In Silico Prediction and Design of Uropathogenic Escherichia coli Alpha-Hemolysin Generate a Soluble and Hemolytic Recombinant Toxin
Abstract
1. Introduction
2. Materials and Methods
2.1. Bacterial Strains and Growth Conditions
2.2. Cell Culture
2.3. Design and Construction of Immunogenic Recombinant HlyA
2.4. Expression and Purification of the Recombinant Protein
2.5. Mass Spectrometry Analysis
2.6. Hemolysis Assay
2.7. Cell Assay
3. Results
3.1. In Silico Design and Prediction
3.2. Cloning, Expression, and Purification
3.3. Proteomic Processing
3.4. Phenotypical Features of HlyA
3.4.1. Hemolytic Activity
3.4.2. Cytotoxic Activity
4. Discussion
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Ristow, L.C.; Welch, R.A. Hemolysin of uropathogenic Escherichia coli: A cloak or a dagger? Biochimica Biophysica Acta 2016, 1858, 538–545. [Google Scholar] [CrossRef] [PubMed]
- Linhartová, I.; Bumba, L.; Mašín, J.; Basler, M.; Osička, R.; Kamanová, J.; Procházková, K.; Adkins, I.; Hejnová-Holubová, J.; Sadílková, L.; et al. RTX proteins: A highly diverse family secreted by a common mechanism. FEMS Microbiol. Rev. 2010, 34, 1076–1112. [Google Scholar] [CrossRef]
- Murthy, A.M.V.; Phan, M.D.; Peters, K.M.; Nhu, N.T.K.; Welch, R.A.; Ulett, G.C.; Schembri, M.A.; Sweet, M.J. Regulation of hemolysin in uropathogenic Escherichia coli fine-tunes killing of human macrophages. Virulence 2018, 9, 967–980. [Google Scholar] [CrossRef]
- Wiles, T.J.; Dhakal, B.K.; Eto, D.S.; Mulvey, M.A. Inactivation of host akt/protein kinase B signaling by bacterial pore-forming toxins. Mol. Biol. Cell 2008, 19, 1427–1438. [Google Scholar] [CrossRef]
- Stanek, O.; Masin, J.; Osicka, R.; Jurnecka, D.; Osickova, A.; Sebo, P. Rapid purification of endotoxin-free RTX toxins. Toxins 2019, 11, 336. [Google Scholar] [CrossRef]
- Verma, V.; Gupta, S.; Kumar, P.; Rawat, A.; Singh Dhanda, R.; Yadav, M. Efficient production of endotoxin depleted bioactive α-hemolysin of uropathogenic Escherichia coli. Prep. Biochem. Biotechnol. 2019, 49, 616–622. [Google Scholar] [CrossRef]
- Orr, B.; Douce, G.; Baillie, S.; Parton, R.; Coote, J. Adjuvant effects of adenylate cyclase toxin of Bordetella pertussis after intranasal immunisation of mice. Vaccine 2007, 25, 64–71. [Google Scholar] [CrossRef]
- Raunio, H. In silico toxicology—Non-testing methods. Front. Pharmacol. 2011, 2, 33. [Google Scholar] [CrossRef] [PubMed]
- Chan, C.C.H.; Song, J.; Tey, B.I.; Ramana, R.N. Bioinformatics approaches for improved recombinant protein production in Escherichia coli: Protein solubility prediction. Brief. Bioinform. 2013, 15, 953–962. [Google Scholar] [CrossRef]
- Hopp, T.P.; Woods, K.R. Prediction of protein antigenic determinants from amino acid sequences. Proc. Natl. Acad. Sci. USA 1981, 78, 3824–3828. [Google Scholar] [CrossRef]
- Sambrook, J.; Fritsch, E.R.; Maniatis, T. Molecular Cloning: A Laboratory Manual, 2nd ed.; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, NY, USA, 1989. [Google Scholar]
- Armenteros, J.J.A.; Tsirigos, K.D.; Sønderby, C.K.; Petersen, T.N.; Winther, O.; Brunak, S.; Nielsen, H. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat. Biotechnol. 2019, 37, 420–423. [Google Scholar] [CrossRef]
- Kelley, L.A.; Mezulis, S.; Yates, C.M.; Wass, M.N.; Sternberg, M.J. The Phyre2 web portal for protein modeling, prediction and analysis. Nat. Protoc. 2015, 10, 845–858. [Google Scholar] [CrossRef]
- Schwede, T.; Kopp, J.; Guex, N.; Peitsch, M.C. SWISS-MODEL: An automated protein homology-modeling server. Nucleic Acids Res. 2003, 31, 3381–3385. [Google Scholar] [CrossRef]
- Yang, J.; Yan, R.; Roy, A.; Xu, D.; Poisson, J.; Zhang, Y. The I-TASSER Suite: Protein structure and function prediction. Nat. Methods 2015, 12, 7–8. [Google Scholar] [CrossRef]
- Bhattacharya, D.; Nowotny, J.; Cao, R.; Cheng, J. 3Drefine: An interactive web server for efficient protein structure refinement. Nucleic Acids Res. 2016, 44, W406–W409. [Google Scholar] [CrossRef]
- Jespersen, M.C.; Peters, B.; Nielsen, M.; Marcatili, P. BepiPred-2.0: Improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. 2017, 5, W24–W29. [Google Scholar] [CrossRef] [PubMed]
- Chung, C.T.; Miller, R.H. A rapid and convenient method for the preparation and storage of competent bacterial cells. Nucleic Acids Res. 1988, 16, 3580. [Google Scholar] [CrossRef] [PubMed]
- Beutin, L. The different hemolysins of Escherichia coli. Med. Microbiol. Immunol. 1991, 180, 167–182. [Google Scholar] [CrossRef]
- Itagaki, H.; Hagino, S.; Kato, S.; Kobayashi, T.; Umeda, M. An in vitro alternative to the draize eye-irritation test: Evaluation of the crystal violet staining method. Toxic. In Vitro 1991, 5, 139–143. [Google Scholar] [CrossRef]
- Thomas, S.; Holland, I.B.; Schmitt, L. The Type 1 secretion pathway—The hemolysin system and beyond. Biochimica Biophysica Acta 2014, 1843, 1629–1641. [Google Scholar] [CrossRef]
- Balsalobre, C.; Silvan, J.M.; Berglund, S.; Mizunoe, Y.; Uhlin, B.E.; Wai, S.N. Release of the type I secreted alpha-haemolysin via outer membrane vesicles from Escherichia coli. Mol. Microbiol. 2006, 59, 99–112. [Google Scholar] [CrossRef] [PubMed]
- Oropeza-Wekerle, R.L.; Muller, E.; Kern, P.; Meyermann, R.; Goebel, W. Synthesis, inactivation, and localization of extracellular and intracelular Escherichia coli hemolysins. J. Bacteriol. 1989, 171, 2783–2788. [Google Scholar] [CrossRef] [PubMed]
- Mansson, L.E.; Kja, P.; Pellet, S.; Nagy, G.; Welch, R.A.; Backhed, F.; Frisan, T.; Dahlforsi, A.R. Role of the lipopolysaccharide-CD-14 complex for the activity of hemolysin from uropathogenic Escherichia coli. Infec. Immun. 2007, 75, 997–1004. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Hernández-Domínguez, E.M.; Castillo-Ortega, L.S.; García-Esquivel, Y.; Mandujano-González, V.; Díaz-Godínez, G.; Álvarez-Cervantes, J. Bioinformatics as a tool for the structural and evolutionary analysis of proteins. In Computational Biology and Chemistry; IntechOpen: London, UK, 2019. [Google Scholar]
- Raoufi, E.; Hemmati, M.; Eftekhari, S.; Khaksaran, K.; Mahmodi, Z.; Farajollahi, M.M.; Mohsenzadegan, M. Epitope prediction by novel immunoinformatics approach: A state-of-the-art review. Int. J. Pept. Res. Ther. 2020, 26, 1155–1163. [Google Scholar] [CrossRef]
- Forestier, C.; Welch, R.A. Identification of RTX toxin target cell specificity domains by use of hybrid genes. Infect. Immun. 1991, 59, 4212–4220. [Google Scholar] [CrossRef] [PubMed]
- Rowe, G.E.; Pellet, S.; Welch, R.A. Analysis of toxinogenic functions associated with the RTX repeat region and monoclonal antibody D12 epitope of Escherichia coli hemolysin. Infect. Immun. 1994, 62, 579–588. [Google Scholar] [CrossRef]







| Peptide Sequence | Length | Start | End | pI | |
|---|---|---|---|---|---|
| 1 | LTPGEEIRERRQSGKY | 16 | 550 | 565 | 8.59 |
| 2 | ASVGNNQYREI | 11 | 600 | 610 | 6.05 |
| 3 | VKVLQEVVKEQEVSVGKRTEKTQYRSYEFTHINGKNLTETDNLY | 44 | 674 | 717 | 6.76 |
| Protein | Sequence | Length | Molecular Weight |
|---|---|---|---|
| Alpha-hemolysin | LLKFVTPLLTPGEEIRERRQSGKYEYITELLVKGVDKWTVKGVQDKGSVYDYSNLIQHASVGNNQYREIRIESHLGDGDDKVFLSAGSANIYAGKGHDVVYYDKTDTGYLTIDGTKATEAGNYTVTRVLGGDVKVLQEVVKEQEVSVGKRTEKTQYRSYEFTHINGKNLTETDNLYSVEELI | 182 | 20.48 kDa |
| Description | Accession | −10lgP | #Peptides | Coverage (%) | Avg. Mass | Organism |
|---|---|---|---|---|---|---|
| Hemolysin, chromosomal | P09983 | 111.40 | 10 | 10 | 109,867 | Escherichia coli |
| Chloramphenicol acetyltransferase | P62577 | 88.31 | 7 | 17 | 25,663 | Escherichia coli |
| 50S ribosomal protein | B61233 | 28.38 | 1 | 3 | 22,087 | Escherichia coli |
| Hly A (recombinant) | - | 222.24 | 11 | 59 | 20,480 | Escherichia coli |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Caetano, B.D.L.; Domingos, M.d.O.; da Silva, M.A.; da Silva, J.C.A.; Polatto, J.M.; Montoni, F.; Iwai, L.K.; Pimenta, D.C.; Vigerelli, H.; Vieira, P.C.G.; et al. In Silico Prediction and Design of Uropathogenic Escherichia coli Alpha-Hemolysin Generate a Soluble and Hemolytic Recombinant Toxin. Microorganisms 2022, 10, 172. https://doi.org/10.3390/microorganisms10010172
Caetano BDL, Domingos MdO, da Silva MA, da Silva JCA, Polatto JM, Montoni F, Iwai LK, Pimenta DC, Vigerelli H, Vieira PCG, et al. In Silico Prediction and Design of Uropathogenic Escherichia coli Alpha-Hemolysin Generate a Soluble and Hemolytic Recombinant Toxin. Microorganisms. 2022; 10(1):172. https://doi.org/10.3390/microorganisms10010172
Chicago/Turabian StyleCaetano, Bruna De Lucca, Marta de Oliveira Domingos, Miriam Aparecida da Silva, Jessika Cristina Alves da Silva, Juliana Moutinho Polatto, Fabio Montoni, Leo Kei Iwai, Daniel Carvalho Pimenta, Hugo Vigerelli, Paulo Cesar Gomes Vieira, and et al. 2022. "In Silico Prediction and Design of Uropathogenic Escherichia coli Alpha-Hemolysin Generate a Soluble and Hemolytic Recombinant Toxin" Microorganisms 10, no. 1: 172. https://doi.org/10.3390/microorganisms10010172
APA StyleCaetano, B. D. L., Domingos, M. d. O., da Silva, M. A., da Silva, J. C. A., Polatto, J. M., Montoni, F., Iwai, L. K., Pimenta, D. C., Vigerelli, H., Vieira, P. C. G., Ruiz, R. d. C., Patané, J. S., & Piazza, R. M. F. (2022). In Silico Prediction and Design of Uropathogenic Escherichia coli Alpha-Hemolysin Generate a Soluble and Hemolytic Recombinant Toxin. Microorganisms, 10(1), 172. https://doi.org/10.3390/microorganisms10010172

