The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus
Abstract
:Simple Summary
Abstract
1. Introduction
2. Materials and Methods
2.1. Insect Colonies
2.2. Chorion Collection and Sample Preparation
2.3. Reduction/Alkylation and In-Solution Digestion of Chorion Proteins
2.4. Desalting of Digested Protein
2.5. LC-MS/MS Mass Spectrometry Analysis
2.6. Database Searches
3. Results and Discussion
3.1. Enzymes
3.2. Binding Proteins
3.3. Structural and Protection Proteins
3.4. Vitellogenins
3.5. Gene Expression Regulation Proteins
3.6. Immune Response
3.7. Other Proteins and Uncharacterized Proteins
4. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Bové, J.M. Huanglongbing: A destructive, newly emerging, century-old disease of citrus. J. Plant Pathol. 2006, 88, 7–37. [Google Scholar]
- Jagoueix, S.; Bové, J.M.; Garnier, M. The phloem-limited bacterium of greening disease of citrus is a member of the alpha-subdivision of the proteobacteria. Int. J. of Syst. Bacteriol. 1994, 44, 379–386. [Google Scholar] [CrossRef] [Green Version]
- Achor, D.S.; Etxeberria, E.; Wang, N.; Folimonova, S.Y.; Chung, K.R.; Albrigo, L.G. Sequence of anatomical symptom observations in citrus affected with huanglongbing disease. Plant Pathol. J. 2010, 9, 56–64. [Google Scholar] [CrossRef] [Green Version]
- Koh, E.-J.; Zhou, L.; Williams, D.S.; Park, J.; Ding, N.; Duan, Y.-P.; Kang, B.-H. Callose deposition in the phloem plasmodesmata and inhibition of phloem transport in citrus leaves infected with “Candidatus Liberibacter asiaticus”. Protoplasma 2012, 249, 687–697. [Google Scholar] [CrossRef]
- Cimo, G.; Lo Bianco, R.; Gonzalez, P.; Bandaranayake, W.; Etxeberria, E.; Syvertsen, J.P. Carbohydrate and Nutritional Responses to Stem Girdling and Drought Stress with Respect to Understanding Symptoms of Huanglongbing in Citrus. Hortscience 2013, 48, 920–928. [Google Scholar] [CrossRef]
- Johnson, E.G.; Wu, J.; Bright, D.B.; Graham, J.H. Association of ‘Candidatus Liberibacter asiaticus’ root infection, but not phloem plugging with root loss on huanglongbing- affected trees prior to appearance of foliar symptoms. Plant. Pathol. 2014, 63, 290–298. [Google Scholar] [CrossRef]
- Halbert, S.E.; Manjunath, K.L. Asian citrus psyllids (Sternorrhyncha: Psyllidae) and greening disease of citrus: A literature review and assessment of risk in Florida. Fla. Entomol. 2004, 87, 330–353. [Google Scholar] [CrossRef]
- Teixeira, D.D.; Danet, J.L.; Eveillard, S.; Martins, E.C.; Junior, W.C.J.; Yamamoto, P.T.; Lopes, S.A.; Bassanezi, R.B.; Ayres, A.J.; Saillard, C.; et al. Citrus huanglongbing in Sao Paulo State, Brazil: PCR detection of the Candidatus Liberibacter species associated with the disease. Mol. Cell. Probes 2005, 19, 173–179. [Google Scholar] [CrossRef] [PubMed]
- Baldwin, E.; Plotto, A.; Manthey, J.; McCollum, G.; Bai, J.H.; Irey, M.; Cameron, R.; Luzio, G. Effect of Liberibacter Infection (Huanglongbing Disease) of Citrus on Orange Fruit Physiology and Fruit/Fruit Juice Quality: Chemical and Physical Analyses. J. Agric. Food Chem. 2010, 58, 1247–1262. [Google Scholar] [CrossRef] [PubMed]
- Gottwald, T.R. Current Epidemiological Understanding of Citrus Huanglongbing. Annu. Rev. Phytopathol. 2010, 48, 119–139. [Google Scholar] [CrossRef] [Green Version]
- Stover, E.; McCollum, G. Incidence and Severity of Huanglongbing and Candidatus Liberibacter asiaticus Titer among Field-infected Citrus Cultivars. Hortscience 2011, 46, 1344–1348. [Google Scholar] [CrossRef]
- Court, C.D.; Hodges, A.W.; Stair, C.; Rahmani, M. Economic Contributions of the Florida Citrus Industry in 2016–2017; University of Florida: Gainesville, FL, USA, 2018. [Google Scholar]
- Tiwari, S.; Mann, R.S.; Rogers, M.E.; Stelinski, L.L. Insecticide resistance in field populations of Asian citrus psyllid in Florida. Pest. Manag. Sci. 2011, 67, 1258–1268. [Google Scholar] [CrossRef] [PubMed]
- Tiwari, S.; Stelinski, L.L.; Rogers, M.E. Biochemical Basis of Organophosphate and Carbamate Resistance in Asian Citrus Psyllid. J. Econ. Entomol. 2012, 105, 540–548. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Singerman, A.; Lence, S.H.; Useche, P. Is Area-Wide Pest Management Useful? The Case of Citrus Greening. Appl. Econ. Perspect. Policy 2017, 39, 609–634. [Google Scholar] [CrossRef] [Green Version]
- Hall, D.G.; Lapointe, S.L.; Wenninger, E.J. Effects of a particle film on biology and behavior of Diaphorina citri (Hemiptera: Psyllidae) and its infestations in citrus. J. Econ. Entomol. 2007, 100, 847–854. [Google Scholar] [CrossRef]
- Rouse, R.E.; Ozores-Hampton, M.; Roka, F.M.; Roberts, P. Rehabilitation of Huanglongbing-affected Citrus Trees Using Severe Pruning and Enhanced Foliar Nutritional Treatments. Hortscience 2017, 52, 972–978. [Google Scholar] [CrossRef] [Green Version]
- Gottwald, T.R.; Graham, J.H.; Irey, M.S.; McCollum, T.G.; Wood, B.W. Inconsequential effect of nutritional treatments on huanglongbing control, fruit quality, bacterial titer and disease progress. Crop. Prot. 2012, 36, 73–82. [Google Scholar] [CrossRef]
- Stansly, P.A.; Arevalo, H.A.; Qureshi, J.A.; Jones, M.M.; Hendricks, K.; Roberts, P.D.; Roka, F.M. Vector control and foliar nutrition to maintain economic sustainability of bearing citrus in Florida groves affected by huanglongbing. Pest. Manag. Sci. 2014, 70, 415–426. [Google Scholar] [CrossRef]
- Mann, R.S.; Qureshi, J.A.; Stansly, P.A.; Stelinski, L.L. Behavioral Response of Tamarixia radiata (Waterston) (Hymenoptera: Eulophidae) to Volatiles Emanating from Diaphorina citri Kuwayama (Hemiptera: Psyllidae) and Citrus. J. Insect. Behav. 2010, 23, 447–458. [Google Scholar] [CrossRef]
- Hunter, W.B.; Glick, E.; Paldi, N.; Bextine, B.R. Advances in RNA interference: dsRNA Treatment in Trees and Grapevines for Insect Pest Suppression. Southwest Entomol. 2012, 37, 85–87. [Google Scholar] [CrossRef]
- Qureshi, J.A.; Stansly, P.A. Asian Citrus Psyllid: Biology, Ecology and Management of the Huanglongbing Vector; Qureshi, J.A., Stansly, P.A., Eds.; CABI Press: Boston, MA, USA, 2020. [Google Scholar]
- Hunter, W.B.; Reese, J.; Consortium, I.P.G. The Asian Citrus Psyllid Genome (Diaphorina citri, Hemiptera). J. Citrus Pathol. 2014, 1. [Google Scholar] [CrossRef]
- Reese, J.; Christenson, M.K.; Leng, N.; Saha, S.; Cantarel, B.; Lindeberg, M.; Tamborindeguy, C.; MacCarthy, J.; Weaver, D.; Trease, A.J.; et al. Characterization of the Asian Citrus Psyllid Transcriptome. J. Genom. 2014, 2, 54–58. [Google Scholar] [CrossRef]
- Saha, S.; Hosmani, P.S.; Villalobos-Ayala, K.; Miller, S.; Shippy, T.; Flores, M.; Rosendale, A.; Cordola, C.; Bell, T.; Mann, H.; et al. Improved annotation of the insect vector of citrus greening disease: Biocuration by a diverse genomics community. Database J. Biol. Databases Curation 2017, 2017, bax032. [Google Scholar] [CrossRef]
- Killiny, N.; Hajeri, S.; Tiwari, S.; Gowda, S.; Stelinski, L.L. Double-Stranded RNA Uptake through Topical Application, Mediates Silencing of Five CYP4 Genes and Suppresses Insecticide Resistance in Diaphorina citri. PLoS ONE 2014, 9, e0110536. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yu, X.D.; Killiny, N. Effect of silencing a boule homologue on the survival and reproduction of Asian citrus psyllid Diaphorina citri. Physiol. Entomol. 2018, 43, 268–275. [Google Scholar] [CrossRef]
- Yu, X.D.; Killiny, N. Effect of parental RNA interference of a transformer-2 homologue on female reproduction and offspring sex determination in Asian citrus psyllid. Physiol. Entomol. 2018, 43, 42–50. [Google Scholar] [CrossRef] [Green Version]
- Yu, X.D.; Killiny, N. RNA interference of two glutathione S-transferase genes, Diaphorina citri DcGSTe2 and DcGSTd1, increases the susceptibility of Asian citrus psyllid (Hemiptera: Liviidae) to the pesticides fenpropathrin and thiamethoxam. Pest. Manag. Sci. 2018, 74, 638–647. [Google Scholar] [CrossRef] [PubMed]
- Killiny, N.; Kishk, A. Delivery of dsRNA through topical feeding for RNA interference in the citrus sap piercing-sucking hemipteran, Diaphorina citri. Arch. Insect Biochem. Physiol. 2017, 95, e21394. [Google Scholar] [CrossRef]
- Yu, X.; Gowda, S.; Killiny, N. Double-stranded RNA delivery through soaking mediates silencing of the muscle protein 20 and increases mortality to the Asian citrus psyllid, Diaphorina citri. Pest. Manag. Sci. 2017, 73, 1846–1853. [Google Scholar] [CrossRef] [PubMed]
- Hunter, W.B.; Sinisterra-Hunter, X.H. Chapter Six—Emerging RNA Suppression Technologies to Protect Citrus Trees from Citrus Greening Disease Bacteria. In Advances in Insect Physiology; Smagghe, G., Ed.; Academic Press: London, UK, 2018; Volume 55, pp. 163–197. [Google Scholar]
- El-Shesheny, I.; Hajeri, S.; El-Hawary, I.; Gowda, S.; Killiny, N. Silencing Abnormal Wing Disc Gene of the Asian Citrus Psyllid, Diaphorina citri Disrupts Adult Wing Development and Increases Nymph Mortality. PLoS ONE 2013, 8, e0065392. [Google Scholar] [CrossRef] [Green Version]
- Hajeri, S.; Killiny, N.; El-Mohtar, C.; Dawson, W.O.; Gowda, S. Citrus tristeza virus-based RNAi in citrus plants induces gene silencing in Diaphorina citri, a phloem-sap sucking insect vector of citrus greening disease (Huanglongbing). J. Biotechnol. 2014, 176, 42–49. [Google Scholar] [CrossRef]
- Santos-Ortega, Y.; Killiny, N. Silencing of sucrose hydrolase causes nymph mortality and disturbs adult osmotic homeostasis in Diaphorina citri (Hemiptera: Liviidae). Insect Biochem. Mol. Biol. 2018, 101, 131–143. [Google Scholar] [CrossRef]
- Kishk, A.; Hijaz, F.; Anber, H.A.I.; AbdEl-Raof, T.K.; El-Sherbeni, A.D.; Hamed, S.; Killiny, N. RNA interference of acetylcholinesterase in the Asian citrus psyllid, Diaphorina citri, increases its susceptibility to carbamate and organophosphate insecticides. Pestic. Biochem. Physiol. 2017, 143, 81–89. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tsai, J.H.; Liu, Y.H. Biology of Diaphorina citri (Homoptera: Psyllidae) on Four Host Plants. J. Econ. Entomol. 2000, 93, 1721–1725. [Google Scholar] [CrossRef] [PubMed]
- Blum, M.S.; Hilker, M. Chemical Protection of Insect Eggs. In Chemoecology of Insect Eggs and Egg Deposition; Hilker, M., Meiners, T., Eds.; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2003; pp. 61–90. [Google Scholar]
- Bomfim, L.; Vieira, P.; Fonseca, A.; Ramos, I. Eggshell ultrastructure and delivery of pharmacological inhibitors to the early embryo of R. prolixus by ethanol permeabilization of the extraembryonic layers. PLoS ONE 2017, 12, e0185770. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wigglesworth, V.B.; Beament, J.W.L. The Respiratory Mechanisms of Some Insect Eggs. Q. J. Microsc. Sci. 1950, 3, 429–452. [Google Scholar]
- Kumari, A.; Kaushik, N. Oviposition Deterrents in Herbivorous Insects and their potential use in Integrated Pest Management. Indian J. Exp. Biol. 2016, 54, 163–174. [Google Scholar]
- Roy, A.S.; Ghosh, D. Chorion is a complex structure of protein and polysaccharide—A microscopical study in Oxya hyla hyla (Orthoptera: Acrididae). J. Entomol. Zool. Studies 2014, 2, 144–150. [Google Scholar]
- Hunter, W.B.; Gonzalez, M.T.; Tomich, J. BAPC-assisted-CRISPR-Cas9 Delivery into Nymphs and Adults for Heritable Gene Editing (Hemiptera). FASEB J. 2019, 33, 626-2. [Google Scholar] [CrossRef]
- Hunter, W.B.; Gonzalez, M.T.; Tomich, J. BAPC-assisted CRISPR/Cas9 System: Targeted Delivery into Adult Ovaries for Heritable Germline Gene Editing (Arthropoda: Hemiptera). bioRxiv 2018. [Google Scholar] [CrossRef]
- Santos-Ortega, Y.; Killiny, N. In vitro egg hatching of Diaphorina citri, the vector of Huanglongbing. Entomol. Exp. Appl. 2020, in press. [Google Scholar] [CrossRef]
- Lu, Z.; Hu, H.; Killiny, N. Proteomic maps of subcellular protein fractions of the Asian citrus psyllid Diaphorina citri, the vector of citrus huanglongbing. Physiol. Entomol. 2017, 42, 36–64. [Google Scholar] [CrossRef] [Green Version]
- Yu, X.D.; Killiny, N. The secreted salivary proteome of Asian citrus psyllid Diaphorina citri. Physiolog. Entomol. 2018, 43, 324–333. [Google Scholar] [CrossRef]
- Zhang, T.; Chhajed, S.; Schneider, J.D.; Feng, G.; Song, W.-Y.; Chen, S. Proteomic characterization of MPK4 signaling network and putative substrates. Plant. Mol. Biol. 2019, 101, 325–339. [Google Scholar] [CrossRef]
- Nesvizhskii, A.I.; Keller, A.; Kolker, E.; Aebersold, R. A Statistical Model for Identifying Proteins by Tandem Mass Spectrometry. Anal. Chem. 2003, 75, 4646–4658. [Google Scholar] [CrossRef]
- Kerkut, G.A.; Gilbert, L.I. Regulation: Digestion, Nutrition, Excretion. In Comprehensive Insect Physiology, Biochemistry, and Pharmacology; Kerkut, G.A., Gilbert, L.I., Eds.; Pergamon Press: Oxford, UK, 1985; Volume 4. [Google Scholar]
- Amenya, D.A.; Chou, W.; Li, J.; Yan, G.; Gershon, P.D.; James, A.A.; Marinotti, O. Proteomics reveals novel components of the Anopheles gambiae eggshell. J. Insect Physiol. 2010, 56, 1414–1419. [Google Scholar] [CrossRef] [Green Version]
- Margaritis, L.H. The egg-shell of Drosophila melanogaster III. Covalent crosslinking of the chorion proteins involves endogenous hydrogen peroxide. Tissue Cell 1985, 17, 553–559. [Google Scholar] [CrossRef]
- Gundappa; Shashank, P.R.; Bollineni, H. Insect proteomics: Present and future perspective. Curr. Biotica 2014, 7, 336–342. [Google Scholar]
- Marinotti, O.; Ngo, T.; Kojin, B.B.; Chou, S.P.; Nguyen, B.; Juhn, J.; Carballar-Lejarazu, R.; Marinotti, P.N.; Jiang, X.F.; Walter, M.F.; et al. Integrated proteomic and transcriptomic analysis of the Aedes aegypti eggshell. BMC Dev. Biol. 2014, 14, 15. [Google Scholar] [CrossRef] [Green Version]
- Zhu, Q.; Deng, Y.; Vanka, P.; Brown, S.J.; Muthukrishnan, S.; Kramer, K.J. Computational identification of novel chitinase-like proteins in the Drosophila melanogaster genome. Bioinformatics 2004, 20, 161–169. [Google Scholar] [CrossRef] [PubMed]
- Intra, J.; Cenni, F.; Pavesi, G.; Pasini, M.; Perotti, M.E. Interspecific Analysis of the Glycosidases of the Sperm Plasma Membrane in Drosophila. Mol. Reprod. Dev. 2009, 76, 85–100. [Google Scholar] [CrossRef]
- Tajiri, R.; Ogawa, N.; Fujiwara, H.; Kojima, T. Mechanical Control of Whole Body Shape by a Single Cuticular Protein Obstructor-E in Drosophila melanogaster. PLoS Genet. 2017, 13, e1006548. [Google Scholar] [CrossRef]
- Kriventseva, E.V.; Kuznetsov, D.; Tegenfeldt, F.; Manni, M.; Dias, R.; Simao, F.A.; Zdobnov, E.M. OrthoDB v10: Sampling the diversity of animal, plant, fungal, protist, bacterial and viral genomes for evolutionary and functional annotations of orthologs. Nucleic Acids Res. 2019, 47, D807–D811. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tufail, M.; Takeda, M. Insect vitellogenin/lipophorin receptors: Molecular structures, role in oogenesis, and regulatory mechanisms. J. Insect Physiol. 2009, 55, 88–104. [Google Scholar] [CrossRef] [PubMed]
- Upadhyay, S.K.; Singh, H.; Dixit, S.; Mendu, V.; Verma, P.C. Molecular Characterization of Vitellogenin and Vitellogenin Receptor of Bemisia tabaci. PLoS ONE 2016, 11, e0155306. [Google Scholar] [CrossRef] [Green Version]
- Lou, Y.H.; Pan, P.L.; Ye, Y.X.; Cheng, C.; Xu, H.J.; Zhang, C.X. Identification and functional analysis of a novel chorion protein essential for egg maturation in the brown planthopper. Insect. Mol. Biol. 2018, 27, 393–403. [Google Scholar] [CrossRef]
- Miao, Y.T.; Deng, Y.; Jia, H.K.; Liu, Y.D.; Hou, M.L. Proteomic analysis of watery saliva secreted by white-backed planthopper, Sogatella furcifera. PLoS ONE 2018, 13, e0193831. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tetley, R.J.; Blanchard, G.B.; Fletcher, A.G.; Adams, R.J.; Sanson, B. Unipolar distributions of junctional Myosin II identify cell stripe boundaries that drive cell intercalation throughout Drosophila axis extension. Elife 2016, 5, e12094. [Google Scholar] [CrossRef]
- Gur, G.; Rubin, C.; Katz, M.; Amit, I.; Citri, A.; Nilsson, J.; Amariglio, N.; Henriksson, R.; Rechavi, G.; Hedman, H.; et al. LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation. EMBO J. 2004, 23, 3270–3281. [Google Scholar] [CrossRef] [Green Version]
- Lindquist, D.; Kvarnbrink, S.; Henriksson, R.; Hedman, H. LRIG and cancer prognosis. Acta Oncol. 2014, 53, 1135–1142. [Google Scholar] [CrossRef] [Green Version]
- Alon, M.; Elbaz, M.; Ben-Zvi, M.M.; Feldmesser, E.; Vainstein, A.; Morin, S. Insights into the transcriptomics of polyphagy: Bemisia tabaci adaptability to phenylpropanoids involves coordinated expression of defense and metabolic genes. Insect Biochem. Mol. Biol. 2012, 42, 251–263. [Google Scholar] [CrossRef] [PubMed]
- Chaturvedi, D.; Inaba, M.; Scoggin, S.; Buszczak, M. Drosophila CG2469 Encodes a Homolog of Human CTR9 and Is Essential for Development. G3-Genes Genomes Genet. 2016, 6, 3849–3857. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xia, X.F.; You, M.S.; Rao, X.J.; Yu, X.Q. Insect C-type lectins in innate immunity. Develop. Comp. Immunol. 2018, 83, 70–79. [Google Scholar] [CrossRef] [PubMed]
- Hilker, M.; Fatouros, N.E. Plant Responses to Insect Egg Deposition. Annu. Rev. Entomol. 2015, 60, 493–515. [Google Scholar] [CrossRef] [PubMed]
- Ammar, E.D.; Ramos, J.E.; Hall, D.G.; Dawson, W.O.; Shatters, R.G. Acquisition, Replication and Inoculation of Candidatus Liberibacter asiaticus following Various Acquisition Periods on Huanglongbing-Infected Citrus by Nymphs and Adults of the Asian Citrus Psyllid. PLoS ONE 2016, 11, e0159594. [Google Scholar] [CrossRef] [PubMed]
Identified Protein | Accession Number | M.W. (kDa) | Peptides | Coverage (%) | Biological Activity |
---|---|---|---|---|---|
Vitellogenin-1-like VWFD domain | A0A1S3DT76_DIACI | 63 | (R)SEKEDPAMQIAAEAMWGENAQSGAK(I) (R)KQYIANHPQAEQCR(K) (R)LMVVEQGNQLCFSTK(A) | 11.10 | Homeostasis |
Vitellogenin-2-like VWFD domain | A0A3Q0J6A6_DIACI | 52 | (R)ASSAIPSTPSK(N) (R)SEKEDPAMQIAAEAMWGENAQSGAK(I) (R)KQYIANHPQAEQCR(K) | 10.80 | Homeostasis |
Vitellogenin-A1-like VTG domain | A0A3Q0JK51_DIACI | 170 | (R)TLAALHDVADQYTGTIIK(A) (R)NQDSVLAWVTNAR(H) (K)NLQVSQNLPTWELNIIK(S) (K)GSNGDLIDIIK(T) (K)FTILAGVIR(T) | 4.44 | Source of nutrients |
Vitellogenin-likeLOC103523837 | A0A1S4ERJ7_DIACI | 64 | (K)IAQMLNIK(R) (K)YFQVNIPIK(A) | 2.94 | Lipid transport |
LOW QUALITY PROTEIN: probable chitinase 10 GH18 family | A0A3Q0JIK7_DIACI | 306 | (K)KESCAPGLHWNK(V) (R)SFLICSHGNLLK(Q) (K)QSCGPSLLWNAK(K) (R)IGPYAYSDNQWVGYDDVDMIR(T) (K)SMNLGGGMIWALDLDDFK(N) (R)AAFNPHDLLLSAAVSPSK(A) (R)GFLAYYEICDK(I) | 3.84 | Glycosyl hydrolases |
Histone acetyltransferase p300 | A0A1S4EH08_DIACI | 30 | (K)TNGPHIYSAQATQYSGPQQTWADLQSSPVVILVK(N) (K)LLLQNNDK(V) (K)VGILYPTNAFPVNSFPDFPVGNLILPQDMSLSK(I) | 27.60 | Transferase activity |
Cluster of golgin subfamily A member 4-like LOC103519497 | A0A3Q0JE54_DIACI | 180 | (R)LEAETNLEKSLEQKNR(E) (R)SNNEIDLDMELVIDKFKALQTQMK(T) | 2.59 | Gene expression regulation |
Golgin subfamily A member 4-like LOC103510159 | A0A3Q0IWE5_DIACI | 192 | (K)VGILYPTNAFPVNSFPDFPVGNLILPQDMSLSK(I) (R)SNNEIDLDMELVIDKFKALQTQMK(T) | 0.96 | Gene expression regulation |
Endochitinase LOC103505867 GH18 family | A0A3Q0IKI3_DIACI | 68 | (R)GNWAGFADVHSPLYK(R) (R)SFTLSSGNNNYNIGTYINK(E) (K)MSVCDWPEKVDVTR(C) | 8.00 | Glycosyl hydrolases |
LOW QUALITY PROTEIN myosin-II-like LOC103524911 | A0A3Q0IIF7_DIACI | 151 | (R)SDSLTNVLNTTSSLNSSSLSNRSLNSSGLSNR(S) (R)ITRVTNDAPIMEVNSNSLGR(R) | 3.91 | Gene expression regulation |
Epoxide hydrolase 4-like LOC103509850 | A0A1S3D296_DIACI | 46 | (K)VKDERENAPTCLVDNSFGQHLYVK(L) (K)QVNQQTGLVGKMYGAVSNTVK(Y) (K)QVNQQTGLVGKMYGAVSNTVKYGNHYK(M) | 12.80 | Hydrolase activity |
Dynein heavy chain 2, axonemal-like LOC103509704 | A0A3Q0IU47_DIACI | 538 | (K)SETVKDLGKCMAYLVVITNCSDSLDYK(S) (K)DLGKCMAYLVVITNCSDSLDYKSLAR(M) (K)VIVEQMKVEMEENQVLVENYKK(E) | 1.14 | Microtubule-based movement |
Odorant binding protein 1 | A0A2Z2GYV0_DIACI | 16 | (K)CKTELNSPPEAVALLGAK(S) (K)TELNSPPEAVALLGAK(S) | 12.20 | Odorant binding |
Voltage-dependent calcium channel VWA domain LOC103507125 | A0A1S4E906_DIACI | 88 | (K)EGKLMVSVSTPVFDK(R) (K)LERHSHFCDKSLVQSLVFDAMVTEGLEHPSAAYLK(G) | 6.54 | Homeostasis |
Cuticle protein 7-like LOC103507855 | A0A1S3CYX2_DIACI | 15 | (K)YDFAYDVADSYTGDIK(S) (R)DGDYVSGYYSLVEADGSK(R) (R)IVEYTADGYNGFNAVVK(K) | 36.70 | Protection |
Carboxypeptidase D-likeLOC103513394 | A0A3Q0J1P3_DIACI | 145 | (K)FLVAAAQQNPSK(V) (R)DLWALQISR(N) (R)SVMKVDSIVK(G) | 2.38 | Carboxypeptidaseactivity |
Vegetative cell wall protein gp1-like LOC113466980 | A0A3Q0IQY0_DIACI | 52 | (R)IDNDALQSMAAANINAEEVKATGVELLNK(G) (R)QRKPRSAPSNSPGGSNVR(G) | 9.61 | Structure |
Protein obstructor-E-like LOC103517319 | A0A1S3DGK4_DIACI | 27 | (K)NSYYPDSIQCDLYYHCSDGQLVEEK(L) (R)CDTNVNVECGER(T) | 15.00 | Chitin-binding |
Wiskott-Aldrich syndrome protein family member 2 LOC103507255 | A0A3Q0INT8_DIACI | 22 | (K)CITTAEYNPQCGTDGQDYSNPGR(V) (K)VVEIEFPGVCK(S) | 15.70 | Protease inhibitor |
Alpha-mannosidase LOC103513787 | A0A3Q0J7L7_DIACI | 120 | (R)EQASLFSQMGYDGFMFGR(Q) (R)SSGAYIFR(N) | 2.46 | Glycosidase activity |
Glutamic acid-rich protein LOC103510883 | A0A1S4EDL9_DIACI | 101 | (K)EKGNDSQSSLTRK(G) (K)SQNKRESAEILEK(E) | 2.88 | Other |
Aminopeptidase LOC103519822 | A0A3Q0JIL4_DIACI | 92 | (K)EIMDSWTLQTGYPIVDVTR(E) (K)KENGEIELNSRDEKPIVSGGGGSGNTR(N) | 5.75 | Aminopeptidase activity |
Leucine-rich repeats and immunoglobulin-like domains protein 1 LOC103522720 | A0A1S3DQ23_DIACI | 60 | (K)TQCQIFGLNSTLRIYLEGNPVLCDDSMR(A) (R)IYLEGNPVLCDDSMRAVIDAMETINNNTK(I) | 7.89 | Immune response |
Apoptosis-inducing factor 1, mitochondrial LOC103519937 | A0A1S4ENS9_DIACI | 81 | (R)SSAAQEESTKTTAVTK(V) (R)RVEHHDHAVVSGRLAGENMTGAHK(H) | 5.45 | Oxyreductase activity |
Ecotropic viral integration site 5 ortholog-like LOC103504936 | A0A3Q0IJ13_DIACI | 81 | (R)HLRSLVEANHNSCQSSMDEASLSK(E) (R)LKVIEVETRADDVNPDK(K) | 5.86 | GTPase-activity |
Ubiquilin-1 LOC103506324 | A0A3Q0ILW3_DIACI | 39 | (R)ALSNLESIPGGYSALQR(M) (R)DIQEPMLNAATQQFSR(N) | 9.35 | Cellular processes |
RNA polymerase-associated protein CTR9 homolog LOC103509140 | A0A3Q0ISU5_DIACI | 158 | (K)EEYFLKANTLYTTGDK(I) (K)AQPGNYETMKILGSLYANSSSQSKR(D) | 2.95 | Cellular processes |
Chitooligosaccharidolytic beta-N- acetylglucosaminidase-like LOC103512791 | A0A3Q0J0G8_DIACI | 38 | (K)LLDQTSLNISNNPELK(S) (K)SLIMGQEAALWSEQADAATLDGR(L) | 11.70 | Hydrolase activity |
Protein BTG2-like LOC103513815 | A0A3Q0J2K8_DIACI | 24 | (-)MQDQISAAVLFLAK(L) (K)KDTILENAAKAVGMSYEDMR(L) | 16.30 | Other |
Zinc finger homeobox protein 3-like LOC113472870 | A0A3Q0JJ91_DIACI | 85 | (R)LLMLVDQSHWLNTVSRPSNANQQSSSESSSASKHEK(S) (K)KMIQDILTGSSAVQK(S) | 6.86 | Nucleic acid-binding protein |
Alpha-galactosidase LOC103508314 | A0A1S4EAR0_DIACI | 17 | (R)CNTDCDNYPDECISENLFK(R) (R)CNTDCDNYPDECISENLFKR(M) | 13.70 | Hydrolase activity |
Uncharacterized protein LOC103507240 | A0A1S3CXQ3_DIACI | 16 | (R)DFPGMCFASTK(C) (R)LLELVEDCGPLPK(A) (K)TAPFPDCCPTFECEPGVK(L) | 43.40 | Environmental challenges |
Uncharacterized protein LOC103519250 | A0A1S3DJY7_DIACI | 44 | (K)NESSNGSTVNSPVAQAKPK(G) (K)GLAVAGEGGVADSSPSGTALVGK(K) | 10.30 | Uncharacterized |
Uncharacterized protein LOC103508449 | A0A1S3CZS7_DIACI | 15 | (R)RNLPNAYNLCEPETQVCTR(Y) (R)NLPNAYNLCEPETQVCTR(Y) (K)QATAICGPSYVDKLVDFK(T) | 27.60 | Uncharacterized |
Uncharacterized protein LOC103512175 | A0A1S4EEU2_DIACI | 38 | (R)GSYSYVAPDGTPIK(V) (R)GSYSYVAPDGTPIKVVYTSGR(E) | 5.80 | Structure |
Uncharacterized protein LOC113467831 | A0A3Q0IZD8_DIACI | 10 | (K)FAQDCDADGQIDCR(D) (R)LGGYGCNAPLDATYLAR(F) | 33.00 | Immune response |
Uncharacterized protein LOC103507653 | A0A1S3CZP5_DIACI | 56 | (K)GNQVNGVRENEDLIDVTSNHVNK(L) (R)AQMIYLQTELASAQNSGILPFDDSAK(N) | 9.92 | Uncharacterized |
Uncharacterized protein LOC103513825 | A0A1S3D966_DIACI | 11 | (R)QAQNTQLIPQGAEIQKVQEGIELAAFESIPGNQR(I) (K)VQEGIELAAFESIPGNQR(I) | 34.00 | Uncharacterized |
Uncharacterized protein LOC103518044 | A0A3Q0JFF5_DIACI | 428 | (R)AIGQDCTVTK(S) (R)QESIQGFCCPR(Y) (K)QLGCLVEGQTYMVGEK(V) | 0.91 | Homeostasis VWFC domain |
Uncharacterized protein LOC103505974 | A0A3Q0IQQ7_DIACI | 91 | (K)DTEVDRVQK(S) (K)QLDQAAKEIEELKSENQIMK(R) | 3.64 | Peptidase activity |
Uncharacterized protein LOC103513107 | A0A1S3D7M4_DIACI | 136 | (K)VDNSPNRTQYGELLK(T) (R)QNTINIAKLGGIESPEKDELK(N) | 3.00 | Uncharacterized |
Uncharacterized protein LOC113468219 | A0A3Q0IX19_DIACI) | 113 | (K)CVKTTKMLPGGQK(K) (K)FKSRGLLGDNGFQSGGLLDDK(D) | 3.43 | Uncharacterized |
Uncharacterized protein LOC103506631 | A0A3Q0ISV1_DIACI | 30 | (K)IVTSTGGLPPQFVNPK(S) (R)SQVCIAHGPYAAIPGINEWCETNCLR(F) | 15.60 | Uncharacterized |
Uncharacterized protein LOC103512422 | A0A1S3D6F7_DIACI | 22 | (R)SLEVDWLDAR(N) (R)NTGDWSATGGFGQAQPDNR(E) | 14.70 | Calcium-dependent carbohydrate-recognition domain |
Uncharacterized protein LOC103516159 | A0A1S3DEF2_DIACI | 12 | (K)EVTQLASSIAPFSDPTICDDPFKCDEDTIIPDTICGK(L) (K)LYTTAGNGLR(I) | 43.90 | Uncharacterized |
Uncharacterized protein LOC103516900 | A0A1S3DFS2_DIACI | 51 | (K)DVEFVCPDEGGNGNYADPSTCR(R) (K)SETAPLEACNLPNK(C) | 7.95 | Chitin binding |
Uncharacterized protein LOC103519755 | A0A1S3DJA9_DIACI | 36 | (K)VAKPSYVVQEQVIPVQKPAYVIEEAVEK(V) (K)VTKPAFVVETIVETVPVPEFK(L) | 14.90 | Uncharacterized |
Uncharacterized protein LOC103506731 | A0A3Q0ISB2_DIACI | 21 | (R)SIGLQLTSFESR(E) (K)SDSITQYLTNAGYNK(Y) | 14.60 | Calcium-dependent carbohydrate-recognition domain |
Uncharacterized protein LOC103509128 | A0A3Q0IST9_DIACI | 233 | (R)STDGKNQRPSALPSAMAPNKLDSDR(R) (R)QIHVMLHAFIREGGAVLQMQQESR(L) | 2.34 | Actin binding |
Uncharacterized protein LOC103509950 | A0A3Q0IUI2_DIACI | 86 | (K)SDFVQNDGSAGKFGAGDSRSK(D) (R)TPLERTSASGASQSPMSINKATNINR(M) | 5.84 | Uncharacterized |
Uncharacterized protein LOC103512184 | A0A3Q0J4A1_DIACI | 149 | (K)NQVMYKPDIPSGGSLSSLPIYAEVNK(K) (K)VKDIDQLSTTSNNSNINVFIVNKR(S) | 3.72 | Uncharacterized |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Santos-Ortega, Y.; Killiny, N. The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects 2021, 12, 959. https://doi.org/10.3390/insects12110959
Santos-Ortega Y, Killiny N. The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects. 2021; 12(11):959. https://doi.org/10.3390/insects12110959
Chicago/Turabian StyleSantos-Ortega, Yulica, and Nabil Killiny. 2021. "The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus" Insects 12, no. 11: 959. https://doi.org/10.3390/insects12110959
APA StyleSantos-Ortega, Y., & Killiny, N. (2021). The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects, 12(11), 959. https://doi.org/10.3390/insects12110959