Abstract
Ctn[15-34], the C-terminal section of crotalicidin (Ctn), a cathelicidin from a South American pit viper, is an antimicrobial and antitumoral peptide with remarkably longer stability in human serum than the parent Ctn. In this work, a set of topoisomers of both Ctn and Ctn[15-34], including the retro, enantio, and retroenantio versions, were synthesized and tested to investigate the structural requirements for activity. All topoisomers were as active as the cognate sequences against Gram-negative bacteria and tumor cells while slightly more toxic towards normal cells. More importantly, the enhanced serum stability of the D-amino-acid-containing versions suggests that such topoisomers must be preferentially considered as future antimicrobial and anticancer peptide leads.
1. Introduction
Since the discovery of penicillin by Fleming in 1928 [1] and the ensuing golden era of antibiotic development (1930–1960), the prospects for anti-infective therapies have become increasingly problematic due to the rise in antimicrobial resistance (AMR), first observed as the ability of E. coli to synthesize penicillinase that inactivated penicillin [2], later (1960) as the lack of response of 80% of S. aureus-infected patients to penicillin [3], and since then on to the current, widespread AMR crisis, an alarming predicament that is unanimously regarded as one of the most serious threats to global health [4,5,6,7].
In order to fight AMR, it is essential to have a good understanding of the mechanisms underlying infection, in particular those related to the interaction between anti-infective agents and pathogen targets. In this regard, antimicrobial peptides (AMPs) are emerging as promising therapeutic alternatives in the worrying context of global AMR for reasons that include, among others, their simple but effective mechanisms of action—different from traditional antibiotics and with a low likelihood of giving rise to resistance [8]—broad spectrum (Gram-negative and -positive bacteria, fungi, protozoa, and viruses [9,10,11]), amenability to structural modification by versatile peptide engineering techniques, and affordable production costs. In addition, AMPs are also showing promise as potential antitumor agents [12]. Structurally, AMPs comprise a wide variety of motifs; although they share a generally cationic nature and a high content of hydrophobic residues, both features combine to promote amphipathic secondary structures that facilitate membrane interaction and ensuing biological action [13,14].
The cathelicidins are one of the main families of AMPs, widely distributed through the animal kingdom (from human LL-37 [15] to primitive hagfish species [16]), with an important role in host defense based on their broad antimicrobial activity [17]. The name cathelicidin refers to a primary structure where a conserved N-terminus harboring a signal peptide and a cathepsin L inhibitor (cathelin) domain precedes a C-terminal region from which the mature cathelicidin is proteolytically cleaved. Pertinent to this work, cathelicidin-related antimicrobial peptides (CRAMPs) with remarkable antimicrobial activity (Gram-negative bacteria) have been found in the venoms of both Asian and South American snakes [9]. Our laboratory has focused on one such CRAMP, crotalicidin (Ctn) from Crotalus durissus terrificus [18], from which a C-terminal fragment results from structure-based rational design, Ctn[15-34] [9,19,20], has been shown to have antimicrobial and antitumor properties similar or superior to the parent Ctn, including remarkable proteolytic stability in biological fluids [9,18].
In peptide research, the topoisomer (the term topoisomer is used to denote composition-identical (hence isomer) but three-dimensionally distinct (hence topo) variants of a given molecule, with structural changes translating into different bioactivity. Such a broad definition inevitably encompasses a wide variety of structural arrangements of identical molecular composition; in practice, the term is largely confined to the nucleic acid [21,22] and peptide/protein fields [23,24]) label is often used to describe the different spatial patterns multiple disulfide peptides can fold into as a result of different cysteine pairings. Less frequent but equally appropriate use of the term concerns peptide structures with altered sequence and/or stereochemical features within a fixed composition. This still rather broad category may be further narrowed down to peptides such as those in this work, i.e., with fully inverted amino acid sequence (retro isomers) or with the canonic sequence made up of residues of reversed chirality (enantio isomers), or with both features combined (retroenantio isomers). Research in this area over recent years has unveiled rather interesting features of these isomers, particularly the retroenantio ones [23,24,25,26,27].
Against this backdrop, the present study focuses on the topoisomers that result from applying retro, enantio, and retroenantio modifications to the original Ctn and Ctn[15-34] sequences. We hence report the synthesis of the six peptides (three each for Ctn and Ctn[15-34], Table 1), comment on their structural features, in particular, the similarities found by solution nuclear magnetic resonance (NMR) between the cognate and retroenantio versions, and examine their in vitro activity on both antimicrobial and antitumor screens, as well as their stability in human serum.
Table 1.
Primary structures of crotalicidin, Ctn[15-34] and their topoisomers.
2. Materials and Methods
2.1. Peptide Synthesis
Ctn (KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF), Ctn[15-34] (KKRLKKIFKKPMVIGVTIPF), and their six topoisomers (Table 1) were synthesized in C-terminal carboxamide form in a Liberty Blue instrument (CEM Corporation, Matthews, NC, USA) using Fmoc solid phase peptide synthesis (SPPS) at 0.1 or 0.25 mmol scale on Rink Amide ProTide resin. Side chain functionalities were protected with tert-butyl (Ser, Thr), tert-butyloxycarbonyl (Lys), and 2,2,4,6,7-pentamethyldihydrobenzo- furan-5-sulfonyl (Arg) groups. Four equivalents of Fmoc-L- or Fmoc-D-amino acid derivative and equivalent amounts of Oxyma Pure (Merck, Darmstadt, Germany) and N,N′-diisopropylcarbodiimide were used for the couplings, with N,N-dimethylformamide (DMF) as solvent. After chain assembly, full deprotection and cleavage from the resin were conducted with trifluoroacetic acid (TFA)/H2O/triisopropylsilane (95:2.5:2.5 v/v, 120 min, rt.). Peptides were precipitated with cold diethyl ether, dissolved in water, and lyophilized.
2.2. Peptide Analysis
Analytical reversed-phase HPLC or UHPLC were performed on C18 columns (4.6 × 50 mm, 3 μm; Phenomenex) in LC2010A or LC2040C3DPlus instruments (Shimadzu Corp., Kyoto, Japan). Linear gradients (15–50%) of solvent B (0.036% TFA in MeCN) into A (0.045% TFA in H2O) were used for elution at 1 mL/min (HPLC) or 0.6 mL/min (UHPLC) flow rate, with UV detection at 220 nm. LC-mass spectrometry was performed in an LC-MS 2010EV instrument (Shimadzu, Kyoto, Japan) fitted with an XBridge column (4.6 × 150 mm, 3.5 μm; Waters, Cerdanyola del Vallès, Spain), eluting with a 15–50% linear gradient of B (HCOOH/MeCN 0.08% v/v) into A (HCOOH/H2O 0.1%, v/v) over 15 min at 1 mL/min with UV detection at 220 nm.
2.3. Peptide Purification
Preparative HPLC runs were performed on a Luna C18 column (21.2 mm × 250 mm, 10 μm; Phenomenex), using linear gradients (15–50%) of solvent B (0.1% TFA in MeCN) into A (0.1% TFA in H2O), as required, at a flow rate of 25 mL/min. Fractions with adequate HPLC homogeneity (>95%) and the expected mass by LC-MS were pooled, lyophilized, and used in subsequent experiments. All the peptides were solved in water for resuspension.
2.4. NMR Spectroscopy
Samples were prepared by dissolving the lyophilized peptide (1–2 mg) in 0.5 mL of a fresh solution of 30 mM DPC-d38 (98% deuteration; Cambridge Isotope Laboratories, Inc Andover, MA) at pH 3.0 in either H2O/D2O (9:1 v/v) or pure D2O. Peptide concentrations were approximately 1 mM. Sodium 2,2-dimethyl-2-silapentane-5-sulfonate was added as an internal reference. pH was measured with a glass microelectrode (not corrected for isotope effects) and adjusted, if necessary, by adding minimal amounts of NaOD or DCl.
NMR spectra were recorded in a Bruker AVNEO-600 spectrometer operating at a 600.13 MHz proton frequency and equipped with a cryoprobe. Probe temperature was calibrated using a methanol sample; 1D and 2D spectra, i.e., double-filtered-quantum-phase-sensitive correlated spectroscopy (DFQ-COSY), total correlated spectroscopy (TOCSY), nuclear Overhauser enhancement spectroscopy (NOESY), and 1H−13C heteronuclear single quantum coherence spectra (HSQC), were acquired using standard pulse sequences, and processed with the TOPSPIN program (Bruker Biospin, Karlsruhe, Germany), as reported [28]. TOCSY and NOESY mixing times were 60 and 150 ms, respectively. The water signal was suppressed using an excitation sculping scheme [29]. 1H−13C HSQC spectra were acquired at natural heteronuclear abundance. The 13C δ-values were indirectly referenced using the IUPAC-recommended 13C/1H ratio of 0.25144953 [30].
1H and 13C assignment was achieved by standard sequential analysis [31,32] of 2D DFQ-COSY, TOCSY, and NOESY spectra acquired at 25 °C and 35 °C, examined in combination with the corresponding 2D 1H−13C HSQC spectra. The 13C chemical shift values served to confirm the assignment of side chains, in particular the repeated Lys residues. The spectra were analyzed using the NMRFAM-SPARKY software [33]. The assigned chemical shifts have been deposited at the BioMagResBank (http://www.bmrb.wisc.edu (accessed on 28 July 2022)) with accession codes 51536 (Ctn retroenantio) and 52537 (Ctn[15-34] retroenantio).
Secondary structure was delineated from the 1Hα and 13Cα chemical shift deviations, which are defined as ΔδHα = δHαobserved − δHαRC, ppm, and ΔδCα = δCαobserved − δCαRC, ppm, being δHαobserved and δCαobserved the 1Hα and 13Cα chemical shifts presented for the peptides, and δHαRC and δCαRC the random coil values, which were taken from Wishart et al. [34]. Negative ΔδHα and positive ΔδCα values are indicators of helical structures, and positive ΔδHα and negative ΔδCα values of β-sheets/extended structures are considered as random coil or disordered those with small absolute values (approximately |ΔδHα| ≤ 0.04 ppm and |ΔδCα| ≤ 0.4 ppm).
The percentages of helical populations were estimated from the ΔδHα values averaged for all the helical residues (ΔδHαAv, ppm) by applying Equation (1), as previously described [35,36].
% helix = 100 × (ΔδHαAv/ΔδHα100%helix)
The ΔδHα value for 100% helix (ΔδHα100%helix) was taken as −0.39 ppm, which is the averaged value in protein helices.
2.5. NMR Structure Calculation
Structure calculations were performed with the CYANA 3.98 program [37,38]. Upper limit distance restraints were obtained from the NOE cross-peaks present in 2D NOESY spectra recorded at 25 °C and 35 °C, which were integrated using the automatic integration subroutine of the Sparky program (T. D. Goddard and D. G. Kneller, Sparky 3, NMR assignment program, University of California, San Francisco, CA, USA). In addition, restrictions for i, i + 4 hydrogen bonds were incorporated for the helical regions, as deduced from the δHα and δCα values (Figures S1 and S2). The standard iterative protocol for automatic NOE assignment implemented in CYANA 3.98 was used. It consists of seven cycles of combined NOE assignment and structure calculation of 100 conformers per cycle. For each peptide, the final NMR structure corresponds to the ensemble of the 20 conformers with the lowest target function value. MOLMOL [39] was used to visualize the structures of the peptides. Structures are available upon request from the authors.
2.6. Bacterial Strains and MIC
Assays were performed on three Gram-negative bacteria: E. coli (BW25113, Coli Genetic Stock Center), A. baumannii (ATCC 15308, CECT, Valencia, Spain), and Pseudomonas sp. (ATCC15915, CECT). The minimal inhibitory concentration (MIC) of each peptide was determined as described by Wiegand et al. [40]. Peptide stocks in water were added to polypropylene 96-well plates (Greiner, Frickenhausen, Germany) and serially diluted from 100 to 0.2 μM. Fresh bacteria were incubated at 37 °C in Mueller Hinton Broth (MHB, Condalab, Torrejón de Ardoz, Spain) up to exponential growth and diluted to a final inoculum of 5 × 105 CFU/mL. BSA and acetic acid at 0.04% (w/v) and 0.002% (v/v) final concentration, respectively, were added to avoid peptide self-aggregation. Plates were incubated for 20–22 h at 37 °C. Each peptide was tested in duplicate. MIC values were the lowest peptide concentration where bacterial growth was not detected.
2.7. Cell Culture
Human HeLa S3 (cervix epithelial carcinoma), leukemia Jurkat E6.1 (T-cell lineage), U937 (histiocytic lymphoma), THP-1 (acute monocytic leukemia), and 1BR3G human fibroblasts were obtained from the Cell Lines Repository of the Institut Municipal d’Investigació Medica (Barcelona, Spain). BxPC3 (pancreas adenocarcinoma), A549 (lung carcinoma), SH-Sy5Y (neuroblastoma), Panc1 (epithelioid carcinoma), 786-O (renal cell adenocarcinoma), and HT29 (colorectal adenocarcinoma) were obtained from the Integrative Biomedical Materials and Nanomedicine lab at UPF (Barcelona, Spain). HeLa S3, Jurkat E6.1, U937, THP-1, Panc1, and 786-O were cultured in Roswell Park Memorial Institute medium (RPMI) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin/streptomycin solution and maintained at 37 °C in a humidified atmosphere with 5% of CO2. 1BR3G, BxPC3, A549, and HT29 were cultured in Dulbecco’s Modified Eagle’s Medium (DMEM) supplemented with 10% FBS and 1% penicillin/streptomycin solution and maintained at 37 °C in a humidified atmosphere with 5% of CO2. SH-Sy5Y was cultured in DMEM supplemented with 15% FBS and 1% penicillin/streptomycin and maintained at 37 °C in a humidified atmosphere with 5% of CO2. Cultures were maintained at 105–106 cell/mL densities. For 1BR3G human fibroblasts, BxPC3, A549, SH-Sy5Y, Panc1, 786-O, and HT29 were split every time they reached 80–90% of confluence after harvesting with PBS and trypsin.
2.8. Peptide Cytotoxicity
About 60,000 cells were added to different microfuge tubes containing 2-fold serial dilution of the peptide, with a final concentration in the range between 0.1–100 μM in RPMI containing 2% of FBS. After 30 min incubation at 37 °C and 5% of CO2, 100 mL of medium containing approximately 10,000 treated cells were transferred to a 96-well plate. Then, 15 μL of Cell Titer Blue dye (Promega, Madison, WI, USA) was added, and plates were reincubated for 24 h. Fluorescence was read at 4 and 24 h after dye addition in a Synergy HTX (BioTek, Winooski, VT, USA) reader, with λexc = 560 nm and λem = 620 nm. In the case of adherent cultures, 5000 cells/well were seeded in 96-well plates. After 24 h incubation at 37 °C and 5% of CO2, the medium was removed, and a new medium with 2% of FBS containing the various 2-fold dilution of the peptides was added. After a further 30 min, 15 μL of Cell Titer Blue dye was added to each well, and the measurement was done as above. Relative viability was calculated relative to a cell with only 2% FBS in the corresponding medium as a control (100% viability). All assays were conducted in triplicate.
2.9. Hemolytic Activity
Fresh human blood (10 mL) was collected in EDTA tubes and centrifuged at 1000× g for 10 min at 4 °C. After plasma removal, the pellet containing the erythrocytes was washed 3× with phosphate-buffered saline (PBS) and resuspended to an 8% (v/v) suspension in PBS. Then, 100 μL of the suspension was added to a final concentration of 4% (v/v) to microfuge tubs containing 2-fold serially diluted peptides (0.2–100 μM). The suspension was incubated for 30 min at 37 °C with agitation, then centrifuged for 2 min at 1000× g. The supernatant was transferred to 96-well plates, and hemoglobin was measured by OD at 540 nm in a Synergy HTX plate reader (BioTek). Positive and negative controls were 1% (v/v) Triton X-100 and untreated erythrocytes (4% v/v in PBS), respectively. Measurements were done in triplicate. Hemolysis was calculated as:
2.10. Serum Stability
Briefly, 0.5 mL each of human serum (Sigma-Aldrich, St. Louis, MO, USA) and peptide (1 mM in water) were mixed and incubated for 24 h at 37 °C with stirring. Aliquots (0.1 mL) were taken at 0, 1, 5, 10, 30, 120, 360 and 1440 min and treated with 20 μL of trichloroacetic acid (15% (v/v) in water). The suspension was centrifuged for 30 min at 4 °C and 13,000 rpm, and the supernatant was analyzed by HPLC as described above.
3. Results
3.1. Synthesis of Ctn and Ctn[15-34] Topoisomers
Since the Ctn and Ctn[15-34] sequences have proven to be valuable antimicrobial (AMP) and antitumor peptide (ATP) leads, we set out to decipher if their topoisomers have similar or even improved properties [9]. Table 1 shows a set of C-terminally amidated topoisomers produced by standard Fmoc solid-phase peptide synthesis (SPPS) methods. The analytical characterization is in the supplementary information (Table S4, pages S12–S14).
3.2. Minimal Inhibitory Concentration (MIC)
Ctn, Ctn[15-34], and their topoisomers were tested in minimal inhibitory concentration (MIC) assays against three representative Gram-negative bacteria (Pseudomonas sp., Escherichia coli, and Acinetobacter baumannii) (Table 2). The topoisomers were not tested against Gram-positive bacteria, as previous results for the cognate Ctn and Ctn[15-34] showed preferential activity against Gram-negative [9]. Comparing MIC values, we observed that while Ctn topoisomers lost around 50% activity in comparison to their precursor, Ctn[15-34] topoisomers performed almost undistinguishably from the original, thus qualifying as good AMP leads.
Table 2.
Minimal inhibitory concentrations (MICs) of Ctn, Ctn[15-34], and their topoisomers against Gram-negative bacteria.
3.3. Cell Viability Studies
The activity of Ctn, Ctn[15-34] and their topoisomers against U937, THP-1, Jurkat·6.1, HeLa S3, BxPC3, A549, SH-Sy5Y, Panc1, 786-O, and HT29 tumor cell lines was also studied. After incubation with peptide, cell viabilities were determined by resazurin, a nonfluorescent dye with a low metabolic activity that is reduced to fluorescent resorufin only by live cells and detected by a fluorescence spectrometer. As shown in Figure 1 and Figure 2, the peptides displayed selective toxicity in a concentration-dependent manner. Specifically, for leukemia cells (Figure 1), as previously reported [9], the most toxic peptide was Ctn, with IC50 values below 1 μM for Jurkat E6.1, THP-1, and U937; and in the low μM range (IC50 ≈ 3.47) for Hela S3. Similar results were also observed for the Ctn topoisomers. On the other hand, Ctn[15-34] and its topoisomers had little toxicity toward leukemia cells, with IC50 values in the mM range (Figure 1).
Figure 1.
Viability of leukemia cells upon peptide treatment for 24 h. Ctn[15-34] and Ctn topoisomers are depicted in black and orange, respectively. Results are the average of three replicates.
Figure 2.
Viability of non-leukemia cells upon peptide treatment for 24 h. Ctn[15-34] and Ctn topoisomers are depicted in black and orange, respectively. Results are the average of three replicates.
Similar toxicity studies were performed with other non-leukemia cell lines: BxPC3, A549, SH-Sy5Y, Panc1, 786-O, and HT29 (Figure 2). Ctn was again the most toxic peptide, particularly for neuroblastoma (SH-Sy5Y, IC50 ≈ 2.61 μM). The other cancer cell lines, with IC50 values near or above 10 μM, were not considered potential targets for either Ctn or its topoisomers. Likewise, Ctn[15-34] and its topoisomers had practically no effects on non-leukemia cells.
Cell viability of human fibroblast (1BR3G line derives from a normal fibroblast transformed with antigen T of SV40 (an oncogene), offering characteristics of a tumoral cell) after 24 h treatment with Ctn, Ctn[15-34], and their topoisomers was next investigated. Results showed that full-length Ctn and its topoisomers were more toxic than the Ctn[15-34] fragment and its congeners. Indeed, neither Ctn[15-34] (IC50 ≈ 14.32 μM) nor its retro version (IC50 ≈ 15.84 μM) were toxic. It is also worth noting the clear differences in terms of cell viability observed between D- and L-residue-containing peptides. Consistently, D-isomers were more toxic than the L- versions, with IC50 values of 2.7 μM and 4.3 μM for Ctn enantio and Ctn retroenantio, respectively (Figure 3), versus 191 μM and 43 μM for Ctn[15-34] enantio and Ctn[15-34] retroenantio.
Figure 3.
Toxicity of Ctn and Ctn[15-34] topoisomers to eukaryotic cells.
3.4. Hemolytic Activity
The hemolytic effect of the peptides was tested on human erythrocytes and showed Ctn topoisomers as moderately lytic peptides (ca. 30% at 100 μM) (Figure 4). In contrast, Ctn[15-34] and all its topoisomers were totally nonhemolytic up to 100 μM.
Figure 4.
Hemolysis data of Ctn and Ctn[15-34] topoisomers.
3.5. Serum Stability
All peptides were routinely tested for stability in human serum by LC-MS. Results confirmed the lower stability of Ctn and its topoisomers over Ctn[15-34]—previously reported as remarkably resilient to serum degradation [9,20]—and its counterparts. In general, the retro versions displayed stability trends similar to their cognates, although with slightly lower values (Figure 5). As expected, enantio and retroenantio peptides, by virtue of their D-amino acid content, were less susceptible to serum degradation, with 30% Ctn enantio and 40% Ctn retroenantio still remaining after 24 h exposure and up to 50% in the case of D-residue-containing Ctn[15-34] topoisomers. Of note was Ctn[15-34] retroenantio, with unusually high serum stability (t1/2 = 921 min), even for a linear enantiomeric peptide.
Figure 5.
Stability of Ctn and Ctn[15-34] topoisomers in human serum.
3.6. NMR Structures of Ctn and Ctn[15-34] Retroenantio Versions in DPC Micelles
Structures of Ctn and Ctn[15-34] retroenantio peptides were characterized by solution NMR in a membrane-like (DPC micelle) environment and compared with Ctn and Ctn[15-34] original versions [9]. The two DPro residues present in the retroenantio peptides present cis–trans isomerism. The small differences in chemical shifts between the 13Cβ and 13Cγ for both Pro residues (δPro = δCβ − δCγ, ppm; see Table S1) demonstrate that the rotameric state for both Pro in the two retroenantio peptides is trans [41], as was the case for the parent peptides [9]. Based on 1H and 13C chemical shift deviations (Figures S1 and S2), Ctn retroenantio forms a helix extending residues 11-33 (corresponding to residues 24-2 in parent Ctn), and Ctn[15-34] retroenantio a helix spanning residues 11-19 (corresponding to residues 24-16 in Ctn[15-34]). Thus, the helices formed by the retroenantio peptides are slightly longer than those in the cognates. In both peptides, the N-terminal segment (residues 1-10) is mainly disordered, similarly to the equivalent residues in the parent peptides. The helical populations are also similar between Ctn (79%) and Ctn retroenantio (78%) peptides, but helicity in Ctn[15-34] retroenantio peptide (56%) is higher than in the cognate fragment (15%) but lower than that of the entire Ctn retroenantio peptide (Table S2). To visualize the formed helices, structure calculations were performed using distance restraints derived from the experimentally observed NOEs (see Methods). The resulting structural ensembles show well-defined helices and a disorder N-terminal region (Figure S3 and Table S3). Figure 6 shows ribbon representations of these structures in comparison with those of the original versions. Despite the differences in helix lengths, the helices formed by the parent and retroenantio peptides displayed similar amphipathicity.
Figure 6.
Ribbon representations of helical regions determined by NMR of Ctn retroenantio (left, top), Ctn (left, bottom), Ctn[15-34] retroenantio (right, top), and Ctn[15-34] (right, bottom) peptides. Arg and Lys side chains are shown in blue, and all other side chains are shown in green. N- and C-termini as well as hydrophobic side chains are labeled.
4. Discussion
Bioactive peptides isolated from natural sources, including animal toxins, plant extracts, fungi, and bacteria, have long raised considerable interest for their manifold therapeutic properties [42,43]. Among such peptides, snake-venom-derived cathelicidins are an interesting family with demonstrable promising anti-infective and antitumor activities. Our group has contributed to this field by showing that crotalicidin (Ctn) and Ctn[15-34], a selected fragment thereof, kill bacteria through disruption of their membrane following three stages [19]: (1) initial peptide recruitment by electrostatic interactions, (2) surface accumulation, and (3) bacterial death by membrane disruption. Ctn[15-34] is additionally remarkable for its long-term stability in human serum [20] and low toxicity in healthy eukaryotic cells [9]. Even so, as natural peptides composed of L-amino acids, both Ctn and Ctn[15-34] remain susceptible to proteases and thus amenable to improvement by peptide engineering methods.
The enantiomers (D-amino acid versions) of natural bioactive peptides have been explored as a means to overcome the protease susceptibility of the native forms [20]. Unfortunately, as only a small fraction of biologically relevant interactions are chirality-indifferent, the application of strict enantiomers of bioactive peptides is confined to a few specific areas such as AMPs or cell-penetrating peptides (CPPs) [44,45]. In contrast, the retroenantio (re) approach [23], where the original bioactive sequence is reversed and made up of D-amino acids hence highly protease-resistant, has over recent years shown multiple examples of therapeutic promise. For instance, THRre, the retroenantio version of THR (THR is a peptide that interacts with the transferrin receptor but does not compete with transferrin [46,47]), has better blood–brain barrier (BBB)-crossing properties than its cognate, extensively degraded by proteases [24]. Our own group, applying the re approach, has recently developed an orally active BBB-crossing peptide candidate that minimizes the adverse cognitive effects of cannabinoid therapy while preserving analgesic properties [25].
In tune with these approaches, in this work, we have explored the structural and functional properties of the topoisomers of rattlesnake-derived AMPs crotalicidin (Ctn) and Ctn[15-34]. MIC assays showed the topoisomers to be effective AMPs (Table 2), particularly against Gram-negative bacteria, as previously reported for the cognate Ctn and Ctn[15-34] [9]. In addition, antitumoral screens [12,48] on various leukemia and HeLa cell lines showed Ctn topoisomers to be more cytotoxic than Ctn[15-34] analogs, also in agreement with previous observations [9]. Toxicity assays were extended to other cancer cell lines, showing an IC50 of 2.61 μM for Ctn against neuroblastoma that merits further study.
While the enantio and retroenantio versions, in general, confirmed expectations of enhanced serum survival (Section 3.5, Figure 5), they were, unfortunately, slightly more toxic in eukaryotic cells than the original L-peptides. The most probable reason for this toxicity is that mammalian cells, unlike bacteria, do not have racemases directly converting D- into L-amino acid residues [49]; an alternative two-step conversion pathway has been postulated, i.e., (i) transformation to α-keto acids by D-amino acid oxidase and D-aspartate oxidase; (ii) transamination to L-amino acids [50]. Unfortunately, this sequence produces H2O2 as a by-product, accumulation of which may result in lipid peroxidation and cell membrane damage [51].
Finally, solution NMR studies of Ctn and Ctn[15-34] retroenantio versions showed an increase in helix length in both peptides compared to their corresponding L-precursors, with a significant increase in the helix population of Ctn[15-34] retroenantio. Taking into account the well-known principles of helix stability [35], these differences could be explained by the fact that stabilizing contributions in α-helices are position-dependent, with the N-cap and C-cap residues playing an important role. For instance, because of the helix dipole, positively charged Lys and Arg favor helix formation at the C-terminal region and are helix-destabilizing at the N-terminal region. In our case, R18 and K19 located at the C-terminus of Ctn[15-34] retroenantio are very likely contributing to increase helix population, whereas the equivalent residues (R3 and K2) in the parent Ctn[15-34] peptide are likely to play an opposite role and decrease helix population at the N-terminus.
These structural issues notwithstanding, no obvious relation between helix population and activity can be inferred. The mechanism of action of Ctn[15-34] and Ctn in disrupting membranes is by electrostatic interaction between the positively charged peptide and the anionic head groups of bacterial membrane phospholipids [19]. The activities of the different Ctn and Ctn[15-34] topoisomers against Gram-negative bacteria are quite similar, suggesting that the interaction is predominantly electrostatic; hence, peptide 3D structure is of marginal significance. Both of the topoisomers studied preserve an amphipathic helix structure with a hydrophobic face that may interact with membrane lipids and a hydrophilic side compatible with aqueous environments [52].
This study was launched in the hope that Ctn[15-34], a peptide long-studied in our group for its promising combination of antimicrobial and antitumor properties with singular serum stability, could be further improved therapeutically by way of retro or retroenantio congeners. Unfortunately, such expectations were not obtained, and Ctn[15-34] in its original all-L version remains more competitive than any topoisomer. In contrast, Ctn retroenantio is more promising than Ctn and, therefore, worth investigating alongside Ctn[15-34] in in vivo studies.
Supplementary Materials
The following are available online at https://www.mdpi.com/article/10.3390/biomedicines10092110/s1: NMR data (Tables S1–S3; Figures S1–S3); analytical data of peptides (Table S4); HPLC traces and LC-MS spectra of peptides.
Author Contributions
Conceptualization, A.C.-A., C.P.-P., D.A. and M.T.; methodology, A.C.-A., D.S. and M.Á.J.; investigation, A.C.-A. and D.S.; data curation, A.C.-A., D.A., M.T. and M.Á.J.; writing—original draft preparation, A.C.-A. and S.D.; writing—review and editing A.C.-A., S.D., D.A., M.T. and M.Á.J.; and supervision, D.A. All authors have read and agreed to the published version of the manuscript.
Funding
Financial support from the Spanish Ministry of Economy and Innovation (grant AGL2017-84097-C2-2-R), from the Spanish Ministry of Science and Innovation (MCIN/AEI/10.13039/501100011033 grants PID2020-113184RB-C22; PID2020-112821GB-I00 and PID2020-114627RB-I00; MCIN/AEI/10.13039/501100011033/FEDER PDC2021-121544-I00), from the EU (Next GenerationEU/PRTR) and from La Caixa Banking Foundation (HR17-00409) is acknowledged.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
NMR assigned chemical shifts have been deposited at the BioMagResBank (http://www.bmrb.wisc.edu (accessed on 28 July 2022)) with accession codes 51536 (Ctn retroenantio) and 52537 (Ctn[15-34] retroenantio).
Acknowledgments
The Department of Medicine and Sciences at UPF is a member of the “María de Maeztu” Program for Units of Excellence in R&D (CEX2018-000792-M) from the Spanish Ministry of Economy and Competitiveness (MINECO). NMR experiments were performed in the “Manuel Rico” NMR laboratory (LMR) of the Spanish National Research Council (CSIC), a node of the Spanish Large-Scale National Facility (ICTS R-LRB).
Conflicts of Interest
The authors declare no conflict of interest.
References
- Fleming, A. On the antibacterial action of cultures of a penicillium, with special reference to their use in the isolation of b. influenzæ. Br. J. Exp. Pathol. 1929, 10, 236. [Google Scholar] [CrossRef]
- Abraham, E.P.; Chain, E. An enzyme from bacteria able to destroy penicillin. Nature 1940, 146, 837. [Google Scholar] [CrossRef]
- Lobanovska, M.; Pilla, G. Penicillin’s discovery and antibiotic resistance: Lessons for the future? Yale J. Biol. Med. 2017, 90, 135–145. [Google Scholar] [PubMed]
- Ghosh, S.; Bornman, C.; Zafer, M.M. Antimicrobial Resistance Threats in the emerging COVID-19 pandemic: Where do we stand? J. Infect. Public Health 2021, 14, 555–560. [Google Scholar] [CrossRef] [PubMed]
- Prestinaci, F.; Pezzotti, P.; Pantosti, A. Antimicrobial resistance: A global multifaceted phenomenon. Pathog. Glob. Health. 2015, 109, 309–318. [Google Scholar] [CrossRef] [PubMed]
- Toner, E.; Adalja, A.; Gronvall, G.K.; Cicero, A.; Inglesby, T.V. Antimicrobial Resistance Is a Global Health Emergency. Health Secur. 2015, 13, 153–155. [Google Scholar] [CrossRef]
- Aslam, B.; Wang, W.; Arshad, M.I.; Khurshid, M.; Muzammil, S.; Rasool, M.H.; Nisar, M.A.; Alvi, R.F.; Aslam, M.A.; Qamar, M.U.; et al. Antibiotic resistance: A rundown of a global crisis. Infect. Drug Resist. 2018, 11, 1645–1658. [Google Scholar] [CrossRef]
- Zhang, Q.Y.; Yan, Z.B.; Meng, Y.M.; Hong, X.Y.; Shao, G.; Ma, J.J.; Cheng, X.R.; Liu, J.; Kang, J.; Fu, C.Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [PubMed]
- Falcão, C.B.; Pérez-Peinado, C.; De La Torre, B.G.; Mayol, X.; Zamora-Carreras, H.; Jiménez, M.Á.; Rádis-Baptista, G.; Andreu, D. Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity. J. Med. Chem. 2015, 58, 8553–8563. [Google Scholar] [CrossRef]
- Jenssen, H.; Hamill, P.; Hancock, R.E.W. Peptide antimicrobial agents. Clin. Microbiol. Rev. 2006, 19, 491–511. [Google Scholar] [CrossRef] [Green Version]
- Zaiou, M. Multifunctional antimicrobial peptides: Therapeutic targets in several human diseases. J. Mol. Med. 2007, 85, 317–329. [Google Scholar] [CrossRef]
- Gaspar, D.; Veiga, A.S.; Castanho, M.A.R.B. From antimicrobial to anticancer peptides. A review. Front. Microbiol. 2013, 4, 294. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Zhang, Q.; Yuan, X.; Cao, Y.; Yuan, Y.; Yin, H.; Ding, X.; Zhu, Z.; Luo, S.Z. How charge distribution influences the function of membrane-active peptides: Lytic or cell-penetrating? Int. J. Biochem. Cell Biol. 2017, 83, 71–75. [Google Scholar] [CrossRef] [PubMed]
- Marín-Medina, N.; Ramírez, D.A.; Trier, S.; Leidy, C. Mechanical properties that influence antimicrobial peptide activity in lipid membranes. Appl. Microbiol. Biotechnol. 2016, 100, 10251–10263. [Google Scholar] [CrossRef] [PubMed]
- Gudmundsson, G.H.; Magnusson, K.P.; Chowdhary, B.P.; Johansson, M.; Andersson, L.; Boman, H.G. Structure of the gene for porcine peptide antibiotic PR-39, a cathelin gene family member: Comparative mapping of the locus for the human peptide antibiotic FALL-39. Proc. Natl. Acad. Sci. USA 1995, 92, 7085–7089. [Google Scholar] [CrossRef] [PubMed]
- Uzzell, T.; Stolzenberg, E.D.; Shinnar, A.E.; Zasloff, M. Hagfish intestinal antimicrobial peptides are ancient cathelicidins. Peptides 2003, 24, 1655–1667. [Google Scholar] [CrossRef]
- Zhao, H.; Gan, T.X.; Liu, X.D.; Jin, Y.; Lee, W.H.; Shen, J.H.; Zhang, Y. Identification and characterization of novel reptile cathelicidins from elapid snakes. Peptides 2008, 29, 1685–1691. [Google Scholar] [CrossRef]
- Falcão, C.B.; Radis-Baptista, G. Crotamine and crotalicidin, membrane active peptides from Crotalus durissus terrificus rattlesnake venom, and their structurally-minimized fragments for applications in medicine and biotechnology. Peptides 2020, 126, 1702342. [Google Scholar] [CrossRef]
- Pérez-Peinado, C.; Dias, S.A.; Domingues, M.M.; Benfield, A.H.; Freire, J.M.; Rádis-Baptista, G.; Gaspar, D.; Castanho, M.A.R.B.; Craik, D.J.; Henriques, S.T.; et al. Mechanisms of bacterial membrane permeabilization by crotalicidin (Ctn) and its fragment Ctn(15–34), antimicrobial peptides from rattlesnake venom. J. Biol. Chem. 2018, 293, 1536–1549. [Google Scholar] [CrossRef]
- Pérez-Peinado, C.; Defaus, S.; Sans-Comerma, L.; Valle, J.; Andreu, D. Decoding the human serum interactome of snake-derived antimicrobial peptide Ctn[15-34]: Toward an explanation for unusually long half-life. J. Proteomics 2019, 204, 103372. [Google Scholar] [CrossRef]
- Champoux, J.J. DNA Topoisomerases: Structure, Function, and Mechanism. Annu. Rev. Biochem. 2001, 70, 369–413. [Google Scholar] [CrossRef] [PubMed]
- Seol, Y.; Neuman, K.C. The dynamic interplay between DNA topoisomerases and DNA topology. Biophys. Rev. 2016, 8, 101–111. [Google Scholar] [CrossRef] [PubMed]
- Merrifield, R.B.; Juvvadi, P.; Andreu, D.; Ubach, J.; Boman, A.; Boman, H.G. Retro and retroenantio analogs of cecropin-melittin hybrids. Proc. Natl. Acad. Sci. USA 1995, 92, 3449–3453. [Google Scholar] [CrossRef] [PubMed]
- Prades, R.; Oller-Salvia, B.; Schwarzmaier, S.M.; Selva, J.; Moros, M.; Balbi, M.; Grazú, V.; De La Fuente, J.M.; Egea, G.; Plesnila, N.; et al. Applying the retro-enantio approach to obtain a peptide capable of overcoming the blood-brain barrier. Angew. Chemie. Int. Ed. 2015, 54, 3967–3972. [Google Scholar] [CrossRef]
- Gallo, M.; Moreno, E.; Defaus, S.; Ortega-Alvaro, A.; Gonzalez, A.; Robledo, P.; Cavaco, M.; Neves, V.; Castanho, M.A.R.B.; Casadó, V.; et al. Orally Active Peptide Vector Allows Using Cannabis to Fight Pain While Avoiding Side Effects. J. Med. Chem. 2021, 64, 6937–6948. [Google Scholar] [CrossRef]
- Grillo-Bosch, D.; Carulla, N.; Cruz, M.; Sánchez, L.; Pujol-Pina, R.; Madurga, S.; Rabanal, F.; Giralt, E. Retro-Enantio N-Methylated Peptides as β-Amyloid Aggregation Inhibitors. ChemMedChem 2009, 4, 1488–1494. [Google Scholar] [CrossRef]
- Doti, N.; Mardirossian, M.; Sandomenico, A.; Ruvo, M.; Caporale, A. Recent Applications of Retro-Inverso Peptides. Int. J. Mol. Sci. 2021, 22, 8677. [Google Scholar] [CrossRef]
- Mirassou, Y.; Santiveri, C.M.; Pérez de Vega, M.J.; González-Muñiz, R.; Jiménez, M.A. Disulfide Bonds versus Trp-Trp Pairs in Irregular β-Hairpins: NMR Structure of Vammin Loop 3-Derived Peptides as a Case Study. ChemBioChem 2009, 10, 902–910. [Google Scholar] [CrossRef]
- Hwang, T.L.; Shaka, A.J. Water Suppression That Works. Excitation Sculpting Using Arbitrary Wave-Forms and Pulsed-Field Gradients. J. Magn. Reson. Ser. A 1995, 112, 275–279. [Google Scholar] [CrossRef]
- Markley, J.L.; Bax, A.; Arata, Y.; Hilbers, C.W.; Kaptein, R.; Sykes, B.D.; Wright, P.E.; Wüthrich, K. Recommendations for the presentation of NMR structures of proteins and nucleic acids. J. Mol. Biol. 1998, 280, 933–952. [Google Scholar] [CrossRef]
- Wüthrich, K. NMR of Proteins and Nucleic Acids; John Wiley & Sons: New York, NY, USA, 1986. [Google Scholar]
- Wüthrich, K.; Billeter, M.; Braun, W. Polypeptide secondary structure determination by nuclear magnetic resonance observation of short proton-proton distances. J. Mol. Biol. 1984, 180, 715–740. [Google Scholar] [CrossRef]
- Lee, W.; Tonelli, M.; Markley, J.L. NMRFAM-SPARKY: Enhanced software for biomolecular NMR spectroscopy. Bioinformatics 2015, 31, 1325–1327. [Google Scholar] [CrossRef] [PubMed]
- Wishart, D.S.; Bigam, C.G.; Holm, A.; Hodges, R.S.; Sykes, B.D. 1H, 13C and 15N random coil NMR chemical shifts of the common amino acids. I. Investigations of nearest-neighbor effects. J. Biomol. NMR 1995, 5, 67–81. [Google Scholar] [CrossRef]
- Morales, P.; Jiménez, M.A. Design and structural characterisation of monomeric water-soluble α-helix and β-hairpin peptides: State-of-the-art. Arch. Biochem. Biophys. 2019, 661, 149–167. [Google Scholar] [CrossRef] [PubMed]
- Chaves-Arquero, B.; Pérez-Cañadillas, J.M.; Jiménez, M.A. Effect of Phosphorylation on the Structural Behaviour of Peptides Derived from the Intrinsically Disordered C-Terminal Domain of Histone H1.0. Chem. Eur. J. 2020, 26, 5970–5981. [Google Scholar] [CrossRef] [PubMed]
- Güntert, P. Automated wishNMR Structure Calculation With CYANA. Methods Mol. Biol. 2004, 278, 353–378. [Google Scholar]
- Güntert, P.; Mumenthaler, C.; Wüthrich, K. Torsion angle dynamics for NMR structure calculation with the new program Dyana. J. Mol. Biol. 1997, 273, 283–298. [Google Scholar] [CrossRef]
- Koradi, R.; Billeter, M.; Wüthrich, K. MOLMOL: A program for display and analysis of macromolecular structures. J. Mol. Graph. 1996, 14, 51–55. [Google Scholar] [CrossRef]
- Wiegand, I.; Hilpert, K.; Hancock, R.E.W. Agar and broth dilution methods to determine the minimal inhibitory concentration (MIC) of antimicrobial substances. Nat. Protoc. 2008, 3, 163–175. [Google Scholar] [CrossRef]
- Schubert, M.; Labudde, D.; Oschkinat, H.; Schmieder, P. A software tool for the prediction of Xaa-Pro peptide bond conformations in proteins based on 13C chemical shift statistics. J. Biomol. NMR 2002, 24, 149–154. [Google Scholar] [CrossRef]
- Sánchez, A.; Vázquez, A. Bioactive peptides: A review. Food Qual. Saf. 2017, 1, 29–46. [Google Scholar] [CrossRef]
- Bhandari, D.; Rafiq, S.; Gat, Y.; Gat, P.; Waghmare, R.; Kumar, V. A Review on Bioactive Peptides: Physiological Functions, Bioavailability and Safety. Int. J. Pept. Res. Ther. 2020, 26, 139–150. [Google Scholar] [CrossRef]
- Zhao, L.; Lu, W. Mirror image proteins. Curr. Opin. Chem. Biol. 2014, 22, 56–61. [Google Scholar] [CrossRef] [PubMed]
- Funke, S.A.; Willbold, D. Mirror image phage display—a method to generate D-peptideligands for use in diagnostic or therapeutical applications. Mol. Biosyst. 2009, 5, 783–786. [Google Scholar] [CrossRef] [PubMed]
- Oller-Salvia, B.; Sánchez-Navarro, M.; Giralt, E.; Teixidó, M. Blood–brain barrier shuttle peptides: An emerging paradigm for brain delivery. Chem. Soc. Rev. 2016, 45, 4690–4707. [Google Scholar] [CrossRef]
- Lee, J.H.; Engler, J.A.; Collawn, J.F.; Moore, B.A. Receptor mediated uptake of peptides that bind the human transferrin receptor. Eur. J. Biochem. 2001, 268, 2004–2012. [Google Scholar] [CrossRef]
- Schweizer, F. Cationic amphiphilic peptides with cancer-selective toxicity. Eur. J. Pharmacol. 2009, 625, 190–194. [Google Scholar] [CrossRef]
- Corrigan, J.J. D-Amino Acids in Animals. Science 1969, 164, 142–149. [Google Scholar] [CrossRef]
- D’Aniello, A.; D’Onofrio, G.; Pischetola, M.; D’Aniello, G.; Vetere, A.; Petrucelli, L.; Fisher, G.H. Biological role of D-amino acid oxidase and D-aspartate oxidase. Effects of D-amino acids. J. Biol. Chem. 1993, 268, 26941–26949. [Google Scholar] [CrossRef]
- Ercal, N.; Luo, X.; Matthews, R.H.; Armstrong, D.W. In Vitro Study of the Metabolic Effects of Amino Acids. Chirality 1996, 8, 24–29. [Google Scholar] [CrossRef]
- Wade, D.; Boman, A.; Wåhlin, B.; Drain, C.M.; Andreu, D.; Boman, H.G.; Merrifield, R.B. All-D amino acid-containing channel-forming antibiotic peptides. Proc. Natl. Acad. Sci. USA 1990, 87, 4761–4765. [Google Scholar] [CrossRef] [PubMed] [Green Version]
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).