OQ347094.1 |
Omicron | BF.7 | OQ346784.1 |
Omicron | BN.1 | OQ346744.1 |
Omicron | BQ.1 | OQ346454.1 |
Omicron | BQ.1.1 | OQ346605.1 |
Omicron | CH.1.1 | OQ346876.1 |
Omicron | XBB | OQ347865.1 |
Omicron | XBB.1.5 | XBB.1.5 is a sub-lineage of XBB with an additional spike RBD mutation S486P |
Nomenclature | Accession Number |
---|---|
MERS-CoV | NC_019843 |
SARS-CoV (Urbani) | AY278741.1 |
HCoV-HKU1–genotype B | AY884001 |
HCoV-OC43 | KF923903 |
HCoV-NL63 | NC_005831 |
Strain Name | Accession Number |
---|---|
Bat CoV RATG13 | MN996532.2 |
Bat CoV ZXC21 | MG772934.1 |
Bat CoV YN02 | MW201982.1 |
Pangolin CoV GX-P2V | MT072864.1 |
Pangolin CoV GX-P5E | MT040336.1 |
Pangolin CoV GX-P5L | MT040335.1 |
Pangolin CoV GX-P1E | MT040334.1 |
Pangolin CoV GX-P4L | MT040333.1 |
Pangolin CoV MP789 | MT121216.1 |
Avian CoV Ind-TN92-03 | NC_048213.1 |
Avian CoV DK/GD/27/2014 | NC_048214.1 |
Avian CoV MG10 | NC_010800.1 |
CTL Prediction Tools | Prediction Tool’s Criteria |
---|---|
NetCTL-1.2 |
|
VaxiJen 2.0 |
|
IEDB MHC Class I immunogenicity |
|
ToxinPred |
|
HTL Prediction Tools | Prediction Tool’s Criteria |
---|---|
IEDB MHC-II |
|
IFNepitope |
|
LBL Prediction Tools | Prediction Tool’s Condition |
ABCPred |
|
SVMTriP |
|
Epitopes | Number of Coronavirus Strains in Which the Epitope Is Found (Out of 30) | Location in the S Glycoprotein * | Assigned Name |
---|---|---|---|
RVVVLSFEL | 25 | 509–517 | CTL1 |
STQDLFLPF | 24 | 50–59 | CTL2 |
WTAGAAAYY | 24 | 258–266 | CTL3 |
YLQPRTFLL | 24 | 269–277 | CTL4 |
QIITTDNTF | 24 | 1113–1121 | CTL5 |
GAAAYYVGY | 24 | 261–269 | CTL6 |
ITDAVDCAL | 24 | 284–293 | CTL7 |
FTISVTTEI | 24 | 718–726 | CTL8 |
FVFLVLLPL | 23 | 2–9 | CTL9 |
QSYGFRPTY | 15 | 493–501 | CTL10 |
SVLYNFAPF | 13 | 366–374 | CTL11 |
YQPYRVVVL | 6 | 505–513 | CTL12 |
Peptide Sequence | Number of Matched Coronavirus Strains | Location in S Glycoprotein | Assigned Name |
---|---|---|---|
CVLGQSKRVDFCGKGY | 25 | 1045–1060 | LBL1 |
DKYFKNHTSPDVDLGD | 25 | 1166–1181 | LBL2 |
DEDDSEPVLKGVKLHY | 25 | 1270–1285 | LBL3 |
AMQMAYFNGIGVTQN | 25 | 899–914 | LBL4 |
AGAALQIPFAMQMAYR | 25 | 903–918 | LBL5 |
FAMQMAYRFNGIGVTQ | 25 | 911–926 | LBL6 |
ASANLAATKMSECVLG | 24 | 1033–1048 | LBL7 |
ATKMSECVLGQSKRVD | 24 | 1039–1054 | LBL8 |
HGVVFLHVTYVPAQEK | 24 | 1071–1086 | LBL9 |
HVTYVPAQEKNFTTAP | 24 | 1077–1092 | LBL10 |
FVSGNCDVVIGIVNNT | 24 | 1134–1149 | LBL11 |
VIGIVNNTVYDPLQPE | 24 | 1142–1157 | LBL12 |
HTSPDVDLGDISGINA | 24 | 1172–1187 | LBL13 |
LGDISGINASVVNIQK | 24 | 1179–1194 | LBL14 |
GTTLDSKTQSLLIVNN | 24 | 120–135 | LBL15 |
ESLIDLQELGKYEQYI | 24 | 1208–1223 | LBL16 |
YVGYLQPRTFLLKYNE | 24 | 279–294 | LBL17 |
NENGTITDAVDCALDP | 24 | 293–308 | LBL18 |
AVDCALDPLSETKCTL | 24 | 301–316 | LBL19 |
DPLSETKCTLKSFTVE | 24 | 307–322 | LBL20 |
TVEKGIYQTSNFRVQP | 24 | 320–335 | LBL21 |
VQPTESIVRFPNITNL | 24 | 333-348 | LBL22 |
NDLCFTNVYADSFVIR | 24 | 388–403 | LBL23 |
PTKLNDLCFTNVYADS | 24 | 397–412 | LBL24 |
VVLSFELLHAPATVCG | 24 | 524–539 | LBL25 |
FRSSVLHSTQDLFLPF | 24 | 56–71 | LBL26 |
TDAVRDPQTLEILDIT | 24 | 586–601 | LBL27 |
EILDITPCSFGGVSVI | 24 | 596–611 | LBL28 |
GVSVITPGTNTSNQVA | 24 | 607–622 | LBL29 |
HSTQDLFLPFFSNVTW | 24 | 62–77 | LBL30 |
YSTGSNVFQTRAGCLI | 24 | 649–664 | LBL31 |
TISVTTEILPVSMTKT | 24 | 732–747 | LBL32 |
TECSNLLLQYGSFCTQ | 24 | 760–775 | LBL33 |
RALTGIAVEQDKNTQE | 24 | 778–793 | LBL34 |
AVEQDKNTQEVFAQVK | 24 | 784–799 | LBL35 |
EMIAQYTSALLAGTIT | 24 | 881–896 | LBL36 |
AGTITSGWTFGAGAAL | 24 | 892–907 | LBL37 |
IGKIQDSLSSTASALG | 24 | 944–959 | LBL38 |
FKCYGVSPTKLNDLCF | 24 | 374–389 | LBL39 |
FVTQRNFYEPQIITTD | 23 | 1116–1131 | LBL40 |
YEQYIKWPWYIWLGFI | 23 | 1219–1234 | LBL41 |
PWYIWLGFIAGLIAIV | 23 | 1226–1241 | LBL42 |
EPLVDLPIGINITRFQ | 23 | 237–252 | LBL43 |
QTLLALHRSYLTPGDS | 23 | 239–254 | LBL44 |
TRFQTLLALHRSYLTP | 23 | 249–264 | LBL45 |
NQVAVLYQGVNCTEVP | 23 | 606–621 | LBL46 |
YQGVNCTEVPVAIHAD | 23 | 612–627 | LBL47 |
NNSIAIPTNFTISVTT | 23 | 722–737 | LBL48 |
RDLICAQKFNGLTVLP | 23 | 860–875 | LBL49 |
VFLVLLPLVSSQCVNL | 22 | 16–31 | LBL50 |
TGTGVLTESNKKFLPF | 22 | 560–575 | LBL51 |
NNSYECDIPIGAGICA | 22 | 670–685 | LBL52 |
SQSIIAYTMSLGAENS | 22 | 702–717 | LBL53 |
YTMSLGAENSVAYSNN | 22 | 708–723 | LBL54 |
GDCLGDIAARDLICAQ | 22 | 851–866 | LBL55 |
DIPIGAGICASYQTQT | 21 | 663–678 | LBL56 |
PFLMDLEGKQGNFKNL | 20 | 187–202 | LBL57 |
GWTAGAAAYYVGYLQP | 20 | 270–285 | LBL58 |
HRSYLTPGDSSSGWTA | 19 | 258–273 | LBL59 |
YGVGHQPYRVVVLSFE | 19 | 501–516 | LBL60 |
SYQTQTKSHRRARSVA | 19 | 673–688 | LBL61 |
TASALGKLQDVVNHNA | 19 | 941–956 | LBL62 |
KQLSSKFGAISSVLND | 19 | 964–979 | LBL63 |
PVLPFNDGVYFASTEK | 18 | 95–110 | LBL64 |
PGQTGNIADYNYKLPD | 17 | 412–427 | LBL65 |
RKSNLKPFERDISTEI | 17 | 470–485 | LBL66 |
GSFCTQLKRALTGIAV | 17 | 757–772 | LBL67 |
LQSYGFRPTYGVGHQP | 15 | 492–507 | LBL68 |
Combination of Peptides | Peptide Sequence | Peptide Location * | Peptide Length | Matched HLA Class I Supertype | Matched HLA Class II Supertype | Assigned Name |
---|---|---|---|---|---|---|
CTL3+ CTL4+ CTL6+ CTL7+ HTL50+ HTL42+ HTL30+ HTL31+ HTL43+ LBL59+ LBL58+ LBL17 | SGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALD | 256–294 (N-terminal domain) | 39 | A1, A2, A26, B8, B39, B58, B62 | HLA-DPA1*01:03/DPB1*04:01; HLA-DPA1*01:03/DPB1*02:01; HLA-DPA1*02:01/DPB1*01:01; HLA-DPA1*02:01/DPB1*05:01; HLA-DPA1*03:01/DPB1*04:02; HLA-DQA1*01:01/DQB1*05:01; HLA-DQA1*01:02/DQB1*06:02; HLA-DQA1*04:01/DQB1*04:02; HLA-DQA1*05:01/DQB1*02:01; HLA-DQA1*05:01/DQB1*03:01; HLA-DRB1*01:01; HLA-DRB1*07:01; HLA-DRB1*09:01 | Epi1 |
CTL1+ CTL10+ HTL51+ HTL25+ HTL14+ HTL22+ HTL23+ HTL15+ HTL16+ HTL45+ LBL60+ LBL68 | LQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVC | 492–525 (RBD) | 34 | A1, A2, A3, B7, B27, B58, B62 | HLA-DPA1*01:03/DPB1*04:01; HLA-DPA1*01:03/DPB1*02:01; HLA-DPA1*02:01/DPB1*01:01; HLA-DPA1*02:01/DPB1*05:01; HLA-DPA1*03:01/DPB1*04:02; HLA-DQA1*01:01/DQB1*05:01; HLA-DQA1*03:01/DQB1*03:02; HLA-DQA1*05:01/DQB1*02:01; HLA-DRB1*01:01; HLA-DRB1*07:01; HLA-DRB1*09:01; HLA-DRB4*01:01 | Epi2 |
Class | Epi1 | Epi2 | ||||
---|---|---|---|---|---|---|
Coverage | Average Hit | PC90 * | Coverage | Average Hit | PC90 * | |
Class I | 75.53% | 1.09 | 0.41 | 81.06% | 1.25 | 0.53 |
Class II | 99.88% | 4.27 | 3.04 | 99.74% | 3.82 | 2.53 |
Combined | 99.97% | 5.36 | 3.79 | 99.95% | 5.07 | 3.48 |
Scores | Epi1-TLR2 | Epi2-TLR2 |
---|---|---|
HADDOCK score | −76.6 ± 5.2 | −82.4 ± 6.5 |
Cluster size | 13 | 25 |
RMSD from the overall lowest-energy structure (Å) | 4.9 ± 0.3 | 0.4 ± 0.3 |
Van der Waals energy (kcal mol−1) | −63 ± 4.5 | −69.8 ± 8.8 |
Electrostatic energy (kcal mol−1) | −255.2 ± 32.3 | −245.9 ± 51.1 |
Desolvation energy (kcal mol−1) | −21.6 ± 5.8 | −37.3 ± 4.5 |
Restraints violation energy (kcal mol−1) | 589.9 ± 65.3 | 738.6 ± 17.6 |
Buried surface area (Å2) | 2292.3 ± 89.5 | 2271.0 ± 76.4 |
Z-Score | −1.5 | −1.5 |
Scores | Epi1-TLR4 | Epi2-TLR4 |
---|---|---|
HADDOCK score | 24.2 ± 19.4 | 27.7 ± 4.6 |
Cluster size | 9 | 20 |
RMSD from the overall lowest energy structure (Å) | 0.5 ± 0.3 | 8.4 ± 0.0 |
Van der Waals energy (kcal mol−1) | −92.7 ± 13.5 | −101.1 ± 6.5 |
Electrostatic energy (kcal mol−1) | −133.2 ± 5.6 | −125.3 ± 11.0 |
Desolvation energy (kcal mol−1) | −56.0 ± 4.1 | −44.5 ± 1.0 |
Restraints violation energy (kcal mol−1) | 1995.3 ± 111.3 | 1953.8 ± 46.4 |
Buried surface area (Å2) | 2719.0 ± 164.8 | 2844.3 ± 109.4 |
Z-Score | −2.2 | −1.8 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ong, Y.C.; Tejo, B.A.; Yap, W.B. An Immunoinformatic Approach for Identifying and Designing Conserved Multi-Epitope Vaccines for Coronaviruses. Biomedicines 2024, 12, 2530. https://doi.org/10.3390/biomedicines12112530
Ong YC, Tejo BA, Yap WB. An Immunoinformatic Approach for Identifying and Designing Conserved Multi-Epitope Vaccines for Coronaviruses. Biomedicines. 2024; 12(11):2530. https://doi.org/10.3390/biomedicines12112530
Chicago/Turabian StyleOng, Yu Chuan, Bimo Ario Tejo, and Wei Boon Yap. 2024. "An Immunoinformatic Approach for Identifying and Designing Conserved Multi-Epitope Vaccines for Coronaviruses" Biomedicines 12, no. 11: 2530. https://doi.org/10.3390/biomedicines12112530
APA StyleOng, Y. C., Tejo, B. A., & Yap, W. B. (2024). An Immunoinformatic Approach for Identifying and Designing Conserved Multi-Epitope Vaccines for Coronaviruses. Biomedicines, 12(11), 2530. https://doi.org/10.3390/biomedicines12112530