Structural and Functional Insights into CRF Peptides and Their Receptors
Simple Summary
Abstract
1. Introduction
2. Pharmacological Properties of CRF Ligands and Their Receptors and Historical Overview
3. Structural Features of CRF Family Peptides
3.1. Peptide CRF Analogs
3.1.1. The N-Segment
3.1.2. The C-Segment
3.1.3. The I-Segment
3.2. Non-Peptide CRF Analogs
4. Receptors
4.1. The ECD
4.2. The J-Domain
5. The Two-Step Model of Ligand–Receptor Interaction
6. Structural Basis of Receptor Activation
7. Molecular Mechanisms of Ligand Selectivity
7.1. Selectivity of Non-Peptide Antagonists
7.2. Selectivity of Peptide Agonists
8. Concluding Remarks
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Liapakis, G.; Venihaki, M.; Margioris, A.; Grigoriadis, D.; Gkountelias, K. Members of CRF family and their receptors: From past to future. Curr. Med. Chem. 2011, 18, 2583–2600. [Google Scholar] [CrossRef] [PubMed]
- Vaughan, J.; Donaldson, C.; Bittencourt, J.; Perrin, M.H.; Lewis, K.; Sutton, S.; Chan, R.; Turnbull, A.V.; Lovejoy, D.; Rivier, C.; et al. Urocortin, a mammalian neuropeptide related to fish urotensin I and to corticotropin-releasing factor. Nature 1995, 378, 287–292. [Google Scholar] [CrossRef] [PubMed]
- Montecucchi, P.C.; Henschen, A. Amino acid composition and sequence analysis of sauvagine, a new active peptide from the skin of Phyllomedusa sauvagei. Int. J. Pept. Protein Res. 1981, 18, 113–120. [Google Scholar] [CrossRef] [PubMed]
- Lederis, K.; Letter, A.; McMaster, D.; Moore, G.; Schlesinger, D. Complete amino acid sequence of urotensin I, a hypotensive and corticotropin-releasing neuropeptide from Catostomus. Science 1982, 218, 162–165. [Google Scholar] [CrossRef] [PubMed]
- Reyes, T.M.; Lewis, K.; Perrin, M.H.; Kunitake, K.S.; Vaughan, J.; Arias, C.A.; Hogenesch, J.B.; Gulyas, J.; Rivier, J.; Vale, W.W.; et al. Urocortin II: A member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc. Natl. Acad. Sci. USA 2001, 98, 2843–2848. [Google Scholar] [CrossRef] [PubMed]
- Hsu, S.Y.; Hsueh, A.J. Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor. Nat. Med. 2001, 7, 605–611. [Google Scholar] [CrossRef]
- Lewis, K.; Li, C.; Perrin, M.H.; Blount, A.; Kunitake, K.; Donaldson, C.; Vaughan, J.; Reyes, T.M.; Gulyas, J.; Fischer, W.; et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc. Natl. Acad. Sci. USA 2001, 98, 7570–7575. [Google Scholar] [CrossRef]
- Potter, E.; Behan, D.P.; Fischer, W.H.; Linton, E.A.; Lowry, P.J.; Vale, W.W. Cloning and characterization of the cDNAs for human and rat corticotropin releasing factor-binding proteins. Nature 1991, 349, 423–426. [Google Scholar] [CrossRef]
- Behan, D.P.; Khongsaly, O.; Ling, N.; De Souza, E.B. Urocortin interaction with corticotropin-releasing factor (CRF) binding protein (CRF-BP): A novel mechanism for elevating ‘free’ CRF levels in human brain. Brain Res. 1996, 725, 263–267. [Google Scholar]
- Vale, W.; Spiess, J.; Rivier, C.; Rivier, J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and β-endorphin. Science 1981, 213, 1394–1397. [Google Scholar] [CrossRef]
- Chrousos, G.P. The hypothalamic-pituitary-adrenal axis and immune-mediated inflammation. N. Engl. J. Med. 1995, 332, 1351–1362. [Google Scholar] [CrossRef]
- Owens, M.J.; Nemeroff, C.B. Physiology and pharmacology of corticotropin-releasing factor. Pharmacol. Rev. 1991, 43, 425–473. [Google Scholar]
- Gold, P.W.; Chrousos, G.P. Organization of the stress system and its dysregulation in melancholic and atypical depression: High vs. low CRH/NE states. Mol. Psychiatry 2002, 7, 254–275. [Google Scholar] [CrossRef]
- Keck, M.E.; Holsboer, F. Hyperactivity of CRH neuronal circuits as a target for therapeutic interventions in affective disorders. Peptides 2001, 22, 835–844. [Google Scholar] [CrossRef]
- Reul, J.M.; Holsboer, F. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr. Opin. Pharmacol. 2002, 2, 23–33. [Google Scholar] [CrossRef]
- Dautzenberg, F.M.; Kilpatrick, G.J.; Hauger, R.L.; Moreau, J. Molecular biology of the CRH receptors—In the mood. Peptides 2001, 22, 753–760. [Google Scholar] [CrossRef] [PubMed]
- Behan, D.P.; Heinrichs, S.C.; Troncoso, J.C.; Liu, X.J.; Kawas, C.H.; Ling, N.; De Souza, E.B. Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer’s disease. Nature 1995, 378, 284–287. [Google Scholar] [CrossRef] [PubMed]
- De Souza, E.B.; Whitehouse, P.J.; Kuhar, M.J.; Price, D.L.; Vale, W.W. Reciprocal changes in corticotropin-releasing factor (CRF)-like immunoreactivity and CRF receptors in cerebral cortex of Alzheimer’s disease. Nature 1986, 319, 593–595. [Google Scholar] [CrossRef] [PubMed]
- Makrigiannakis, A.; Zoumakis, E.; Kalantaridou, S.; Coutifaris, C.; Margioris, A.N.; Coukos, G.; Rice, K.C.; Gravanis, A.; Chrousos, G.P. Corticotropin-releasing hormone promotes blastocyst implantation and early maternal tolerance. Nat. Immunol. 2001, 2, 1018–1024. [Google Scholar] [CrossRef] [PubMed]
- Chrousos, G.P.; Torpy, D.J.; Gold, P.W. Interactions between the hypothalamic-pituitary-adrenal axis and the female reproductive system: Clinical implications. Ann. Intern. Med. 1998, 129, 229–240. [Google Scholar] [CrossRef] [PubMed]
- Martinez, V.; Rivier, J.; Wang, L.; Tache, Y. Central injection of a new corticotropin-releasing factor (CRF) antagonist, astressin, blocks CRF- and stress-related alterations of gastric and colonic motor function. J. Pharmacol. Exp. Ther. 1997, 280, 754–760. [Google Scholar] [PubMed]
- Orth, D.N. Corticotropin-releasing hormone in humans. Endocr. Rev. 1992, 13, 164–191. [Google Scholar] [PubMed]
- Parkes, D.G.; Weisinger, R.S.; May, C.N. Cardiovascular actions of CRH and urocortin: An update. Peptides 2001, 22, 821–827. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Dikkes, P.; Carrigan, A.; Karalis, K.P. Corticotropin-releasing hormone regulates IL-6 expression during inflammation. J. Clin. Investig. 2001, 108, 1159–1166. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Majzoub, J.A. Animal models of CRH deficiency. Front. Neuroendocrinol. 1999, 20, 122–145. [Google Scholar] [CrossRef] [PubMed]
- Wang, L.; Martinez, V.; Rivier, J.E.; Tache, Y. Peripheral urocortin inhibits gastric emptying and food intake in mice: Differential role of CRF receptor 2. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2001, 281, R1401–R1410. [Google Scholar] [CrossRef]
- Martinez, V.; Wang, L.; Rivier, J.E.; Vale, W.; Tache, Y. Differential actions of peripheral corticotropin-releasing factor (CRF), urocortin II, and urocortin III on gastric emptying and colonic transit in mice: Role of CRF receptor subtypes 1 and 2. J. Pharmacol. Exp. Ther. 2002, 301, 611–617. [Google Scholar] [CrossRef]
- Coste, S.C.; Kesterson, R.A.; Heldwein, K.A.; Stevens, S.L.; Heard, A.D.; Hollis, J.H.; Murray, S.E.; Hill, J.K.; Pantely, G.A.; Hohimer, A.R.; et al. Abnormal adaptations to stress and impaired cardiovascular function in mice lacking corticotropin-releasing hormone receptor-2. Nat. Genet. 2000, 24, 403–409. [Google Scholar] [CrossRef]
- Coste, S.C.; Quintos, R.F.; Stenzel-Poore, M.P. Corticotropin-releasing hormone-related peptides and receptors: Emergent regulators of cardiovascular adaptations to stress. Trends Cardiovasc. Med. 2002, 12, 176–182. [Google Scholar] [CrossRef]
- Karalis, K.; Sano, H.; Redwine, J.; Listwak, S.; Wilder, R.L.; Chrousos, G.P. Autocrine or paracrine inflammatory actions of corticotropin-releasing hormone in vivo. Science 1991, 254, 421–423. [Google Scholar] [CrossRef]
- Koob, G.F.; Bloom, F.E. Corticotropin-releasing factor and behavior. Fed. Proc. 1985, 44, 259–263. [Google Scholar]
- Kempuraj, D.; Papadopoulou, N.G.; Lytinas, M.; Huang, M.; Kandere-Grzybowska, K.; Madhappan, B.; Boucher, W.; Christodoulou, S.; Athanassiou, A.; Theoharides, T.C. Corticotropin-releasing hormone and its structurally related urocortin are synthesized and secreted by human mast cells. Endocrinology 2004, 145, 43–48. [Google Scholar] [CrossRef]
- Dedic, N.; Chen, A.; Deussing, J.M. The CRF Family of Neuropeptides and their Receptors—Mediators of the Central Stress Response. Curr. Mol. Pharmacol. 2018, 11, 4–31. [Google Scholar] [CrossRef]
- Sanders, J.; Nemeroff, C. The CRF System as a Therapeutic Target for Neuropsychiatric Disorders. Trends Pharmacol. Sci. 2016, 37, 1045–1054. [Google Scholar] [CrossRef] [PubMed]
- Makrigiannakis, A.; Vrekoussis, T.; Zoumakis, E.; Navrozoglou, I.; Kalantaridou, S.N. CRH Receptors in Human Reproduction. Curr. Mol. Pharmacol. 2018, 11, 81–87. [Google Scholar] [CrossRef] [PubMed]
- Basman, C.; Agrawal, P.; Knight, R.; Saravolatz, L.; McRee, C.; Chen-Scarabelli, C.; Narula, J.; Scarabelli, T. Cardioprotective Utility of Urocortin in Myocardial Ischemia- Reperfusion Injury: Where do We Stand? Curr. Mol. Pharmacol. 2018, 11, 32–38. [Google Scholar] [CrossRef] [PubMed]
- Pagan-Busigo, J.E.; Lopez-Carrasquillo, J.; Appleyard, C.B.; Torres-Reveron, A. Beyond depression and anxiety; a systematic review about the role of corticotropin-releasing hormone antagonists in diseases of the pelvic and abdominal organs. PLoS ONE 2022, 17, e0264909. [Google Scholar] [CrossRef]
- Arborelius, L.; Owens, M.J.; Plotsky, P.M.; Nemeroff, C.B. The role of corticotropin-releasing factor in depression and anxiety disorders. J. Endocrinol. 1999, 160, 1–12. [Google Scholar] [CrossRef]
- Muller, M.B.; Zimmermann, S.; Sillaber, I.; Hagemeyer, T.P.; Deussing, J.M.; Timpl, P.; Kormann, M.S.; Droste, S.K.; Kuhn, R.; Reul, J.M.; et al. Limbic corticotropin-releasing hormone receptor 1 mediates anxiety-related behavior and hormonal adaptation to stress. Nat. Neurosci. 2003, 6, 1100–1107. [Google Scholar] [CrossRef] [PubMed]
- Timpl, P.; Spanagel, R.; Sillaber, I.; Kresse, A.; Reul, J.M.; Stalla, G.K.; Blanquet, V.; Steckler, T.; Holsboer, F.; Wurst, W. Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1. Nat. Genet. 1998, 19, 162–166. [Google Scholar] [CrossRef] [PubMed]
- Zobel, A.W.; Nickel, T.; Kunzel, H.E.; Ackl, N.; Sonntag, A.; Ising, M.; Holsboer, F. Effects of the high-affinity corticotropin-releasing hormone receptor 1 antagonist R121919 in major depression: The first 20 patients treated. J. Psychiatr. Res. 2000, 34, 171–181. [Google Scholar] [CrossRef]
- Ising, M.; Zimmermann, U.S.; Kunzel, H.E.; Uhr, M.; Foster, A.C.; Learned-Coughlin, S.M.; Holsboer, F.; Grigoriadis, D.E. High-affinity CRF1 receptor antagonist NBI-34041: Preclinical and clinical data suggest safety and efficacy in attenuating elevated stress response. Neuropsychopharmacology 2007, 32, 1941–1949. [Google Scholar] [CrossRef]
- Zorrilla, E.P.; Koob, G.F. Progress in corticotropin-releasing factor-1 antagonist development. Drug Discov. Today 2010, 15, 371–383. [Google Scholar] [CrossRef]
- Valdez, G.R.; Inoue, K.; Koob, G.F.; Rivier, J.; Vale, W.; Zorrilla, E.P. Human urocortin II: Mild locomotor suppressive and delayed anxiolytic-like effects of a novel corticotropin-releasing factor related peptide. Brain Res. 2002, 943, 142–150. [Google Scholar] [CrossRef] [PubMed]
- Valdez, G.R.; Zorrilla, E.P.; Rivier, J.; Vale, W.W.; Koob, G.F. Locomotor suppressive and anxiolytic-like effects of urocortin 3, a highly selective type 2 corticotropin-releasing factor agonist. Brain Res. 2003, 980, 206–212. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Sakihara, S.; Subramanian, S.; Dikkes, P.; Weninger, S.C.; Liapakis, G.; Graf, T.; Majzoub, J.A. Urocortin III, A Novel Murine Brain Neuropeptide of the Corticotropin-Releasing Hormone Family: Modulation by Stress and Attenuation of Some Anxiety-Like Behaviors. J. Neuroendocrinol. 2004, 16, 411–422. [Google Scholar] [CrossRef] [PubMed]
- Venkatasubramanian, S.; Griffiths, M.E.; McLean, S.G.; Miller, M.R.; Luo, R.; Lang, N.N.; Newby, D.E. Vascular effects of urocortins 2 and 3 in healthy volunteers. J. Am. Heart Assoc. 2013, 2, e004267. [Google Scholar] [CrossRef] [PubMed]
- Bale, T.L.; Hoshijima, M.; Gu, Y.; Dalton, N.; Anderson, K.R.; Lee, K.F.; Rivier, J.; Chien, K.R.; Vale, W.W.; Peterson, K.L. The cardiovascular physiologic actions of urocortin II: Acute effects in murine heart failure. Proc. Natl. Acad. Sci. USA 2004, 101, 3697–3702. [Google Scholar] [CrossRef] [PubMed]
- Tache, Y.; Larauche, M.; Yuan, P.Q.; Million, M. Brain and Gut CRF Signaling: Biological Actions and Role in the Gastrointestinal Tract. Curr. Mol. Pharmacol. 2018, 11, 51–71. [Google Scholar] [CrossRef]
- Rivier, J.E. Prospective Clinical Applications of CRF Peptide Antagonists. Curr. Mol. Pharmacol. 2017, 10, 264–269. [Google Scholar] [CrossRef]
- Torres-Reverón, A.; Rivera-Lopez, L.L.; Flores, I.; Appleyard, C.B. Antagonizing the corticotropin releasing hormone receptor 1 with antalarmin reduces the progression of endometriosis. PLoS ONE 2018, 13, e0197698. [Google Scholar] [CrossRef] [PubMed]
- Sarafoglou, K.; Barnes, C.N.; Huang, M.; Imel, E.A.; Madu, I.J.; Merke, D.P.; Moriarty, D.; Nakhle, S.; Newfield, R.S.; Vogiatzi, M.G.; et al. Tildacerfont in Adults with Classic Congenital Adrenal Hyperplasia: Results from Two Phase 2 Studies. J. Clin. Endocrinol. Metab. 2021, 106, e4666–e4679. [Google Scholar] [CrossRef]
- Harmar, A.J. Family-B G-protein-coupled receptors. Genome. Biol. 2001, 2, REVIEWS3013. [Google Scholar] [CrossRef]
- Gkountelias, K.; Papadokostaki, M.; Javitch, J.A.; Liapakis, G. Exploring the binding site crevice of a family B G protein-coupled receptor, the type 1 corticotropin releasing factor receptor. Mol. Pharmacol. 2010, 78, 785–793. [Google Scholar] [CrossRef]
- Hillhouse, E.W.; Grammatopoulos, D.K. The molecular mechanisms underlying the regulation of the biological activity of corticotropin-releasing hormone receptors: Implications for physiology and pathophysiology. Endocr. Rev. 2006, 27, 260–286. [Google Scholar] [CrossRef]
- Grammatopoulos, D.K.; Ourailidou, S. CRH Receptor Signalling: Potential Roles in Pathophysiology. Curr. Mol. Pharmacol. 2017, 10, 296–310. [Google Scholar] [CrossRef] [PubMed]
- Cong, Z.; Liang, Y.-L.; Zhou, Q.; Darbalaei, S.; Zhao, F.; Feng, W.; Zhao, L.; Xu, H.E.; Yang, D.; Wang, M.-W. Structural perspective of class B1 GPCR signaling. Trends Pharmacol. Sci. 2022, 43, 321–334. [Google Scholar] [CrossRef] [PubMed]
- Bockaert, J.; Pin, J.P. Molecular tinkering of G protein-coupled receptors: An evolutionary success. EMBO J. 1999, 18, 1723–1729. [Google Scholar] [CrossRef]
- Islam, M.R.; Teleb, M.; Karageorgos, V.; Sakellaris, S.; Papadopoulos, M.; Pirmettis, I.; Fronczek, F.R.; Liapakis, G.; Fahmy, H. Design, synthesis, structural optimization, SAR, in silico prediction of physicochemical properties and pharmacological evaluation of novel & potent thiazolo[4,5-d]pyrimidine corticotropin releasing factor (CRF) receptor antagonists. Eur. J. Pharm. Sci. 2022, 169, 106084. [Google Scholar] [CrossRef]
- Grigoriadis, D.E.; Liu, X.J.; Vaughn, J.; Palmer, S.F.; True, C.D.; Vale, W.W.; Ling, N.; De Souza, E.B. 125I-Tyro-sauvagine: A novel high affinity radioligand for the pharmacological and biochemical study of human corticotropin-releasing factor 2 α receptors. Mol. Pharmacol. 1996, 50, 679–686. [Google Scholar]
- Dautzenberg, F.M.; Py-Lang, G.; Higelin, J.; Fischer, C.; Wright, M.B.; Huber, G. Different binding modes of amphibian and human corticotropin-releasing factor type 1 and type 2 receptors: Evidence for evolutionary differences. J. Pharmacol. Exp. Ther. 2001, 296, 113–120. [Google Scholar]
- Rivier, J.; Spiess, J.; Vale, W. Characterization of rat hypothalamic corticotropin-releasing factor. Proc. Natl. Acad. Sci. USA 1983, 80, 4851–4855. [Google Scholar] [CrossRef]
- Shibahara, S.; Morimoto, Y.; Furutani, Y.; Notake, M.; Takahashi, H.; Shimizu, S.; Horikawa, S.; Numa, S. Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene. EMBO J 1983, 2, 775–779. [Google Scholar] [CrossRef]
- Patthy, M.; Horvath, J.; Mason-Garcia, M.; Szoke, B.; Schlesinger, D.H.; Schally, A.V. Isolation and amino acid sequence of corticotropin-releasing factor from pig hypothalami. Proc. Natl. Acad. Sci. USA 1985, 82, 8762–8766. [Google Scholar] [CrossRef]
- Okawara, Y.; Morley, S.D.; Burzio, L.O.; Zwiers, H.; Lederis, K.; Richter, D. Cloning and sequence analysis of cDNA for corticotropin-releasing factor precursor from the teleost fish Catostomus commersoni. Proc. Natl. Acad. Sci. USA 1988, 85, 8439–8443. [Google Scholar] [CrossRef] [PubMed]
- Stenzel-Poore, M.P.; Heldwein, K.A.; Stenzel, P.; Lee, S.; Vale, W.W. Characterization of the genomic corticotropin-releasing factor (CRF) gene from Xenopus laevis: Two members of the CRF family exist in amphibians. Mol. Endocrinol. 1992, 6, 1716–1724. [Google Scholar]
- Donaldson, C.J.; Sutton, S.W.; Perrin, M.H.; Corrigan, A.Z.; Lewis, K.A.; Rivier, J.E.; Vaughan, J.M.; Vale, W.W. Cloning and characterization of human urocortin. Endocrinology 1996, 137, 2167–2170, Erratum in Endocrinoogy 1996, 137, 3896. [Google Scholar] [CrossRef] [PubMed]
- Grace, C.R.; Perrin, M.H.; Cantle, J.P.; Vale, W.W.; Rivier, J.E.; Riek, R. Common and divergent structural features of a series of corticotropin releasing factor-related peptides. J. Am. Chem. Soc. 2007, 129, 16102–16114. [Google Scholar] [CrossRef] [PubMed]
- Ohta, N.; Mochizuki, T.; Hoshino, M.; Jun, L.; Kobayashi, H.; Yanaihara, N. Adrenocorticotropic hormone-releasing activity of urotensin I and its fragments in vitro. J. Pept. Res. 1997, 50, 178–183. [Google Scholar] [CrossRef] [PubMed]
- Rivier, J.; Rivier, C.; Vale, W. Synthetic competitive antagonists of corticotropin-releasing factor: Effect on ACTH secretion in the rat. Science 1984, 224, 889–891. [Google Scholar] [CrossRef]
- Kornreich, W.D.; Galyean, R.; Hernandez, J.F.; Craig, A.G.; Donaldson, C.J.; Yamamoto, G.; Rivier, C.; Vale, W.; Rivier, J. Alanine series of ovine corticotropin releasing factor (oCRF): A structure-activity relationship study. J. Med. Chem. 1992, 35, 1870–1876. [Google Scholar] [CrossRef]
- Mesleh, M.F.; Shirley, W.A.; Heise, C.E.; Ling, N.; Maki, R.A.; Laura, R.P. NMR structural characterization of a minimal peptide antagonist bound to the extracellular domain of the corticotropin-releasing factor1 receptor. J. Biol. Chem. 2007, 282, 6338–6346. [Google Scholar] [CrossRef] [PubMed]
- Rijkers, D.T.; Kruijtzer, J.A.; van Oostenbrugge, M.; Ronken, E.; den Hartog, J.A.; Liskamp, R.M. Structure-activity studies on the corticotropin releasing factor antagonist astressin, leading to a minimal sequence necessary for antagonistic activity. Chembiochem 2004, 5, 340–348. [Google Scholar] [CrossRef] [PubMed]
- Pioszak, A.A.; Parker, N.R.; Suino-Powell, K.; Xu, H.E. Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1. J. Biol. Chem. 2008, 283, 32900–32912. [Google Scholar] [CrossRef]
- Weiss, G.A.; Watanabe, C.K.; Zhong, A.; Goddard, A.; Sidhu, S.S. Rapid mapping of protein functional epitopes by combinatorial alanine scanning. Proc. Natl. Acad. Sci. USA 2000, 97, 8950–8954. [Google Scholar] [CrossRef]
- Yamada, Y.; Mizutani, K.; Mizusawa, Y.; Hantani, Y.; Tanaka, M.; Tanaka, Y.; Tomimoto, M.; Sugawara, M.; Imai, N.; Yamada, H.; et al. New class of corticotropin-releasing factor (CRF) antagonists: Small peptides having high binding affinity for CRF receptor. J. Med. Chem. 2004, 47, 1075–1078. [Google Scholar] [CrossRef]
- Beyermann, M.; Rothemund, S.; Heinrich, N.; Fechner, K.; Furkert, J.; Dathe, M.; Winter, R.; Krause, E.; Bienert, M. A role for a helical connector between two receptor binding sites of a long-chain peptide hormone. J. Biol. Chem. 2000, 275, 5702–5709. [Google Scholar] [CrossRef]
- Pallai, P.V.; Mabilia, M.; Goodman, M.; Vale, W.; Rivier, J. Structural homology of corticotropin-releasing factor, sauvagine, and urotensin I: Circular dichroism and prediction studies. Proc. Natl. Acad. Sci. USA 1983, 80, 6770–6774. [Google Scholar] [CrossRef] [PubMed]
- Dathe, M.; Fabian, H.; Gast, K.; Zirwer, D.; Winter, R.; Beyermann, M.; Schumann, M.; Bienert, M. Conformational differences of ovine and human corticotropin releasing hormone. A CD, IR, NMR and dynamic light scattering study. Int. J. Pept. Protein Res. 1996, 47, 383–393. [Google Scholar] [CrossRef]
- Heinrich, N.; Meyer, M.R.; Furkert, J.; Sasse, A.; Beyermann, M.; Bonigk, W.; Berger, H. Corticotropin-releasing factor (CRF) agonists stimulate testosterone production in mouse leydig cells through CRF receptor-1. Endocrinology 1998, 139, 651–658. [Google Scholar] [CrossRef]
- Rivier, J.; Rivier, C.; Galyean, R.; Miranda, A.; Miller, C.; Craig, A.G.; Yamamoto, G.; Brown, M.; Vale, W. Single point D-substituted corticotropin-releasing factor analogues: Effects on potency and physicochemical characteristics. J. Med. Chem. 1993, 36, 2851–2859. [Google Scholar] [CrossRef]
- Rothemund, S.; Krause, E.; Beyermann, M.; Dathe, M.; Bienert, M.; Hodges, R.S.; Sykes, B.D.; Sonnichsen, F.D. Peptide destabilization by two adjacent D-amino acids in single-stranded amphipathic α-helices. Pept. Res. 1996, 9, 79–87. [Google Scholar]
- Eckart, K.; Jahn, O.; Radulovic, J.; Tezval, H.; Werven, L.; Spiess, J. A single amino acid serves as an affinity switch between the receptor and the binding protein of corticotropin-releasing factor: Implications for the design of agonists and antagonists. Proc. Natl. Acad. Sci. USA 2001, 98, 11142–11147. [Google Scholar] [CrossRef]
- Gilligan, P.J.; Robertson, D.W.; Zaczek, R. Corticotropin releasing factor (CRF) receptor modulators: Progress and opportunities for new therapeutic agents. J. Med. Chem. 2000, 43, 1641–1660. [Google Scholar] [CrossRef] [PubMed]
- Grigoriadis, D.E.; Haddach, M.; Ling, N.; Saunders, J. The CRF Receptor: Structure, Function and Potential for Therapeutic Intervention. Curr. Med. Chem. Cent. Nerv. Syst. Agents 2001, 1, 63–97. [Google Scholar] [CrossRef]
- Chen, Y.L.; Braselton, J.; Forman, J.; Gallaschun, R.J.; Mansbach, R.; Schmidt, A.W.; Seeger, T.F.; Sprouse, J.S.; Tingley, F.D., 3rd; Winston, E.; et al. Synthesis and SAR of 2-aryloxy-4-alkoxy-pyridines as potent orally active corticotropin-releasing factor 1 receptor antagonists. J. Med. Chem. 2008, 51, 1377–1384. [Google Scholar] [CrossRef]
- Million, M.; Zhao, J.-F.; Luckey, A.; Czimmer, J.; Maynard, G.D.; Kehne, J.; Hoffman, D.C.; Taché, Y. The Newly Developed CRF1-Receptor Antagonists, NGD 98-2 and NGD 9002, Suppress Acute Stress-Induced Stimulation of Colonic Motor Function and Visceral Hypersensitivity in Rats. PLoS ONE 2013, 8, e73749. [Google Scholar] [CrossRef]
- Molteni, V.; Penzotti, J.; Wilson, D.M.; Termin, A.P.; Mao, L.; Crane, C.M.; Hassman, F.; Wang, T.; Wong, H.; Miller, K.J.; et al. N-phenylphenylglycines as novel corticotropin releasing factor receptor antagonists. J. Med. Chem. 2004, 47, 2426–2429. [Google Scholar] [CrossRef] [PubMed]
- Williams, J.P. Corticotropin-releasing factor 1 receptor antagonists: A patent review. Expert Opin. Ther. Pat. 2013, 23, 1057–1068. [Google Scholar] [CrossRef] [PubMed]
- Perrin, M.H.; Sutton, S.; Bain, D.L.; Berggren, W.T.; Vale, W.W. The first extracellular domain of corticotropin releasing factor-R1 contains major binding determinants for urocortin and astressin. Endocrinology 1998, 139, 566–570. [Google Scholar] [CrossRef] [PubMed]
- Perrin, M.H.; Fischer, W.H.; Kunitake, K.S.; Craig, A.G.; Koerber, S.C.; Cervini, L.A.; Rivier, J.E.; Groppe, J.C.; Greenwald, J.; Moller Nielsen, S.; et al. Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor. J. Biol. Chem. 2001, 276, 31528–31534. [Google Scholar] [CrossRef]
- Perrin, M.H.; DiGruccio, M.R.; Koerber, S.C.; Rivier, J.E.; Kunitake, K.S.; Bain, D.L.; Fischer, W.H.; Vale, W.W. A soluble form of the first extracellular domain of mouse type 2β corticotropin-releasing factor receptor reveals differential ligand specificity. J. Biol. Chem. 2003, 278, 15595–15600. [Google Scholar] [CrossRef]
- Klose, J.; Fechner, K.; Beyermann, M.; Krause, E.; Wendt, N.; Bienert, M.; Rudolph, R.; Rothemund, S. Impact of N-terminal domains for corticotropin-releasing factor (CRF) receptor-ligand interactions. Biochemistry 2005, 44, 1614–1623. [Google Scholar] [CrossRef] [PubMed]
- Grace, C.R.; Perrin, M.H.; Gulyas, J.; Digruccio, M.R.; Cantle, J.P.; Rivier, J.E.; Vale, W.W.; Riek, R. Structure of the N-terminal domain of a type B1 G protein-coupled receptor in complex with a peptide ligand. Proc. Natl. Acad. Sci. USA 2007, 104, 4858–4863. [Google Scholar] [CrossRef] [PubMed]
- Hofmann, B.A.; Sydow, S.; Jahn, O.; van Werven, L.; Liepold, T.; Eckart, K.; Spiess, J. Functional and protein chemical characterization of the N-terminal domain of the rat corticotropin-releasing factor receptor 1. Protein Sci. 2001, 10, 2050–2062. [Google Scholar] [CrossRef]
- Grace, C.R.; Perrin, M.H.; DiGruccio, M.R.; Miller, C.L.; Rivier, J.E.; Vale, W.W.; Riek, R. NMR structure and peptide hormone binding site of the first extracellular domain of a type B1 G protein-coupled receptor. Proc. Natl. Acad. Sci. USA 2004, 101, 12836–12841. [Google Scholar] [CrossRef] [PubMed]
- Qi, L.J.; Leung, A.T.; Xiong, Y.; Marx, K.A.; Abou-Samra, A.B. Extracellular cysteines of the corticotropin-releasing factor receptor are critical for ligand interaction. Biochemistry 1997, 36, 12442–12448. [Google Scholar]
- Dore, A.S.; Bortolato, A.; Hollenstein, K.; Cheng, R.K.Y.; Read, R.J.; Marshall, F.H. Decoding Corticotropin-Releasing Factor Receptor Type 1 Crystal Structures. Curr. Mol. Pharmacol. 2017, 10, 334–344. [Google Scholar] [CrossRef]
- Koth, C.M.; Murray, J.M.; Mukund, S.; Madjidi, A.; Minn, A.; Clarke, H.J.; Wong, T.; Chiang, V.; Luis, E.; Estevez, A.; et al. Molecular basis for negative regulation of the glucagon receptor. Proc. Natl. Acad. Sci. USA 2012, 109, 14393–14398. [Google Scholar] [CrossRef]
- Ma, S.; Shen, Q.; Zhao, L.H.; Mao, C.; Zhou, X.E.; Shen, D.D.; de Waal, P.W.; Bi, P.; Li, C.; Jiang, Y.; et al. Molecular Basis for Hormone Recognition and Activation of Corticotropin-Releasing Factor Receptors. Mol. Cell 2020, 77, 669–680.e4. [Google Scholar] [CrossRef]
- Gkountelias, K.; Tselios, T.; Venihaki, M.; Deraos, G.; Lazaridis, I.; Rassouli, O.; Gravanis, A.; Liapakis, G. Alanine scanning mutagenesis of the second extracellular loop of type 1 corticotropin-releasing factor receptor revealed residues critical for peptide binding. Mol. Pharmacol. 2009, 75, 793–800. [Google Scholar] [CrossRef] [PubMed]
- Spyridaki, K.; Matsoukas, M.T.; Cordomi, A.; Gkountelias, K.; Papadokostaki, M.; Mavromoustakos, T.; Logothetis, D.E.; Margioris, A.N.; Pardo, L.; Liapakis, G. Structural-Functional Analysis of the Third Transmembrane Domain of the Corticotropin-releasing Factor Type 1 Receptor: Role in Activation and Allosteric Antagonism. J. Biol. Chem. 2014, 289, 18966–18977. [Google Scholar] [CrossRef] [PubMed]
- Hollenstein, K.; Kean, J.; Bortolato, A.; Cheng, R.K.; Dore, A.S.; Jazayeri, A.; Cooke, R.M.; Weir, M.; Marshall, F.H. Structure of class B GPCR corticotropin-releasing factor receptor 1. Nature 2013, 499, 438–443. [Google Scholar] [CrossRef] [PubMed]
- Wootten, D.; Simms, J.; Miller, L.J.; Christopoulos, A.; Sexton, P.M. Polar transmembrane interactions drive formation of ligand-specific and signal pathway-biased family B G protein-coupled receptor conformations. Proc. Natl. Acad. Sci. USA 2013, 110, 5211–5216. [Google Scholar] [CrossRef] [PubMed]
- Liang, Y.L.; Belousoff, M.J.; Zhao, P.; Koole, C.; Fletcher, M.M.; Truong, T.T.; Julita, V.; Christopoulos, G.; Xu, H.E.; Zhang, Y.; et al. Toward a Structural Understanding of Class B GPCR Peptide Binding and Activation. Mol. Cell 2020, 77, 656–668.e655. [Google Scholar] [CrossRef] [PubMed]
- Kraetke, O.; Holeran, B.; Berger, H.; Escher, E.; Bienert, M.; Beyermann, M. Photoaffinity cross-linking of the corticotropin-releasing factor receptor type 1 with photoreactive urocortin analogues. Biochemistry 2005, 44, 15569–15577. [Google Scholar] [CrossRef] [PubMed]
- Dautzenberg, F.M.; Huber, G.; Higelin, J.; Py-Lang, G.; Kilpatrick, G.J. Evidence for the abundant expression of arginine 185 containing human CRF(2α) receptors and the role of position 185 for receptor-ligand selectivity. Neuropharmacology 2000, 39, 1368–1376. [Google Scholar] [CrossRef] [PubMed]
- Sydow, S.; Flaccus, A.; Fischer, A.; Spiess, J. The role of the fourth extracellular domain of the rat corticotropin-releasing factor receptor type 1 in ligand binding. Eur. J. Biochem. 1999, 259, 55–62. [Google Scholar] [CrossRef]
- Coin, I.; Katritch, V.; Sun, T.; Xiang, Z.; Siu, F.Y.; Beyermann, M.; Stevens, R.C.; Wang, L. Genetically encoded chemical probes in cells reveal the binding path of urocortin-I to CRF class B GPCR. Cell 2013, 155, 1258–1269. [Google Scholar] [CrossRef]
- Strader, C.D.; Fong, T.M.; Tota, M.R.; Underwood, D.; Dixon, R.A. Structure and function of G protein-coupled receptors. Annu. Rev. Biochem. 1994, 63, 101–132. [Google Scholar] [CrossRef]
- Savarese, T.M.; Fraser, C.M. In vitro mutagenesis and the search for structure-function relationships among G protein-coupled receptors. Biochem. J. 1992, 283 Pt 1, 1–19. [Google Scholar] [CrossRef]
- Cordomi, A.; Liapakis, G.; Matsoukas, M.T. Understanding Corticotropin Releasing Factor Receptor (CRFR) Activation Using Structural Models. Curr. Mol. Pharmacol. 2017, 10, 325–333. [Google Scholar] [CrossRef]
- Hoare, S.R.; Fleck, B.A.; Gross, R.S.; Crowe, P.D.; Williams, J.P.; Grigoriadis, D.E. Allosteric ligands for the corticotropin releasing factor type 1 receptor modulate conformational states involved in receptor activation. Mol. Pharmacol. 2008, 73, 1371–1380. [Google Scholar] [CrossRef]
- Assil-Kishawi, I.; Abou-Samra, A.B. Sauvagine cross-links to the second extracellular loop of the corticotropin-releasing factor type 1 receptor. J. Biol. Chem. 2002, 277, 32558–32561. [Google Scholar] [CrossRef] [PubMed]
- Hoare, S.R.; Sullivan, S.K.; Schwarz, D.A.; Ling, N.; Vale, W.W.; Crowe, P.D.; Grigoriadis, D.E. Ligand affinity for amino-terminal and juxtamembrane domains of the corticotropin releasing factor type I receptor: Regulation by G-protein and nonpeptide antagonists. Biochemistry 2004, 43, 3996–4011. [Google Scholar] [CrossRef] [PubMed]
- Nielsen, S.M.; Nielsen, L.Z.; Hjorth, S.A.; Perrin, M.H.; Vale, W.W. Constitutive activation of tethered-peptide/corticotropin-releasing factor receptor chimeras. Proc. Natl. Acad. Sci. USA 2000, 97, 10277–10281. [Google Scholar] [CrossRef]
- Zhao, L.-H.; Lin, J.; Ji, S.-Y.; Zhou, X.E.; Mao, C.; Shen, D.-D.; He, X.; Xiao, P.; Sun, J.; Melcher, K.; et al. Structure insights into selective coupling of G protein subtypes by a class B G protein-coupled receptor. Nat. Commun. 2022, 13, 6670. [Google Scholar] [CrossRef] [PubMed]
- Liaw, C.W.; Grigoriadis, D.E.; Lorang, M.T.; De Souza, E.B.; Maki, R.A. Localization of agonist- and antagonist-binding domains of human corticotropin-releasing factor receptors. Mol. Endocrinol. 1997, 11, 2048–2053. [Google Scholar] [CrossRef] [PubMed]
- Cunningham, B.C.; Wells, J.A. High-resolution epitope mapping of hGH-receptor interactions by alanine-scanning mutagenesis. Science 1989, 244, 1081–1085. [Google Scholar] [CrossRef] [PubMed]
- Jahn, O.; Tezval, H.; van Werven, L.; Eckart, K.; Spiess, J. Three-amino acid motifs of urocortin II and III determine their CRF receptor subtype selectivity. Neuropharmacology 2004, 47, 233–242. [Google Scholar] [CrossRef]
- Isfort, R.J.; Wang, F.; Tscheiner, M.; Donnelly, E.; Bauer, M.B.; Lefever, F.; Hinkle, R.T.; Mazur, A.W. Discovery of corticotropin releasing factor 2 receptor selective sauvagine analogues for treatment of skeletal muscle atrophy. J. Med. Chem. 2005, 48, 262–265. [Google Scholar] [CrossRef] [PubMed]
- Mazur, A.W.; Wang, F.; Tscheiner, M.; Donnelly, E.; Isfort, R.J. Determinants of corticotropin releasing factor. Receptor selectivity of corticotropin releasing factor related peptides. J. Med. Chem. 2004, 47, 3450–3454. [Google Scholar] [CrossRef] [PubMed]
- Pal, K.; Swaminathan, K.; Xu, H.E.; Pioszak, A.A. Structural basis for hormone recognition by the Human CRFR2{α} G protein-coupled receptor. J. Biol. Chem. 2010, 285, 40351–40361. [Google Scholar] [CrossRef] [PubMed]
- Rivier, J.; Gulyas, J.; Kirby, D.; Low, W.; Perrin, M.H.; Kunitake, K.; DiGruccio, M.; Vaughan, J.; Reubi, J.C.; Waser, B.; et al. Potent and long-acting corticotropin releasing factor (CRF) receptor 2 selective peptide competitive antagonists. J. Med. Chem. 2002, 45, 4737–4747. [Google Scholar] [CrossRef]
- Gulyas, J.; Rivier, C.; Perrin, M.; Koerber, S.C.; Sutton, S.; Corrigan, A.; Lahrichi, S.L.; Craig, A.G.; Vale, W.; Rivier, J. Potent, structurally constrained agonists and competitive antagonists of corticotropin-releasing factor. Proc. Natl. Acad. Sci. USA 1995, 92, 10575–10579. [Google Scholar] [CrossRef]
- Rivier, J.; Gulyas, J.; Kunitake, K.; DiGruccio, M.; Cantle, J.P.; Perrin, M.H.; Donaldson, C.; Vaughan, J.; Million, M.; Gourcerol, G.; et al. Stressin1-A, a potent corticotropin releasing factor receptor 1 (CRF1)-selective peptide agonist. J. Med. Chem. 2007, 50, 1668–1674. [Google Scholar] [CrossRef]








| Peptide | Amino Acid Sequence | Ki (nM) | % h/rCRF Identity | |||
|---|---|---|---|---|---|---|
| CRF1R CRF2R | ||||||
| h/rCRF 1 | Agonist | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII | 1.9 b | 31 a | 100 | |
| oCRF | Agonist-CRF1R | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA | 1.2 b 1.1.2 b | 185 a | 82.9 | |
| UI | Agonist | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV | 0.4 b | 2.2 a | 53.7 | |
| SVG | Agonist | ZGPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI | 0.7 b | 4.3 a | 45.0 | |
| α-helCRF 2 | Antagonist | DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA | 23.7 b | 96 a | 67.9 | |
| Astressin | Antagonist | HLLREVLEBARAEQLAQEAHKNRKLBEII | 15.4 b | 1.5 b | 86.2 | |
| rUcnI 1 | Agonist | DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV | 0.3 b | 0.3 b | 45.0 | |
| hUcnI 1 | Agonist | DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV | 0.4 b | 0.3 b | 42.5 | |
| hUcnII 1 | Agonist-CRF2R | IVLSLDVPIGLLQILLEQARARAAREQATTNARILARV | >100 c | 1.7 c | 34.2 | |
| mUcnII 1 | Agonist-CRF2R | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV | >100 c | 2.1 c | 34.2 | |
| hUcnII I 1 | Agonist-CRF2R | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI | >100 c | 22 c | 31.6 | |
| mUcnIII 1 | Agonist-CRF2R | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI | >100 c | 5 c | 26.3 | |
| Ligand | EC50 (nM) |
|---|---|
| Chimeric Peptides | |
| N-region-E K E E K E K K R K E-C-region | 0.6 |
| N-region-E K E K E K K R K E-C-region | 25 |
| N-region-E K K E K K R K E-C-region | 8.5 |
| N-region-E K E K K R K E-C-region | 0.9 |
| N-region-E K K K R K E-C-region | 12 |
| N-region-E K K R K E-C-region | 50 |
| N-region-E K R K E-C-region | 30 |
| N-region-E K K E-C-region | 4.6 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Matsoukas, M.-T.; Panagiotopoulos, V.; Karageorgos, V.; Chrousos, G.P.; Venihaki, M.; Liapakis, G. Structural and Functional Insights into CRF Peptides and Their Receptors. Biology 2024, 13, 120. https://doi.org/10.3390/biology13020120
Matsoukas M-T, Panagiotopoulos V, Karageorgos V, Chrousos GP, Venihaki M, Liapakis G. Structural and Functional Insights into CRF Peptides and Their Receptors. Biology. 2024; 13(2):120. https://doi.org/10.3390/biology13020120
Chicago/Turabian StyleMatsoukas, Minos-Timotheos, Vasilis Panagiotopoulos, Vlasios Karageorgos, George P. Chrousos, Maria Venihaki, and George Liapakis. 2024. "Structural and Functional Insights into CRF Peptides and Their Receptors" Biology 13, no. 2: 120. https://doi.org/10.3390/biology13020120
APA StyleMatsoukas, M.-T., Panagiotopoulos, V., Karageorgos, V., Chrousos, G. P., Venihaki, M., & Liapakis, G. (2024). Structural and Functional Insights into CRF Peptides and Their Receptors. Biology, 13(2), 120. https://doi.org/10.3390/biology13020120

