Of Seven New K+ Channel Inhibitor Peptides of Centruroides bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2
Abstract
:1. Introduction
2. Results
2.1. Isolation and Sequence Determination of CboK Peptides
2.2. Phylogenetic and Sequence Analysis of C. bonito KTx Toxins
2.3. Pharmacological Characterization of CboK Peptides
2.4. CboK Peptides Inhibit Kv1.2 with Picomolar Affinity
2.5. CboK Peptides Display Nanomolar Affinity for Kv1.3
3. Discussion
4. Conclusions
5. Materials and Methods
5.1. Venom Source and Purification Procedure
5.2. Mass Spectrometry and Sequence Determination
5.3. Phylogenetic Analysis and Systematic Name Assignment of New Scorpion Toxins
5.4. Isolation and Activation of PBMCs
5.5. Heterologous Expression of Kv1.1 and Kv1.2 Channels in CHO Cells
5.6. Electrophysiology
5.7. Statistics
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Wulff, H.; Castle, N.A.; Pardo, L.A. Voltage-gated potassium channels as therapeutic targets. Nat. Rev. Drug Discov. 2009, 8, 982–1001. [Google Scholar]
- Gutman, G.A.; Chandy, K.G.; Grissmer, S.; Lazdunski, M.; Mckinnon, D.; Pardo, L.A.; Robertson, G.A.; Rudy, B.; Sanguinetti, M.C.; Stühmer, W. International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels. Pharmacol. Rev. 2005, 57, 473–508. [Google Scholar] [CrossRef]
- Wei, A.D.; Gutman, G.A.; Aldrich, R.; Chandy, K.G.; Grissmer, S.; Wulff, H. International Union of Pharmacology. LII. Nomenclature and molecular relationships of calcium-activated potassium channels. Pharmacol. Rev. 2005, 57, 463–472. [Google Scholar] [CrossRef]
- Cahalan, M.D.; Chandy, K.G. The functional network of ion channels in T lymphocytes. Immunol. Rev. 2009, 231, 59–87. [Google Scholar] [CrossRef] [PubMed]
- Hofschröer, V.; Najder, K.; Rugi, M.; Bouazzi, R.; Cozzolino, M.; Arcangeli, A.; Panyi, G.; Schwab, A. Ion channels orchestrate pancreatic ductal adenocarcinoma progression and therapy. Front. Pharmacol. 2021, 11, 586599. [Google Scholar] [CrossRef]
- Corzo, G.; Papp, F.; Varga, Z.; Barraza, O.; Espino-Solis, P.G.; de la Vega, R.C.R.; Gaspar, R.; Panyi, G.; Possani, L.D. A selective blocker of Kv1. 2 and Kv1. 3 potassium channels from the venom of the scorpion Centruroides suffusus suffusus. Biochem. Pharmacol. 2008, 76, 1142–1154. [Google Scholar] [PubMed]
- Syrbe, S.; Hedrich, U.; Riesch, E.; Djémié, T.; Müller, S.; Møller, R.S.; Maher, B.; Hernandez-Hernandez, L.; Synofzik, M.; Caglayan, H.S. De novo loss-or gain-of-function mutations in KCNA2 cause epileptic encephalopathy. Nat. Genet. 2015, 47, 393–399. [Google Scholar] [CrossRef]
- Masnada, S.; Hedrich, U.B.; Gardella, E.; Schubert, J.; Kaiwar, C.; Klee, E.W.; Lanpher, B.C.; Gavrilova, R.H.; Synofzik, M.; Bast, T. Clinical spectrum and genotype–phenotype associations of KCNA2-related encephalopathies. Brain 2017, 140, 2337–2354. [Google Scholar]
- Corbett, M.A.; Bellows, S.T.; Li, M.; Carroll, R.; Micallef, S.; Carvill, G.L.; Myers, C.T.; Howell, K.B.; Maljevic, S.; Lerche, H. Dominant KCNA2 mutation causes episodic ataxia and pharmacoresponsive epilepsy. Neurology 2016, 87, 1975–1984. [Google Scholar] [CrossRef]
- Allen, N.M.; Conroy, J.; Shahwan, A.; Lynch, B.; Correa, R.G.; Pena, S.D.; McCreary, D.; Magalhães, T.R.; Ennis, S.; Lynch, S.A. Unexplained early onset epileptic encephalopathy: Exome screening and phenotype expansion. Epilepsia 2016, 57, e12–e17. [Google Scholar] [CrossRef] [PubMed]
- Canafoglia, L.; Castellotti, B.; Ragona, F.; Freri, E.; Granata, T.; Chiapparini, L.; Gellera, C.; Scaioli, V.; Franceschetti, S.; DiFrancesco, J.C. Progressive myoclonus epilepsy caused by a gain-of-function KCNA2 mutation. Seizure 2019, 65, 106–108. [Google Scholar] [CrossRef] [PubMed]
- Pena, S.; Coimbra, R. Ataxia and myoclonic epilepsy due to a heterozygous new mutation in KCNA2: Proposal for a new channelopathy. Clin. Genet. 2015, 87, e1–e3. [Google Scholar] [CrossRef]
- Hedrich, U.B.; Lauxmann, S.; Wolff, M.; Synofzik, M.; Bast, T.; Binelli, A.; Serratosa, J.M.; Martínez-Ulloa, P.; Allen, N.M.; King, M.D. 4-Aminopyridine is a promising treatment option for patients with gain-of-function KCNA2-encephalopathy. Sci. Transl. Med. 2021, 13, eaaz4957. [Google Scholar] [CrossRef]
- Chi, V.; Pennington, M.W.; Norton, R.S.; Tarcha, E.J.; Londono, L.M.; Sims-Fahey, B.; Upadhyay, S.K.; Lakey, J.T.; Iadonato, S.; Wulff, H. Development of a sea anemone toxin as an immunomodulator for therapy of autoimmune diseases. Toxicon 2012, 59, 529–546. [Google Scholar] [CrossRef]
- Norton, R.S.; Chandy, K.G. Venom-derived peptide inhibitors of voltage-gated potassium channels. Neuropharmacology 2017, 127, 124–138. [Google Scholar] [CrossRef]
- Zhao, Y.; Huang, J.; Yuan, X.; Peng, B.; Liu, W.; Han, S.; He, X. Toxins targeting the Kv1. 3 channel: Potential immunomodulators for autoimmune diseases. Toxins 2015, 7, 1749–1764. [Google Scholar] [CrossRef] [PubMed]
- Teisseyre, A.; Palko-Labuz, A.; Sroda-Pomianek, K.; Michalak, K. Voltage-gated potassium channel Kv1. 3 as a target in therapy of cancer. Front. Oncol. 2019, 9, 933. [Google Scholar] [CrossRef] [PubMed]
- Fomina, A.F.; Nguyen, H.M.; Wulff, H. Kv1. 3 inhibition attenuates neuroinflammation through disruption of microglial calcium signaling. Channels 2021, 15, 67–78. [Google Scholar] [CrossRef]
- Sarkar, S.; Nguyen, H.M.; Malovic, E.; Luo, J.; Langley, M.; Palanisamy, B.N.; Singh, N.; Manne, S.; Neal, M.; Gabrielle, M. Kv1. 3 modulates neuroinflammation and neurodegeneration in Parkinson’s disease. J. Clin. Investig. 2020, 130, 4195–4212. [Google Scholar]
- Chen, Z.-Y.; Zeng, D.-Y.; Hu, Y.-T.; He, Y.-W.; Pan, N.; Ding, J.-P.; Cao, Z.-J.; Liu, M.-L.; Li, W.-X.; Yi, H. Structural and functional diversity of acidic scorpion potassium channel toxins. PLoS ONE 2012, 7, e35154. [Google Scholar] [CrossRef]
- Mouhat, S.; Andreotti, N.; Jouirou, B.; Sabatier, J.-M. Animal toxins acting on voltage-gated potassium channels. Curr. Pharm. Des. 2008, 14, 2503–2518. [Google Scholar] [CrossRef]
- Tabakmakher, V.M.; Krylov, N.A.; Kuzmenkov, A.I.; Efremov, R.G.; Vassilevski, A.A. Kalium 2.0, a comprehensive database of polypeptide ligands of potassium channels. Sci. Data 2019, 6, 73. [Google Scholar] [CrossRef]
- Saucedo, A.L.; Flores-Solis, D.; de la Vega, R.C.R.; Ramírez-Cordero, B.; Hernández-López, R.; Cano-Sánchez, P.; Navarro, R.N.; García-Valdés, J.; Coronas-Valderrama, F.; de Roodt, A. New tricks of an old pattern: Structural versatility of scorpion toxins with common cysteine spacing. J. Biol. Chem. 2012, 287, 12321–12330. [Google Scholar] [CrossRef]
- Dauplais, M.; Lecoq, A.; Song, J.; Cotton, J.; Jamin, N.; Gilquin, B.; Roumestand, C.; Vita, C.; de Medeiros, C.C.; Rowan, E.G. On the convergent evolution of animal toxins: Conservation of a diad of functional residues in potassium channel-blocking toxins with unrelated structures. J. Biol. Chem. 1997, 272, 4302–4309. [Google Scholar] [CrossRef] [PubMed]
- Banerjee, A.; Lee, A.; Campbell, E.; MacKinnon, R. Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K+ channel. Elife 2013, 2, e00594. [Google Scholar] [CrossRef]
- Selvakumar, P.; Fernández-Mariño, A.I.; Khanra, N.; He, C.; Paquette, A.J.; Wang, B.; Huang, R.; Smider, V.V.; Rice, W.J.; Swartz, K.J. Structures of the T cell potassium channel Kv1. 3 with immunoglobulin modulators. Nat. Commun. 2022, 13, 3854. [Google Scholar] [CrossRef] [PubMed]
- Goldstein, S.; Miller, C. Mechanism of charybdotoxin block of a voltage-gated K+ channel. Biophys. J. 1993, 65, 1613–1619. [Google Scholar] [CrossRef]
- Santibáñez-López, C.E.; Francke, O.F.; Ureta, C.; Possani, L.D. Scorpions from Mexico: From species diversity to venom complexity. Toxins 2015, 8, 2. [Google Scholar] [CrossRef]
- González-Santillán, E.; Possani, L.D. North American scorpion species of public health importance with a reappraisal of historical epidemiology. Acta Trop. 2018, 187, 264–274. [Google Scholar] [CrossRef] [PubMed]
- Ravell, A.F.Q.; Teruel, R.; Saavedra, J.P. A new Centruroides Marx, 1890 (Scorpiones: Buthidae), from southern Guerrero State, Mexico. Rev. Ibérica De Aracnol. 2016, 28, 25–34. [Google Scholar]
- King, G.F.; Gentz, M.C.; Escoubas, P.; Nicholson, G.M. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon 2008, 52, 264–276. [Google Scholar] [CrossRef]
- Selisko, B.; Garcia, C.; Becerril, B.; Gómez-Lagunas, F.; Garay, C.; Possani, L.D. Cobatoxins 1 and 2 from Centruroides noxius Hoffmann constitute a subfamily of potassium-channel-blocking scorpion toxins. Eur. J. Biochem. 1998, 254, 468–479. [Google Scholar] [CrossRef] [PubMed]
- Olamendi-Portugal, T.; Bartok, A.; Zamudio-Zuñiga, F.; Balajthy, A.; Becerril, B.; Panyi, G.; Possani, L.D. Isolation, chemical and functional characterization of several new K+-channel blocking peptides from the venom of the scorpion Centruroides tecomanus. Toxicon 2016, 115, 1–12. [Google Scholar] [CrossRef]
- Olamendi-Portugal, T.; Somodi, S.; Fernández, J.A.; Zamudio, F.Z.; Becerril, B.; Varga, Z.; Panyi, G.; Gáspár, R.; Possani, L.D. Novel α-KTx peptides from the venom of the scorpion Centruroides elegans selectively blockade Kv1. 3 over IKCa1 K+ channels of T cells. Toxicon 2005, 46, 418–429. [Google Scholar] [CrossRef]
- Martin, B.; Ramirez, A.; Gurrola, G.; Nobile, M.; Prestipino, G.; Possani, L. Novel K+-channel-blocking toxins from the venom of the scorpion Centruroides limpidus limpidus Karsch. Biochem. J. 1994, 304, 51–56. [Google Scholar] [CrossRef] [PubMed]
- Carbone, E.; Wanke, E.; Prestipino, G.; Possani, L.D.; Maelicke, A. Selective blockage of voltage-dependent K+ channels by a novel scorpion toxin. Nature 1982, 296, 90–91. [Google Scholar] [CrossRef] [PubMed]
- Possani, L.D.; Martin, B.M.; Svendsen, I. The primary structure of noxiustoxin: AK+ channel blocking peptide, purified from the venom of the scorpion centruroides noxius hoffmann. Carlsberg Res. Commun. 1982, 47, 285–289. [Google Scholar] [CrossRef]
- Rezazadeh, S.; Kurata, H.T.; Claydon, T.W.; Kehl, S.J.; Fedida, D. An activation gating switch in Kv1. 2 is localized to a threonine residue in the S2-S3 linker. Biophys. J. 2007, 93, 4173–4186. [Google Scholar] [CrossRef]
- MacKinnon, R.; Miller, C. Mechanism of charybdotoxin block of the high-conductance, Ca2+-activated K+ channel. J. Gen. Physiol. 1988, 91, 335–349. [Google Scholar] [CrossRef]
- Jouirou, B.; Mosbah, A.; Visan, V.; Grissmer, S.; M’Barek, S.; Fajloun, Z.; Van Rietschoten, J.; Devaux, C.; Rochat, H.; Lippens, G.; et al. Cobatoxin 1 from Centruroides noxius scorpion venom: Chemical synthesis, three-dimensional structure in solution, pharmacology and docking on K+ channels. Biochem J 2004, 377, 37–49. [Google Scholar] [CrossRef]
- Luna-Ramirez, K.; Csoti, A.; McArthur, J.R.; Chin, Y.K.; Anangi, R.; del Carmen Najera, R.; Possani, L.D.; King, G.F.; Panyi, G.; Yu, H. Structural basis of the potency and selectivity of Urotoxin, a potent Kv1 blocker from scorpion venom. Biochem. Pharmacol. 2020, 174, 113782. [Google Scholar] [CrossRef]
- Bartok, A.; Toth, A.; Somodi, S.; Szanto, T.G.; Hajdu, P.; Panyi, G.; Varga, Z. Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon 2014, 87, 6–16. [Google Scholar] [CrossRef] [PubMed]
- Gubič, Š.; Hendrickx, L.A.; Toplak, Ž.; Sterle, M.; Peigneur, S.; Tomašič, T.; Pardo, L.A.; Tytgat, J.; Zega, A.; Mašič, L.P. Discovery of Kv1. 3 ion channel inhibitors: Medicinal chemistry approaches and challenges. Med. Res. Rev. 2021, 41, 2423–2473. [Google Scholar] [CrossRef] [PubMed]
- Naseem, M.U.; Gurrola-Briones, G.; Romero-Imbachi, M.R.; Borrego, J.; Carcamo-Noriega, E.; Beltrán-Vidal, J.; Zamudio, F.Z.; Shakeel, K.; Possani, L.D.; Panyi, G. Characterization and Chemical Synthesis of Cm39 (α-KTx 4.8): A Scorpion Toxin That Inhibits Voltage-Gated K+ Channel KV1. 2 and Small-and Intermediate-Conductance Ca2+-Activated K+ Channels KCa2. 2 and KCa3. 1. Toxins 2023, 15, 41. [Google Scholar] [CrossRef]
- Castle, N.; London, D.; Creech, C.; Fajloun, Z.; Stocker, J.; Sabatier, J.-M. Maurotoxin: A potent inhibitor of intermediate conductance Ca2+-activated potassium channels. Mol. Pharmacol. 2003, 63, 409–418. [Google Scholar] [CrossRef]
- Kharrat, R.; Mansuelle, P.; Sampieri, F.; Crest, M.; Oughideni, R.; Van Rietschoten, J.; Martin-Eauclaire, M.; Rochat, H.; El Ayeb, M. Maurotoxin, a four disulfide bridge toxin from Scorpio maurus venom: Purification, structure and action on potassium channels. FEBS Lett. 1997, 406, 284–290. [Google Scholar] [CrossRef]
- M’Barek, S.; Mosbah, A.; Sandoz, G.; Fajloun, Z.; Olamendi-Portugal, T.; Rochat, H.; Sampieri, F.; Guijarro, J.I.; Mansuelle, P.; Delepierre, M. Synthesis and characterization of Pi4, a scorpion toxin from Pandinus imperator that acts on K+ channels. Eur. J. Biochem. 2003, 270, 3583–3592. [Google Scholar] [CrossRef]
- Olamendi-Portugal, T.; Gómez-Lagunas, F.; Gurrola, G.B.; Possani, L.D. Two similar peptides from the venom of the scorpion Pandinus imperator, one highly effective blocker and the other inactive on K+ channels. Toxicon 1998, 36, 759–770. [Google Scholar] [CrossRef] [PubMed]
- Bagdáany, M.; Batista, C.V.; Valdez-Cruz, N.A.; Somodi, S.; de la Vega, R.C.R.; Licea, A.F.; Varga, Z.; Gáspár, R.; Possani, L.D.; Panyi, G. Anuroctoxin, a new scorpion toxin of the α-KTx 6 subfamily, is highly selective for Kv1. 3 over IKCa1 ion channels of human T lymphocytes. Mol. Pharmacol. 2005, 67, 1034–1044. [Google Scholar] [CrossRef]
- Pandit, R.; Chen, L.; Götz, J. The blood-brain barrier: Physiology and strategies for drug delivery. Adv. Drug Deliv. Rev. 2020, 165, 1–14. [Google Scholar] [CrossRef] [PubMed]
- Demeule, M.; Regina, A.; Che, C.; Poirier, J.; Nguyen, T.; Gabathuler, R.; Castaigne, J.-P.; Beliveau, R. Identification and design of peptides as a new drug delivery system for the brain. J. Pharmacol. Exp. Ther. 2008, 324, 1064–1072. [Google Scholar] [CrossRef] [PubMed]
- Thom, G.; Tian, M.-M.; Hatcher, J.P.; Rodrigo, N.; Burrell, M.; Gurrell, I.; Vitalis, T.Z.; Abraham, T.; Jefferies, W.A.; Webster, C.I. A peptide derived from melanotransferrin delivers a protein-based interleukin 1 receptor antagonist across the BBB and ameliorates neuropathic pain in a preclinical model. J. Cereb. Blood Flow Metab. 2019, 39, 2074–2088. [Google Scholar] [CrossRef] [PubMed]
- Teleanu, R.I.; Preda, M.D.; Niculescu, A.-G.; Vladâcenco, O.; Radu, C.I.; Grumezescu, A.M.; Teleanu, D.M. Current strategies to enhance delivery of drugs across the blood–brain barrier. Pharmaceutics 2022, 14, 987. [Google Scholar] [CrossRef] [PubMed]
- Camacho, C.; Coulouris, G.; Avagyan, V.; Ma, N.; Papadopoulos, J.; Bealer, K.; Madden, T.L. BLAST+: Architecture and applications. BMC Bioinform. 2009, 10, 421. [Google Scholar] [CrossRef]
- Katoh, K.; Standley, D.M. MAFFT multiple sequence alignment software version 7: Improvements in performance and usability. Mol. Biol. Evol. 2013, 30, 772–780. [Google Scholar] [CrossRef]
- Ronquist, F.; Teslenko, M.; Van Der Mark, P.; Ayres, D.L.; Darling, A.; Höhna, S.; Larget, B.; Liu, L.; Suchard, M.A.; Huelsenbeck, J.P. MrBayes 3.2: Efficient Bayesian phylogenetic inference and model choice across a large model space. Syst. Biol. 2012, 61, 539–542. [Google Scholar] [CrossRef]
- Kalyaanamoorthy, S.; Minh, B.Q.; Wong, T.K.; Von Haeseler, A.; Jermiin, L.S. ModelFinder: Fast model selection for accurate phylogenetic estimates. Nat. Methods 2017, 14, 587–589. [Google Scholar] [CrossRef]
- Whelan, S.; Goldman, N. A general empirical model of protein evolution derived from multiple protein families using a maximum-likelihood approach. Mol. Biol. Evol. 2001, 18, 691–699. [Google Scholar] [CrossRef]
- Miller, C. The charybdotoxin family of K+ channel-blocking peptides. Neuron 1995, 15, 5–10. [Google Scholar] [CrossRef]
- Hamill, O.P.; Marty, A.; Neher, E.; Sakmann, B.; Sigworth, F.J. Improved patch-clamp techniques for high-resolution current recording from cells and cell-free membrane patches. Pflügers Arch. 1981, 391, 85–100. [Google Scholar] [CrossRef]
Peptide Name | Retention Time (min) | Amino Acid Sequence | Length | MW (Da) |
---|---|---|---|---|
CboK1 | 18.4 | NVACVHRTCDSNCKRNGYKSGKCINRKCNCYPH | 33 | 3765.1 |
CboK2 | 20.9 | TVCVYRTCDKDCKRRGYRSGKCINNACKCYPY | 32 | 3760.4 |
CboK3 | 21.7 | TIINVKCTSPKQCLKPCKDLYGPHAGEKCMNGKCKCYKV | 39 | 4323.5 |
CboK4 | 22.3 | TFINVKCTSPKQCLKPCKDLYGPHAGEKCMNGKCKCYKP | 39 | 4357.9 |
CboK5 | 22.9 | IFINVKCSLPQQCLRPCKDRFGQHAGGKCINGKCKCYP | 38 | 4249.8 |
CboK6 | 23.2 | TTINVKCSLPQQCLRPCKDRFGQHAGGKCINGKCKCYP | 38 | 4191.3 |
CboK7 | 25.3 | TFINVKCTSPKQCLKPCKDLYGPHAGEKCMNGKCKCYKV | 39 | 4298.5 |
Toxin Name | Accession Number | Systematic Name | Sequence | % Identity | Kd Values | ||
---|---|---|---|---|---|---|---|
Kv1.1 | Kv1.2 | Kv1.3 | |||||
A | |||||||
CboK1 | C0HM73 | α-KTx 10.5 | NVACVHRTCDSNCKRNGYKSGKCINRKCNCYPH- | 100% | * | * | * |
Cotx1 | O46028 | α-KTx 10.1 | -AV..Y....KD...R..R......NA.K...Y- | 68% | 24.4 µM | 27 nM | 5.3 µM |
II-10.4 | C0HJW2 | α-KTx 10.4 | -AV..Y....KD...R..R......NA.K...YA | 66% | * | 3.6 nM | 72 nM |
B | |||||||
CboK2 | C0HM75 | α-KTx 10.6 | TVCVYRTCDKDCKRRGYRSGKCINNACKCYPY- | 100% | * | 760 pM | 171 nM |
Cotx1 | O46028 | α-KTx 10.1 | A...............................- | 97% | 24.4 µM | 27 nM | 5.3 µM |
II-10.4 | C0HJW2 | α-KTx 10.4 | A...............................A | 94% | * | 3.6 nM | 72 nM |
CoTx2 | P58504 | α-KTx 10.2 | VA..........TS.K................- | 84% | 1 µM | * | * |
C | |||||||
CboK3 | C0HM77 | α-KTx 2.22 | TIINVKCTSPKQCLKPCKDLYGPHAGEKCMNGKCKCYKV | 100% | 1 µM | 106 pM | 34.3 nM |
CboK4 | C0HM72 | α-KTx 2.23 | .F....................................P | 95% | 1.5 µM | 125 pM | 21.7 nM |
CboK7 | C0HM78 | α-KTx 2.24 | .F..................................... | 97% | 141 nM | 24 pM | 20.4 nM |
II-12.5 | C0HJW6 | α-KTx 2.16 | ......................................I | 97% | * | 700 pM | 26.2 nM |
Ce4 | P0C164 | α-KTx 2.11 | ..............L...EI..I...A...........I | 85% | ND | ND | 0.98 nM |
II-12.8 | C0HJW5 | α-KTx 2.17 | ..............L...QI......A.......H.S.I | 82% | 4.8 nM | 2.9 nM | * |
D | |||||||
CboK5 | C0HM74 | α-KTx 2.10 | IFINVKCSLPQQCLRPCKDRFGQHAGGKCINGKCKCYP | 100% | * | 376 pM | 126 nM |
Ce3 | P0C163 | α-KTx 2.10 | ...................................... | 100% | ND | ND | 366 nM |
E | |||||||
CboK6 | C0HM76 | α-KTx 2.21 | TTINVKCSLPQQCLRPCKDRFGQHAGGKCINGKCKCYP | 100% | * | 585 pM | 160 nM |
Ce3 | P0C163 | α-KTx 2.10 | IF.................................... | 95% | ND | * | 366 nM |
II-10.9 | P45629 | α-KTx 2.3 | I......TS............................. | 92% | * | * | * |
II-10.5 | C0HJW1 | α-KTx 2.15 | IF......S.....K...KA.................. | 84% | * | 300 pM | 8.3 nM |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Shakeel, K.; Olamendi-Portugal, T.; Naseem, M.U.; Becerril, B.; Zamudio, F.Z.; Delgado-Prudencio, G.; Possani, L.D.; Panyi, G. Of Seven New K+ Channel Inhibitor Peptides of Centruroides bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2. Toxins 2023, 15, 506. https://doi.org/10.3390/toxins15080506
Shakeel K, Olamendi-Portugal T, Naseem MU, Becerril B, Zamudio FZ, Delgado-Prudencio G, Possani LD, Panyi G. Of Seven New K+ Channel Inhibitor Peptides of Centruroides bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2. Toxins. 2023; 15(8):506. https://doi.org/10.3390/toxins15080506
Chicago/Turabian StyleShakeel, Kashmala, Timoteo Olamendi-Portugal, Muhammad Umair Naseem, Baltazar Becerril, Fernando Z. Zamudio, Gustavo Delgado-Prudencio, Lourival Domingos Possani, and Gyorgy Panyi. 2023. "Of Seven New K+ Channel Inhibitor Peptides of Centruroides bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2" Toxins 15, no. 8: 506. https://doi.org/10.3390/toxins15080506
APA StyleShakeel, K., Olamendi-Portugal, T., Naseem, M. U., Becerril, B., Zamudio, F. Z., Delgado-Prudencio, G., Possani, L. D., & Panyi, G. (2023). Of Seven New K+ Channel Inhibitor Peptides of Centruroides bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2. Toxins, 15(8), 506. https://doi.org/10.3390/toxins15080506