Structural and Functional Insights into CRF Peptides and Their Receptors
Abstract
:Simple Summary
Abstract
1. Introduction
2. Pharmacological Properties of CRF Ligands and Their Receptors and Historical Overview
3. Structural Features of CRF Family Peptides
3.1. Peptide CRF Analogs
3.1.1. The N-Segment
3.1.2. The C-Segment
3.1.3. The I-Segment
3.2. Non-Peptide CRF Analogs
4. Receptors
4.1. The ECD
4.2. The J-Domain
5. The Two-Step Model of Ligand–Receptor Interaction
6. Structural Basis of Receptor Activation
7. Molecular Mechanisms of Ligand Selectivity
7.1. Selectivity of Non-Peptide Antagonists
7.2. Selectivity of Peptide Agonists
8. Concluding Remarks
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Liapakis, G.; Venihaki, M.; Margioris, A.; Grigoriadis, D.; Gkountelias, K. Members of CRF family and their receptors: From past to future. Curr. Med. Chem. 2011, 18, 2583–2600. [Google Scholar] [CrossRef] [PubMed]
- Vaughan, J.; Donaldson, C.; Bittencourt, J.; Perrin, M.H.; Lewis, K.; Sutton, S.; Chan, R.; Turnbull, A.V.; Lovejoy, D.; Rivier, C.; et al. Urocortin, a mammalian neuropeptide related to fish urotensin I and to corticotropin-releasing factor. Nature 1995, 378, 287–292. [Google Scholar] [CrossRef] [PubMed]
- Montecucchi, P.C.; Henschen, A. Amino acid composition and sequence analysis of sauvagine, a new active peptide from the skin of Phyllomedusa sauvagei. Int. J. Pept. Protein Res. 1981, 18, 113–120. [Google Scholar] [CrossRef] [PubMed]
- Lederis, K.; Letter, A.; McMaster, D.; Moore, G.; Schlesinger, D. Complete amino acid sequence of urotensin I, a hypotensive and corticotropin-releasing neuropeptide from Catostomus. Science 1982, 218, 162–165. [Google Scholar] [CrossRef] [PubMed]
- Reyes, T.M.; Lewis, K.; Perrin, M.H.; Kunitake, K.S.; Vaughan, J.; Arias, C.A.; Hogenesch, J.B.; Gulyas, J.; Rivier, J.; Vale, W.W.; et al. Urocortin II: A member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc. Natl. Acad. Sci. USA 2001, 98, 2843–2848. [Google Scholar] [CrossRef] [PubMed]
- Hsu, S.Y.; Hsueh, A.J. Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor. Nat. Med. 2001, 7, 605–611. [Google Scholar] [CrossRef]
- Lewis, K.; Li, C.; Perrin, M.H.; Blount, A.; Kunitake, K.; Donaldson, C.; Vaughan, J.; Reyes, T.M.; Gulyas, J.; Fischer, W.; et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc. Natl. Acad. Sci. USA 2001, 98, 7570–7575. [Google Scholar] [CrossRef]
- Potter, E.; Behan, D.P.; Fischer, W.H.; Linton, E.A.; Lowry, P.J.; Vale, W.W. Cloning and characterization of the cDNAs for human and rat corticotropin releasing factor-binding proteins. Nature 1991, 349, 423–426. [Google Scholar] [CrossRef]
- Behan, D.P.; Khongsaly, O.; Ling, N.; De Souza, E.B. Urocortin interaction with corticotropin-releasing factor (CRF) binding protein (CRF-BP): A novel mechanism for elevating ‘free’ CRF levels in human brain. Brain Res. 1996, 725, 263–267. [Google Scholar]
- Vale, W.; Spiess, J.; Rivier, C.; Rivier, J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and β-endorphin. Science 1981, 213, 1394–1397. [Google Scholar] [CrossRef]
- Chrousos, G.P. The hypothalamic-pituitary-adrenal axis and immune-mediated inflammation. N. Engl. J. Med. 1995, 332, 1351–1362. [Google Scholar] [CrossRef]
- Owens, M.J.; Nemeroff, C.B. Physiology and pharmacology of corticotropin-releasing factor. Pharmacol. Rev. 1991, 43, 425–473. [Google Scholar]
- Gold, P.W.; Chrousos, G.P. Organization of the stress system and its dysregulation in melancholic and atypical depression: High vs. low CRH/NE states. Mol. Psychiatry 2002, 7, 254–275. [Google Scholar] [CrossRef]
- Keck, M.E.; Holsboer, F. Hyperactivity of CRH neuronal circuits as a target for therapeutic interventions in affective disorders. Peptides 2001, 22, 835–844. [Google Scholar] [CrossRef]
- Reul, J.M.; Holsboer, F. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr. Opin. Pharmacol. 2002, 2, 23–33. [Google Scholar] [CrossRef]
- Dautzenberg, F.M.; Kilpatrick, G.J.; Hauger, R.L.; Moreau, J. Molecular biology of the CRH receptors—In the mood. Peptides 2001, 22, 753–760. [Google Scholar] [CrossRef] [PubMed]
- Behan, D.P.; Heinrichs, S.C.; Troncoso, J.C.; Liu, X.J.; Kawas, C.H.; Ling, N.; De Souza, E.B. Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer’s disease. Nature 1995, 378, 284–287. [Google Scholar] [CrossRef] [PubMed]
- De Souza, E.B.; Whitehouse, P.J.; Kuhar, M.J.; Price, D.L.; Vale, W.W. Reciprocal changes in corticotropin-releasing factor (CRF)-like immunoreactivity and CRF receptors in cerebral cortex of Alzheimer’s disease. Nature 1986, 319, 593–595. [Google Scholar] [CrossRef] [PubMed]
- Makrigiannakis, A.; Zoumakis, E.; Kalantaridou, S.; Coutifaris, C.; Margioris, A.N.; Coukos, G.; Rice, K.C.; Gravanis, A.; Chrousos, G.P. Corticotropin-releasing hormone promotes blastocyst implantation and early maternal tolerance. Nat. Immunol. 2001, 2, 1018–1024. [Google Scholar] [CrossRef] [PubMed]
- Chrousos, G.P.; Torpy, D.J.; Gold, P.W. Interactions between the hypothalamic-pituitary-adrenal axis and the female reproductive system: Clinical implications. Ann. Intern. Med. 1998, 129, 229–240. [Google Scholar] [CrossRef] [PubMed]
- Martinez, V.; Rivier, J.; Wang, L.; Tache, Y. Central injection of a new corticotropin-releasing factor (CRF) antagonist, astressin, blocks CRF- and stress-related alterations of gastric and colonic motor function. J. Pharmacol. Exp. Ther. 1997, 280, 754–760. [Google Scholar] [PubMed]
- Orth, D.N. Corticotropin-releasing hormone in humans. Endocr. Rev. 1992, 13, 164–191. [Google Scholar] [PubMed]
- Parkes, D.G.; Weisinger, R.S.; May, C.N. Cardiovascular actions of CRH and urocortin: An update. Peptides 2001, 22, 821–827. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Dikkes, P.; Carrigan, A.; Karalis, K.P. Corticotropin-releasing hormone regulates IL-6 expression during inflammation. J. Clin. Investig. 2001, 108, 1159–1166. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Majzoub, J.A. Animal models of CRH deficiency. Front. Neuroendocrinol. 1999, 20, 122–145. [Google Scholar] [CrossRef] [PubMed]
- Wang, L.; Martinez, V.; Rivier, J.E.; Tache, Y. Peripheral urocortin inhibits gastric emptying and food intake in mice: Differential role of CRF receptor 2. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2001, 281, R1401–R1410. [Google Scholar] [CrossRef]
- Martinez, V.; Wang, L.; Rivier, J.E.; Vale, W.; Tache, Y. Differential actions of peripheral corticotropin-releasing factor (CRF), urocortin II, and urocortin III on gastric emptying and colonic transit in mice: Role of CRF receptor subtypes 1 and 2. J. Pharmacol. Exp. Ther. 2002, 301, 611–617. [Google Scholar] [CrossRef]
- Coste, S.C.; Kesterson, R.A.; Heldwein, K.A.; Stevens, S.L.; Heard, A.D.; Hollis, J.H.; Murray, S.E.; Hill, J.K.; Pantely, G.A.; Hohimer, A.R.; et al. Abnormal adaptations to stress and impaired cardiovascular function in mice lacking corticotropin-releasing hormone receptor-2. Nat. Genet. 2000, 24, 403–409. [Google Scholar] [CrossRef]
- Coste, S.C.; Quintos, R.F.; Stenzel-Poore, M.P. Corticotropin-releasing hormone-related peptides and receptors: Emergent regulators of cardiovascular adaptations to stress. Trends Cardiovasc. Med. 2002, 12, 176–182. [Google Scholar] [CrossRef]
- Karalis, K.; Sano, H.; Redwine, J.; Listwak, S.; Wilder, R.L.; Chrousos, G.P. Autocrine or paracrine inflammatory actions of corticotropin-releasing hormone in vivo. Science 1991, 254, 421–423. [Google Scholar] [CrossRef]
- Koob, G.F.; Bloom, F.E. Corticotropin-releasing factor and behavior. Fed. Proc. 1985, 44, 259–263. [Google Scholar]
- Kempuraj, D.; Papadopoulou, N.G.; Lytinas, M.; Huang, M.; Kandere-Grzybowska, K.; Madhappan, B.; Boucher, W.; Christodoulou, S.; Athanassiou, A.; Theoharides, T.C. Corticotropin-releasing hormone and its structurally related urocortin are synthesized and secreted by human mast cells. Endocrinology 2004, 145, 43–48. [Google Scholar] [CrossRef]
- Dedic, N.; Chen, A.; Deussing, J.M. The CRF Family of Neuropeptides and their Receptors—Mediators of the Central Stress Response. Curr. Mol. Pharmacol. 2018, 11, 4–31. [Google Scholar] [CrossRef]
- Sanders, J.; Nemeroff, C. The CRF System as a Therapeutic Target for Neuropsychiatric Disorders. Trends Pharmacol. Sci. 2016, 37, 1045–1054. [Google Scholar] [CrossRef] [PubMed]
- Makrigiannakis, A.; Vrekoussis, T.; Zoumakis, E.; Navrozoglou, I.; Kalantaridou, S.N. CRH Receptors in Human Reproduction. Curr. Mol. Pharmacol. 2018, 11, 81–87. [Google Scholar] [CrossRef] [PubMed]
- Basman, C.; Agrawal, P.; Knight, R.; Saravolatz, L.; McRee, C.; Chen-Scarabelli, C.; Narula, J.; Scarabelli, T. Cardioprotective Utility of Urocortin in Myocardial Ischemia- Reperfusion Injury: Where do We Stand? Curr. Mol. Pharmacol. 2018, 11, 32–38. [Google Scholar] [CrossRef] [PubMed]
- Pagan-Busigo, J.E.; Lopez-Carrasquillo, J.; Appleyard, C.B.; Torres-Reveron, A. Beyond depression and anxiety; a systematic review about the role of corticotropin-releasing hormone antagonists in diseases of the pelvic and abdominal organs. PLoS ONE 2022, 17, e0264909. [Google Scholar] [CrossRef]
- Arborelius, L.; Owens, M.J.; Plotsky, P.M.; Nemeroff, C.B. The role of corticotropin-releasing factor in depression and anxiety disorders. J. Endocrinol. 1999, 160, 1–12. [Google Scholar] [CrossRef]
- Muller, M.B.; Zimmermann, S.; Sillaber, I.; Hagemeyer, T.P.; Deussing, J.M.; Timpl, P.; Kormann, M.S.; Droste, S.K.; Kuhn, R.; Reul, J.M.; et al. Limbic corticotropin-releasing hormone receptor 1 mediates anxiety-related behavior and hormonal adaptation to stress. Nat. Neurosci. 2003, 6, 1100–1107. [Google Scholar] [CrossRef] [PubMed]
- Timpl, P.; Spanagel, R.; Sillaber, I.; Kresse, A.; Reul, J.M.; Stalla, G.K.; Blanquet, V.; Steckler, T.; Holsboer, F.; Wurst, W. Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1. Nat. Genet. 1998, 19, 162–166. [Google Scholar] [CrossRef] [PubMed]
- Zobel, A.W.; Nickel, T.; Kunzel, H.E.; Ackl, N.; Sonntag, A.; Ising, M.; Holsboer, F. Effects of the high-affinity corticotropin-releasing hormone receptor 1 antagonist R121919 in major depression: The first 20 patients treated. J. Psychiatr. Res. 2000, 34, 171–181. [Google Scholar] [CrossRef]
- Ising, M.; Zimmermann, U.S.; Kunzel, H.E.; Uhr, M.; Foster, A.C.; Learned-Coughlin, S.M.; Holsboer, F.; Grigoriadis, D.E. High-affinity CRF1 receptor antagonist NBI-34041: Preclinical and clinical data suggest safety and efficacy in attenuating elevated stress response. Neuropsychopharmacology 2007, 32, 1941–1949. [Google Scholar] [CrossRef]
- Zorrilla, E.P.; Koob, G.F. Progress in corticotropin-releasing factor-1 antagonist development. Drug Discov. Today 2010, 15, 371–383. [Google Scholar] [CrossRef]
- Valdez, G.R.; Inoue, K.; Koob, G.F.; Rivier, J.; Vale, W.; Zorrilla, E.P. Human urocortin II: Mild locomotor suppressive and delayed anxiolytic-like effects of a novel corticotropin-releasing factor related peptide. Brain Res. 2002, 943, 142–150. [Google Scholar] [CrossRef] [PubMed]
- Valdez, G.R.; Zorrilla, E.P.; Rivier, J.; Vale, W.W.; Koob, G.F. Locomotor suppressive and anxiolytic-like effects of urocortin 3, a highly selective type 2 corticotropin-releasing factor agonist. Brain Res. 2003, 980, 206–212. [Google Scholar] [CrossRef] [PubMed]
- Venihaki, M.; Sakihara, S.; Subramanian, S.; Dikkes, P.; Weninger, S.C.; Liapakis, G.; Graf, T.; Majzoub, J.A. Urocortin III, A Novel Murine Brain Neuropeptide of the Corticotropin-Releasing Hormone Family: Modulation by Stress and Attenuation of Some Anxiety-Like Behaviors. J. Neuroendocrinol. 2004, 16, 411–422. [Google Scholar] [CrossRef] [PubMed]
- Venkatasubramanian, S.; Griffiths, M.E.; McLean, S.G.; Miller, M.R.; Luo, R.; Lang, N.N.; Newby, D.E. Vascular effects of urocortins 2 and 3 in healthy volunteers. J. Am. Heart Assoc. 2013, 2, e004267. [Google Scholar] [CrossRef] [PubMed]
- Bale, T.L.; Hoshijima, M.; Gu, Y.; Dalton, N.; Anderson, K.R.; Lee, K.F.; Rivier, J.; Chien, K.R.; Vale, W.W.; Peterson, K.L. The cardiovascular physiologic actions of urocortin II: Acute effects in murine heart failure. Proc. Natl. Acad. Sci. USA 2004, 101, 3697–3702. [Google Scholar] [CrossRef] [PubMed]
- Tache, Y.; Larauche, M.; Yuan, P.Q.; Million, M. Brain and Gut CRF Signaling: Biological Actions and Role in the Gastrointestinal Tract. Curr. Mol. Pharmacol. 2018, 11, 51–71. [Google Scholar] [CrossRef]
- Rivier, J.E. Prospective Clinical Applications of CRF Peptide Antagonists. Curr. Mol. Pharmacol. 2017, 10, 264–269. [Google Scholar] [CrossRef]
- Torres-Reverón, A.; Rivera-Lopez, L.L.; Flores, I.; Appleyard, C.B. Antagonizing the corticotropin releasing hormone receptor 1 with antalarmin reduces the progression of endometriosis. PLoS ONE 2018, 13, e0197698. [Google Scholar] [CrossRef] [PubMed]
- Sarafoglou, K.; Barnes, C.N.; Huang, M.; Imel, E.A.; Madu, I.J.; Merke, D.P.; Moriarty, D.; Nakhle, S.; Newfield, R.S.; Vogiatzi, M.G.; et al. Tildacerfont in Adults with Classic Congenital Adrenal Hyperplasia: Results from Two Phase 2 Studies. J. Clin. Endocrinol. Metab. 2021, 106, e4666–e4679. [Google Scholar] [CrossRef]
- Harmar, A.J. Family-B G-protein-coupled receptors. Genome. Biol. 2001, 2, REVIEWS3013. [Google Scholar] [CrossRef]
- Gkountelias, K.; Papadokostaki, M.; Javitch, J.A.; Liapakis, G. Exploring the binding site crevice of a family B G protein-coupled receptor, the type 1 corticotropin releasing factor receptor. Mol. Pharmacol. 2010, 78, 785–793. [Google Scholar] [CrossRef]
- Hillhouse, E.W.; Grammatopoulos, D.K. The molecular mechanisms underlying the regulation of the biological activity of corticotropin-releasing hormone receptors: Implications for physiology and pathophysiology. Endocr. Rev. 2006, 27, 260–286. [Google Scholar] [CrossRef]
- Grammatopoulos, D.K.; Ourailidou, S. CRH Receptor Signalling: Potential Roles in Pathophysiology. Curr. Mol. Pharmacol. 2017, 10, 296–310. [Google Scholar] [CrossRef] [PubMed]
- Cong, Z.; Liang, Y.-L.; Zhou, Q.; Darbalaei, S.; Zhao, F.; Feng, W.; Zhao, L.; Xu, H.E.; Yang, D.; Wang, M.-W. Structural perspective of class B1 GPCR signaling. Trends Pharmacol. Sci. 2022, 43, 321–334. [Google Scholar] [CrossRef] [PubMed]
- Bockaert, J.; Pin, J.P. Molecular tinkering of G protein-coupled receptors: An evolutionary success. EMBO J. 1999, 18, 1723–1729. [Google Scholar] [CrossRef]
- Islam, M.R.; Teleb, M.; Karageorgos, V.; Sakellaris, S.; Papadopoulos, M.; Pirmettis, I.; Fronczek, F.R.; Liapakis, G.; Fahmy, H. Design, synthesis, structural optimization, SAR, in silico prediction of physicochemical properties and pharmacological evaluation of novel & potent thiazolo[4,5-d]pyrimidine corticotropin releasing factor (CRF) receptor antagonists. Eur. J. Pharm. Sci. 2022, 169, 106084. [Google Scholar] [CrossRef]
- Grigoriadis, D.E.; Liu, X.J.; Vaughn, J.; Palmer, S.F.; True, C.D.; Vale, W.W.; Ling, N.; De Souza, E.B. 125I-Tyro-sauvagine: A novel high affinity radioligand for the pharmacological and biochemical study of human corticotropin-releasing factor 2 α receptors. Mol. Pharmacol. 1996, 50, 679–686. [Google Scholar]
- Dautzenberg, F.M.; Py-Lang, G.; Higelin, J.; Fischer, C.; Wright, M.B.; Huber, G. Different binding modes of amphibian and human corticotropin-releasing factor type 1 and type 2 receptors: Evidence for evolutionary differences. J. Pharmacol. Exp. Ther. 2001, 296, 113–120. [Google Scholar]
- Rivier, J.; Spiess, J.; Vale, W. Characterization of rat hypothalamic corticotropin-releasing factor. Proc. Natl. Acad. Sci. USA 1983, 80, 4851–4855. [Google Scholar] [CrossRef]
- Shibahara, S.; Morimoto, Y.; Furutani, Y.; Notake, M.; Takahashi, H.; Shimizu, S.; Horikawa, S.; Numa, S. Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene. EMBO J 1983, 2, 775–779. [Google Scholar] [CrossRef]
- Patthy, M.; Horvath, J.; Mason-Garcia, M.; Szoke, B.; Schlesinger, D.H.; Schally, A.V. Isolation and amino acid sequence of corticotropin-releasing factor from pig hypothalami. Proc. Natl. Acad. Sci. USA 1985, 82, 8762–8766. [Google Scholar] [CrossRef]
- Okawara, Y.; Morley, S.D.; Burzio, L.O.; Zwiers, H.; Lederis, K.; Richter, D. Cloning and sequence analysis of cDNA for corticotropin-releasing factor precursor from the teleost fish Catostomus commersoni. Proc. Natl. Acad. Sci. USA 1988, 85, 8439–8443. [Google Scholar] [CrossRef] [PubMed]
- Stenzel-Poore, M.P.; Heldwein, K.A.; Stenzel, P.; Lee, S.; Vale, W.W. Characterization of the genomic corticotropin-releasing factor (CRF) gene from Xenopus laevis: Two members of the CRF family exist in amphibians. Mol. Endocrinol. 1992, 6, 1716–1724. [Google Scholar]
- Donaldson, C.J.; Sutton, S.W.; Perrin, M.H.; Corrigan, A.Z.; Lewis, K.A.; Rivier, J.E.; Vaughan, J.M.; Vale, W.W. Cloning and characterization of human urocortin. Endocrinology 1996, 137, 2167–2170, Erratum in Endocrinoogy 1996, 137, 3896. [Google Scholar] [CrossRef] [PubMed]
- Grace, C.R.; Perrin, M.H.; Cantle, J.P.; Vale, W.W.; Rivier, J.E.; Riek, R. Common and divergent structural features of a series of corticotropin releasing factor-related peptides. J. Am. Chem. Soc. 2007, 129, 16102–16114. [Google Scholar] [CrossRef] [PubMed]
- Ohta, N.; Mochizuki, T.; Hoshino, M.; Jun, L.; Kobayashi, H.; Yanaihara, N. Adrenocorticotropic hormone-releasing activity of urotensin I and its fragments in vitro. J. Pept. Res. 1997, 50, 178–183. [Google Scholar] [CrossRef] [PubMed]
- Rivier, J.; Rivier, C.; Vale, W. Synthetic competitive antagonists of corticotropin-releasing factor: Effect on ACTH secretion in the rat. Science 1984, 224, 889–891. [Google Scholar] [CrossRef]
- Kornreich, W.D.; Galyean, R.; Hernandez, J.F.; Craig, A.G.; Donaldson, C.J.; Yamamoto, G.; Rivier, C.; Vale, W.; Rivier, J. Alanine series of ovine corticotropin releasing factor (oCRF): A structure-activity relationship study. J. Med. Chem. 1992, 35, 1870–1876. [Google Scholar] [CrossRef]
- Mesleh, M.F.; Shirley, W.A.; Heise, C.E.; Ling, N.; Maki, R.A.; Laura, R.P. NMR structural characterization of a minimal peptide antagonist bound to the extracellular domain of the corticotropin-releasing factor1 receptor. J. Biol. Chem. 2007, 282, 6338–6346. [Google Scholar] [CrossRef] [PubMed]
- Rijkers, D.T.; Kruijtzer, J.A.; van Oostenbrugge, M.; Ronken, E.; den Hartog, J.A.; Liskamp, R.M. Structure-activity studies on the corticotropin releasing factor antagonist astressin, leading to a minimal sequence necessary for antagonistic activity. Chembiochem 2004, 5, 340–348. [Google Scholar] [CrossRef] [PubMed]
- Pioszak, A.A.; Parker, N.R.; Suino-Powell, K.; Xu, H.E. Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1. J. Biol. Chem. 2008, 283, 32900–32912. [Google Scholar] [CrossRef]
- Weiss, G.A.; Watanabe, C.K.; Zhong, A.; Goddard, A.; Sidhu, S.S. Rapid mapping of protein functional epitopes by combinatorial alanine scanning. Proc. Natl. Acad. Sci. USA 2000, 97, 8950–8954. [Google Scholar] [CrossRef]
- Yamada, Y.; Mizutani, K.; Mizusawa, Y.; Hantani, Y.; Tanaka, M.; Tanaka, Y.; Tomimoto, M.; Sugawara, M.; Imai, N.; Yamada, H.; et al. New class of corticotropin-releasing factor (CRF) antagonists: Small peptides having high binding affinity for CRF receptor. J. Med. Chem. 2004, 47, 1075–1078. [Google Scholar] [CrossRef]
- Beyermann, M.; Rothemund, S.; Heinrich, N.; Fechner, K.; Furkert, J.; Dathe, M.; Winter, R.; Krause, E.; Bienert, M. A role for a helical connector between two receptor binding sites of a long-chain peptide hormone. J. Biol. Chem. 2000, 275, 5702–5709. [Google Scholar] [CrossRef]
- Pallai, P.V.; Mabilia, M.; Goodman, M.; Vale, W.; Rivier, J. Structural homology of corticotropin-releasing factor, sauvagine, and urotensin I: Circular dichroism and prediction studies. Proc. Natl. Acad. Sci. USA 1983, 80, 6770–6774. [Google Scholar] [CrossRef] [PubMed]
- Dathe, M.; Fabian, H.; Gast, K.; Zirwer, D.; Winter, R.; Beyermann, M.; Schumann, M.; Bienert, M. Conformational differences of ovine and human corticotropin releasing hormone. A CD, IR, NMR and dynamic light scattering study. Int. J. Pept. Protein Res. 1996, 47, 383–393. [Google Scholar] [CrossRef]
- Heinrich, N.; Meyer, M.R.; Furkert, J.; Sasse, A.; Beyermann, M.; Bonigk, W.; Berger, H. Corticotropin-releasing factor (CRF) agonists stimulate testosterone production in mouse leydig cells through CRF receptor-1. Endocrinology 1998, 139, 651–658. [Google Scholar] [CrossRef]
- Rivier, J.; Rivier, C.; Galyean, R.; Miranda, A.; Miller, C.; Craig, A.G.; Yamamoto, G.; Brown, M.; Vale, W. Single point D-substituted corticotropin-releasing factor analogues: Effects on potency and physicochemical characteristics. J. Med. Chem. 1993, 36, 2851–2859. [Google Scholar] [CrossRef]
- Rothemund, S.; Krause, E.; Beyermann, M.; Dathe, M.; Bienert, M.; Hodges, R.S.; Sykes, B.D.; Sonnichsen, F.D. Peptide destabilization by two adjacent D-amino acids in single-stranded amphipathic α-helices. Pept. Res. 1996, 9, 79–87. [Google Scholar]
- Eckart, K.; Jahn, O.; Radulovic, J.; Tezval, H.; Werven, L.; Spiess, J. A single amino acid serves as an affinity switch between the receptor and the binding protein of corticotropin-releasing factor: Implications for the design of agonists and antagonists. Proc. Natl. Acad. Sci. USA 2001, 98, 11142–11147. [Google Scholar] [CrossRef]
- Gilligan, P.J.; Robertson, D.W.; Zaczek, R. Corticotropin releasing factor (CRF) receptor modulators: Progress and opportunities for new therapeutic agents. J. Med. Chem. 2000, 43, 1641–1660. [Google Scholar] [CrossRef] [PubMed]
- Grigoriadis, D.E.; Haddach, M.; Ling, N.; Saunders, J. The CRF Receptor: Structure, Function and Potential for Therapeutic Intervention. Curr. Med. Chem. Cent. Nerv. Syst. Agents 2001, 1, 63–97. [Google Scholar] [CrossRef]
- Chen, Y.L.; Braselton, J.; Forman, J.; Gallaschun, R.J.; Mansbach, R.; Schmidt, A.W.; Seeger, T.F.; Sprouse, J.S.; Tingley, F.D., 3rd; Winston, E.; et al. Synthesis and SAR of 2-aryloxy-4-alkoxy-pyridines as potent orally active corticotropin-releasing factor 1 receptor antagonists. J. Med. Chem. 2008, 51, 1377–1384. [Google Scholar] [CrossRef]
- Million, M.; Zhao, J.-F.; Luckey, A.; Czimmer, J.; Maynard, G.D.; Kehne, J.; Hoffman, D.C.; Taché, Y. The Newly Developed CRF1-Receptor Antagonists, NGD 98-2 and NGD 9002, Suppress Acute Stress-Induced Stimulation of Colonic Motor Function and Visceral Hypersensitivity in Rats. PLoS ONE 2013, 8, e73749. [Google Scholar] [CrossRef]
- Molteni, V.; Penzotti, J.; Wilson, D.M.; Termin, A.P.; Mao, L.; Crane, C.M.; Hassman, F.; Wang, T.; Wong, H.; Miller, K.J.; et al. N-phenylphenylglycines as novel corticotropin releasing factor receptor antagonists. J. Med. Chem. 2004, 47, 2426–2429. [Google Scholar] [CrossRef] [PubMed]
- Williams, J.P. Corticotropin-releasing factor 1 receptor antagonists: A patent review. Expert Opin. Ther. Pat. 2013, 23, 1057–1068. [Google Scholar] [CrossRef] [PubMed]
- Perrin, M.H.; Sutton, S.; Bain, D.L.; Berggren, W.T.; Vale, W.W. The first extracellular domain of corticotropin releasing factor-R1 contains major binding determinants for urocortin and astressin. Endocrinology 1998, 139, 566–570. [Google Scholar] [CrossRef] [PubMed]
- Perrin, M.H.; Fischer, W.H.; Kunitake, K.S.; Craig, A.G.; Koerber, S.C.; Cervini, L.A.; Rivier, J.E.; Groppe, J.C.; Greenwald, J.; Moller Nielsen, S.; et al. Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor. J. Biol. Chem. 2001, 276, 31528–31534. [Google Scholar] [CrossRef]
- Perrin, M.H.; DiGruccio, M.R.; Koerber, S.C.; Rivier, J.E.; Kunitake, K.S.; Bain, D.L.; Fischer, W.H.; Vale, W.W. A soluble form of the first extracellular domain of mouse type 2β corticotropin-releasing factor receptor reveals differential ligand specificity. J. Biol. Chem. 2003, 278, 15595–15600. [Google Scholar] [CrossRef]
- Klose, J.; Fechner, K.; Beyermann, M.; Krause, E.; Wendt, N.; Bienert, M.; Rudolph, R.; Rothemund, S. Impact of N-terminal domains for corticotropin-releasing factor (CRF) receptor-ligand interactions. Biochemistry 2005, 44, 1614–1623. [Google Scholar] [CrossRef] [PubMed]
- Grace, C.R.; Perrin, M.H.; Gulyas, J.; Digruccio, M.R.; Cantle, J.P.; Rivier, J.E.; Vale, W.W.; Riek, R. Structure of the N-terminal domain of a type B1 G protein-coupled receptor in complex with a peptide ligand. Proc. Natl. Acad. Sci. USA 2007, 104, 4858–4863. [Google Scholar] [CrossRef] [PubMed]
- Hofmann, B.A.; Sydow, S.; Jahn, O.; van Werven, L.; Liepold, T.; Eckart, K.; Spiess, J. Functional and protein chemical characterization of the N-terminal domain of the rat corticotropin-releasing factor receptor 1. Protein Sci. 2001, 10, 2050–2062. [Google Scholar] [CrossRef]
- Grace, C.R.; Perrin, M.H.; DiGruccio, M.R.; Miller, C.L.; Rivier, J.E.; Vale, W.W.; Riek, R. NMR structure and peptide hormone binding site of the first extracellular domain of a type B1 G protein-coupled receptor. Proc. Natl. Acad. Sci. USA 2004, 101, 12836–12841. [Google Scholar] [CrossRef] [PubMed]
- Qi, L.J.; Leung, A.T.; Xiong, Y.; Marx, K.A.; Abou-Samra, A.B. Extracellular cysteines of the corticotropin-releasing factor receptor are critical for ligand interaction. Biochemistry 1997, 36, 12442–12448. [Google Scholar]
- Dore, A.S.; Bortolato, A.; Hollenstein, K.; Cheng, R.K.Y.; Read, R.J.; Marshall, F.H. Decoding Corticotropin-Releasing Factor Receptor Type 1 Crystal Structures. Curr. Mol. Pharmacol. 2017, 10, 334–344. [Google Scholar] [CrossRef]
- Koth, C.M.; Murray, J.M.; Mukund, S.; Madjidi, A.; Minn, A.; Clarke, H.J.; Wong, T.; Chiang, V.; Luis, E.; Estevez, A.; et al. Molecular basis for negative regulation of the glucagon receptor. Proc. Natl. Acad. Sci. USA 2012, 109, 14393–14398. [Google Scholar] [CrossRef]
- Ma, S.; Shen, Q.; Zhao, L.H.; Mao, C.; Zhou, X.E.; Shen, D.D.; de Waal, P.W.; Bi, P.; Li, C.; Jiang, Y.; et al. Molecular Basis for Hormone Recognition and Activation of Corticotropin-Releasing Factor Receptors. Mol. Cell 2020, 77, 669–680.e4. [Google Scholar] [CrossRef]
- Gkountelias, K.; Tselios, T.; Venihaki, M.; Deraos, G.; Lazaridis, I.; Rassouli, O.; Gravanis, A.; Liapakis, G. Alanine scanning mutagenesis of the second extracellular loop of type 1 corticotropin-releasing factor receptor revealed residues critical for peptide binding. Mol. Pharmacol. 2009, 75, 793–800. [Google Scholar] [CrossRef] [PubMed]
- Spyridaki, K.; Matsoukas, M.T.; Cordomi, A.; Gkountelias, K.; Papadokostaki, M.; Mavromoustakos, T.; Logothetis, D.E.; Margioris, A.N.; Pardo, L.; Liapakis, G. Structural-Functional Analysis of the Third Transmembrane Domain of the Corticotropin-releasing Factor Type 1 Receptor: Role in Activation and Allosteric Antagonism. J. Biol. Chem. 2014, 289, 18966–18977. [Google Scholar] [CrossRef] [PubMed]
- Hollenstein, K.; Kean, J.; Bortolato, A.; Cheng, R.K.; Dore, A.S.; Jazayeri, A.; Cooke, R.M.; Weir, M.; Marshall, F.H. Structure of class B GPCR corticotropin-releasing factor receptor 1. Nature 2013, 499, 438–443. [Google Scholar] [CrossRef] [PubMed]
- Wootten, D.; Simms, J.; Miller, L.J.; Christopoulos, A.; Sexton, P.M. Polar transmembrane interactions drive formation of ligand-specific and signal pathway-biased family B G protein-coupled receptor conformations. Proc. Natl. Acad. Sci. USA 2013, 110, 5211–5216. [Google Scholar] [CrossRef] [PubMed]
- Liang, Y.L.; Belousoff, M.J.; Zhao, P.; Koole, C.; Fletcher, M.M.; Truong, T.T.; Julita, V.; Christopoulos, G.; Xu, H.E.; Zhang, Y.; et al. Toward a Structural Understanding of Class B GPCR Peptide Binding and Activation. Mol. Cell 2020, 77, 656–668.e655. [Google Scholar] [CrossRef] [PubMed]
- Kraetke, O.; Holeran, B.; Berger, H.; Escher, E.; Bienert, M.; Beyermann, M. Photoaffinity cross-linking of the corticotropin-releasing factor receptor type 1 with photoreactive urocortin analogues. Biochemistry 2005, 44, 15569–15577. [Google Scholar] [CrossRef] [PubMed]
- Dautzenberg, F.M.; Huber, G.; Higelin, J.; Py-Lang, G.; Kilpatrick, G.J. Evidence for the abundant expression of arginine 185 containing human CRF(2α) receptors and the role of position 185 for receptor-ligand selectivity. Neuropharmacology 2000, 39, 1368–1376. [Google Scholar] [CrossRef] [PubMed]
- Sydow, S.; Flaccus, A.; Fischer, A.; Spiess, J. The role of the fourth extracellular domain of the rat corticotropin-releasing factor receptor type 1 in ligand binding. Eur. J. Biochem. 1999, 259, 55–62. [Google Scholar] [CrossRef]
- Coin, I.; Katritch, V.; Sun, T.; Xiang, Z.; Siu, F.Y.; Beyermann, M.; Stevens, R.C.; Wang, L. Genetically encoded chemical probes in cells reveal the binding path of urocortin-I to CRF class B GPCR. Cell 2013, 155, 1258–1269. [Google Scholar] [CrossRef]
- Strader, C.D.; Fong, T.M.; Tota, M.R.; Underwood, D.; Dixon, R.A. Structure and function of G protein-coupled receptors. Annu. Rev. Biochem. 1994, 63, 101–132. [Google Scholar] [CrossRef]
- Savarese, T.M.; Fraser, C.M. In vitro mutagenesis and the search for structure-function relationships among G protein-coupled receptors. Biochem. J. 1992, 283 Pt 1, 1–19. [Google Scholar] [CrossRef]
- Cordomi, A.; Liapakis, G.; Matsoukas, M.T. Understanding Corticotropin Releasing Factor Receptor (CRFR) Activation Using Structural Models. Curr. Mol. Pharmacol. 2017, 10, 325–333. [Google Scholar] [CrossRef]
- Hoare, S.R.; Fleck, B.A.; Gross, R.S.; Crowe, P.D.; Williams, J.P.; Grigoriadis, D.E. Allosteric ligands for the corticotropin releasing factor type 1 receptor modulate conformational states involved in receptor activation. Mol. Pharmacol. 2008, 73, 1371–1380. [Google Scholar] [CrossRef]
- Assil-Kishawi, I.; Abou-Samra, A.B. Sauvagine cross-links to the second extracellular loop of the corticotropin-releasing factor type 1 receptor. J. Biol. Chem. 2002, 277, 32558–32561. [Google Scholar] [CrossRef] [PubMed]
- Hoare, S.R.; Sullivan, S.K.; Schwarz, D.A.; Ling, N.; Vale, W.W.; Crowe, P.D.; Grigoriadis, D.E. Ligand affinity for amino-terminal and juxtamembrane domains of the corticotropin releasing factor type I receptor: Regulation by G-protein and nonpeptide antagonists. Biochemistry 2004, 43, 3996–4011. [Google Scholar] [CrossRef] [PubMed]
- Nielsen, S.M.; Nielsen, L.Z.; Hjorth, S.A.; Perrin, M.H.; Vale, W.W. Constitutive activation of tethered-peptide/corticotropin-releasing factor receptor chimeras. Proc. Natl. Acad. Sci. USA 2000, 97, 10277–10281. [Google Scholar] [CrossRef]
- Zhao, L.-H.; Lin, J.; Ji, S.-Y.; Zhou, X.E.; Mao, C.; Shen, D.-D.; He, X.; Xiao, P.; Sun, J.; Melcher, K.; et al. Structure insights into selective coupling of G protein subtypes by a class B G protein-coupled receptor. Nat. Commun. 2022, 13, 6670. [Google Scholar] [CrossRef] [PubMed]
- Liaw, C.W.; Grigoriadis, D.E.; Lorang, M.T.; De Souza, E.B.; Maki, R.A. Localization of agonist- and antagonist-binding domains of human corticotropin-releasing factor receptors. Mol. Endocrinol. 1997, 11, 2048–2053. [Google Scholar] [CrossRef] [PubMed]
- Cunningham, B.C.; Wells, J.A. High-resolution epitope mapping of hGH-receptor interactions by alanine-scanning mutagenesis. Science 1989, 244, 1081–1085. [Google Scholar] [CrossRef] [PubMed]
- Jahn, O.; Tezval, H.; van Werven, L.; Eckart, K.; Spiess, J. Three-amino acid motifs of urocortin II and III determine their CRF receptor subtype selectivity. Neuropharmacology 2004, 47, 233–242. [Google Scholar] [CrossRef]
- Isfort, R.J.; Wang, F.; Tscheiner, M.; Donnelly, E.; Bauer, M.B.; Lefever, F.; Hinkle, R.T.; Mazur, A.W. Discovery of corticotropin releasing factor 2 receptor selective sauvagine analogues for treatment of skeletal muscle atrophy. J. Med. Chem. 2005, 48, 262–265. [Google Scholar] [CrossRef] [PubMed]
- Mazur, A.W.; Wang, F.; Tscheiner, M.; Donnelly, E.; Isfort, R.J. Determinants of corticotropin releasing factor. Receptor selectivity of corticotropin releasing factor related peptides. J. Med. Chem. 2004, 47, 3450–3454. [Google Scholar] [CrossRef] [PubMed]
- Pal, K.; Swaminathan, K.; Xu, H.E.; Pioszak, A.A. Structural basis for hormone recognition by the Human CRFR2{α} G protein-coupled receptor. J. Biol. Chem. 2010, 285, 40351–40361. [Google Scholar] [CrossRef] [PubMed]
- Rivier, J.; Gulyas, J.; Kirby, D.; Low, W.; Perrin, M.H.; Kunitake, K.; DiGruccio, M.; Vaughan, J.; Reubi, J.C.; Waser, B.; et al. Potent and long-acting corticotropin releasing factor (CRF) receptor 2 selective peptide competitive antagonists. J. Med. Chem. 2002, 45, 4737–4747. [Google Scholar] [CrossRef]
- Gulyas, J.; Rivier, C.; Perrin, M.; Koerber, S.C.; Sutton, S.; Corrigan, A.; Lahrichi, S.L.; Craig, A.G.; Vale, W.; Rivier, J. Potent, structurally constrained agonists and competitive antagonists of corticotropin-releasing factor. Proc. Natl. Acad. Sci. USA 1995, 92, 10575–10579. [Google Scholar] [CrossRef]
- Rivier, J.; Gulyas, J.; Kunitake, K.; DiGruccio, M.; Cantle, J.P.; Perrin, M.H.; Donaldson, C.; Vaughan, J.; Million, M.; Gourcerol, G.; et al. Stressin1-A, a potent corticotropin releasing factor receptor 1 (CRF1)-selective peptide agonist. J. Med. Chem. 2007, 50, 1668–1674. [Google Scholar] [CrossRef]
Peptide | Amino Acid Sequence | Ki (nM) | % h/rCRF Identity | |||
---|---|---|---|---|---|---|
CRF1R CRF2R | ||||||
h/rCRF 1 | Agonist | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII | 1.9 b | 31 a | 100 | |
oCRF | Agonist-CRF1R | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA | 1.2 b 1.1.2 b | 185 a | 82.9 | |
UI | Agonist | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV | 0.4 b | 2.2 a | 53.7 | |
SVG | Agonist | ZGPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI | 0.7 b | 4.3 a | 45.0 | |
α-helCRF 2 | Antagonist | DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA | 23.7 b | 96 a | 67.9 | |
Astressin | Antagonist | HLLREVLEBARAEQLAQEAHKNRKLBEII | 15.4 b | 1.5 b | 86.2 | |
rUcnI 1 | Agonist | DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV | 0.3 b | 0.3 b | 45.0 | |
hUcnI 1 | Agonist | DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV | 0.4 b | 0.3 b | 42.5 | |
hUcnII 1 | Agonist-CRF2R | IVLSLDVPIGLLQILLEQARARAAREQATTNARILARV | >100 c | 1.7 c | 34.2 | |
mUcnII 1 | Agonist-CRF2R | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV | >100 c | 2.1 c | 34.2 | |
hUcnII I 1 | Agonist-CRF2R | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI | >100 c | 22 c | 31.6 | |
mUcnIII 1 | Agonist-CRF2R | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI | >100 c | 5 c | 26.3 |
Ligand | EC50 (nM) |
---|---|
Chimeric Peptides | |
N-region-E K E E K E K K R K E-C-region | 0.6 |
N-region-E K E K E K K R K E-C-region | 25 |
N-region-E K K E K K R K E-C-region | 8.5 |
N-region-E K E K K R K E-C-region | 0.9 |
N-region-E K K K R K E-C-region | 12 |
N-region-E K K R K E-C-region | 50 |
N-region-E K R K E-C-region | 30 |
N-region-E K K E-C-region | 4.6 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Matsoukas, M.-T.; Panagiotopoulos, V.; Karageorgos, V.; Chrousos, G.P.; Venihaki, M.; Liapakis, G. Structural and Functional Insights into CRF Peptides and Their Receptors. Biology 2024, 13, 120. https://doi.org/10.3390/biology13020120
Matsoukas M-T, Panagiotopoulos V, Karageorgos V, Chrousos GP, Venihaki M, Liapakis G. Structural and Functional Insights into CRF Peptides and Their Receptors. Biology. 2024; 13(2):120. https://doi.org/10.3390/biology13020120
Chicago/Turabian StyleMatsoukas, Minos-Timotheos, Vasilis Panagiotopoulos, Vlasios Karageorgos, George P. Chrousos, Maria Venihaki, and George Liapakis. 2024. "Structural and Functional Insights into CRF Peptides and Their Receptors" Biology 13, no. 2: 120. https://doi.org/10.3390/biology13020120
APA StyleMatsoukas, M.-T., Panagiotopoulos, V., Karageorgos, V., Chrousos, G. P., Venihaki, M., & Liapakis, G. (2024). Structural and Functional Insights into CRF Peptides and Their Receptors. Biology, 13(2), 120. https://doi.org/10.3390/biology13020120