Peptide Aptamer–Paclitaxel Conjugates for Tumor Targeted Therapy
Abstract
1. Introduction
2. Multi-Functional Linkers in PAPCs
3. Multi-Functional Peptide Aptamers in PAPCs
3.1. Membrane Receptors Targeting Peptide Aptamers
3.1.1. Low-Density Lipoprotein Receptor-Related Protein-1 (LRP-1)
3.1.2. Integrin
3.1.3. Neuropilin-1
3.1.4. Epidermal Growth Factor Receptor (EGFR)
3.1.5. Transferrin Receptor (TfR)
3.1.6. Somatostatin Receptor Type 2 (SSTR2)
3.1.7. Acetylcholine Receptor (AChR)
3.1.8. Luteinizing Hormone-Releasing Hormone Receptor (LHRH-R)
3.1.9. Gastrin-Releasing Peptide Receptor (GRPR)
3.1.10. Glucose-Regulated Protein 78 (GRP78)
3.1.11. Nucleolin (NCL)
3.2. Cell Adhesion Molecules and Extracellular Matrix Proteins Targeting Peptide Aptamers
3.2.1. CD44
3.2.2. CD56
3.2.3. Fibronectin Extra Domain B (EDB)
3.2.4. Heparan Sulfate
3.2.5. Annexin A1
3.3. Immune Checkpoint Proteins and Intracellular Regulators Targeting Peptide Aptamers
3.3.1. Programmed Cell Death Protein 1 (PD-1)
3.3.2. Vav 3 Guanine Nucleotide Exchange Factor (VAV3)
3.3.3. Tax-Interacting Protein 1 (TIP-1)
4. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Anand, U.; Dey, A.; Chandel, A.K.S.; Sanyal, R.; Mishra, A.; Pandey, D.K.; De Falco, V.; Upadhyay, A.; Kandimalla, R.; Chaudhary, A.; et al. Cancer chemotherapy and beyond: Current status, drug candidates, associated risks and progress in targeted therapeutics. Genes Dis. 2023, 10, 1367–1401. [Google Scholar] [CrossRef] [PubMed]
- Ma, Y.; Zhang, H.; Shen, X.; Yang, X.; Deng, Y.; Tian, Y.; Chen, Z.; Pan, Y.; Luo, H.; Zhong, C.; et al. Aptamer Functionalized Hypoxia-potentiating Agent and Hypoxia-inducible Factor Inhibitor Combined with Hypoxia-activated Prodrug for Enhanced Tumor Therapy. Cancer Lett. 2024, 598, 217102. [Google Scholar] [CrossRef] [PubMed]
- Dai, H.; Abdullah, R.; Wu, X.; Li, F.; Ma, Y.; Lu, A.; Zhang, G. Pancreatic cancer: Nucleic acid drug discovery and targeted therapy. Front. Cell Dev. Biol. 2022, 10, 855474. [Google Scholar] [CrossRef] [PubMed]
- Falah, M.; Rayan, M.; Rayan, A. A Novel Paclitaxel Conjugate with Higher Efficiency and Lower Toxicity: A New Drug Candidate for Cancer Treatment. Int. J. Mol. Sci. 2019, 20, 4965. [Google Scholar] [CrossRef]
- Rayan, M.; Shadafny, S.; Falah, A.; Falah, M.; Abu-Lafi, S.; Asli, S.; Rayan, A. A Novel Docetaxel-Biotin Chemical Conjugate for Prostate Cancer Treatment. Molecules 2022, 27, 961. [Google Scholar] [CrossRef]
- Zhao, Q.G.; Zhou, Y.J.; Cao, D.X.; Tang, A.N.; Kong, D.M. DNA-Functionalized Porphyrinic Metal-Organic Framework-Based Drug Delivery System for Targeted Bimodal Cancer Therapy. J. Med. Chem. 2023, 66, 15370–15379. [Google Scholar] [CrossRef] [PubMed]
- Wang, Z.; Liu, Z.; Qu, J.; Sun, Y.; Zhou, W. Role of natural products in tumor therapy from basic research and clinical perspectives. Acta Mater. Medica 2024, 3, 163–206. [Google Scholar] [CrossRef]
- Ma, Y.; Yu, S.; Ni, S.; Zhang, B.; Kung, A.C.F.; Gao, J.; Lu, A.; Zhang, G. Targeting strategies for enhancing paclitaxel specificity in chemotherapy. Front. Cell Dev. Biol. 2021, 9, 626910. [Google Scholar] [CrossRef] [PubMed]
- Liu, Y.; Lu, X.; Chen, M.; Wei, Z.; Peng, G.; Yang, J.; Tang, C.; Yu, P. Advances in screening, synthesis, modification, and biomedical applications of peptides and peptide aptamers. Biofactors 2024, 50, 33–57. [Google Scholar] [CrossRef]
- Wang, M.; Liu, J.; Xia, M.; Yin, L.; Zhang, L.; Liu, X.; Cheng, Y. Peptide-drug conjugates: A new paradigm for targeted cancer therapy. Eur. J. Med. Chem. 2024, 265, 116119. [Google Scholar] [CrossRef]
- Guo, J.; Zhang, H.; Lin, W.; Lu, L.; Su, J.; Chen, X. Signaling pathways and targeted therapies for psoriasis. Signal Transduct. Target. Ther. 2023, 8, 437. [Google Scholar] [CrossRef]
- Baghy, K.; Ladanyi, A.; Reszegi, A.; Kovalszky, I. Insights into the Tumor Microenvironment-Components, Functions and Therapeutics. Int. J. Mol. Sci. 2023, 24, 17536. [Google Scholar] [CrossRef]
- van Weverwijk, A.; de Visser, K.E. Mechanisms driving the immunoregulatory function of cancer cells. Nat. Rev. Cancer 2023, 23, 193–215. [Google Scholar] [CrossRef] [PubMed]
- Alas, M.; Saghaeidehkordi, A.; Kaur, K. Peptide-Drug Conjugates with Different Linkers for Cancer Therapy. J. Med. Chem. 2021, 64, 216–232. [Google Scholar] [CrossRef]
- Torrini, F.; Scarano, S.; Palladino, P.; Minunni, M. Advances and perspectives in the analytical technology for small peptide hormones analysis: A glimpse to gonadorelin. J. Pharm. Biomed. Anal. 2023, 228, 115312. [Google Scholar] [CrossRef]
- Pan, Y.; Wang, Q.; Ma, Y. Small RNAs in Cancer Therapy. In Interdisciplinary Cancer Research; Springer International Publishing: Cham, Switzerland, 2024; pp. 1–27. [Google Scholar] [CrossRef]
- Amu, G.; Ma, Y.; Yu, S.; Zhang, H.; Chen, Z.; Ni, S.; Abdullah, R.; Xiao, H.; Zhang, Y.; Dai, H.; et al. Unique quinoline orientations shape the modified aptamer to sclerostin for enhanced binding affinity and bone anabolic potential. Mol. Ther. Nucleic Acids 2024, 35, 102146. [Google Scholar] [CrossRef]
- Amu, G.; Zhang, G.; Jing, N.; Ma, Y. Developing Stapled Aptamers with a Constrained Conformation for Osteogenesis Imperfect Therapeutics. J. Med. Chem. 2024, 67, 18883–18894. [Google Scholar] [CrossRef] [PubMed]
- Zhang, H.; Yu, S.; Ni, S.; Gubu, A.; Ma, Y.; Zhang, Y.; Li, H.; Wang, Y.; Wang, L.; Zhang, Z.; et al. A bimolecular modification strategy for developing long-lasting bone anabolic aptamer. Mol. Ther. Nucleic Acids 2023, 34, 102073. [Google Scholar] [CrossRef] [PubMed]
- Ma, Y.; Zhang, Y.; Chen, Z.; Tian, Y.; Zhang, G. The Modification Strategies for Enhancing the Metabolic Stabilities and Pharmacokinetics of Aptamer Drug Candidates. In Drug Metabolism and Pharmacokinetics; Mithun, R., Ed.; IntechOpen: Rijeka, Croatia, 2023; p. Ch. 6. [Google Scholar] [CrossRef]
- Masuda, R.; Phyu Thant, K.P.; Kawahara, K.; Oki, H.; Kadonosono, T.; Kobayashi, Y.; Koide, T. A yeast two-hybrid system to obtain triple-helical ligands from combinatorial random peptide libraries. J. Biol. Chem. 2024, 300, 107794. [Google Scholar] [CrossRef] [PubMed]
- Kunamneni, A.; Ogaugwu, C.; Bradfute, S.; Durvasula, R. Ribosome Display Technology: Applications in Disease Diagnosis and Control. Antibodies 2020, 9, 28. [Google Scholar] [CrossRef]
- Jaroszewicz, W.; Morcinek-Orlowska, J.; Pierzynowska, K.; Gaffke, L.; Wegrzyn, G. Phage display and other peptide display technologies. FEMS Microbiol. Rev. 2022, 46, fuab052. [Google Scholar] [CrossRef]
- Wu, Y.; Bertran, M.T.; Joshi, D.; Maslen, S.L.; Hurd, C.; Walport, L.J. Identification of photocrosslinking peptide ligands by mRNA display. Commun. Chem. 2023, 6, 103. [Google Scholar] [CrossRef]
- Li, C.; Hua, Y.; Pan, D.; Qi, L.; Xiao, C.; Xiong, Y.; Lu, W.; Dang, Y.; Gao, X.; Zhao, Y. A rapid selection strategy for umami peptide screening based on machine learning and molecular docking. Food Chem. 2023, 404, 134562. [Google Scholar] [CrossRef]
- Ma, Y.; Yu, Y.; Zhang, B.; Lu, A.; Zhang, G. Editorial: Aptamer-based structural biology, computational modelling, translational research and drug discovery, Volume II. Front. Cell Dev. Biol. 2023, 11, 1195372. [Google Scholar] [CrossRef] [PubMed]
- Chen, R.; Liu, E.; Fang, Y.; Gao, N.; Zhang, M.; Zhang, X.; Chen, W.; Liang, C.; Zhang, Y.; Huang, Y. Naturally sourced amphiphilic peptides as paclitaxel vehicles for breast cancer treatment. Biomater. Adv. 2024, 159, 213824. [Google Scholar] [CrossRef] [PubMed]
- Regina, A.; Demeule, M.; Che, C.; Lavallee, I.; Poirier, J.; Gabathuler, R.; Beliveau, R.; Castaigne, J.P. Antitumour activity of ANG1005, a conjugate between paclitaxel and the new brain delivery vector Angiopep-2. Br. J. Pharmacol. 2008, 155, 185–197. [Google Scholar] [CrossRef]
- Ruan, H.; Chai, Z.; Shen, Q.; Chen, X.; Su, B.; Xie, C.; Zhan, C.; Yao, S.; Wang, H.; Zhang, M.; et al. A novel peptide ligand RAP12 of LRP1 for glioma targeted drug delivery. J. Control. Release 2018, 279, 306–315. [Google Scholar] [CrossRef] [PubMed]
- Mei, D.; Lin, Z.; Fu, J.; He, B.; Gao, W.; Ma, L.; Dai, W.; Zhang, H.; Wang, X.; Wang, J.; et al. The use of α-conotoxin ImI to actualize the targeted delivery of paclitaxel micelles to α7 nAChR-overexpressing breast cancer. Biomaterials 2015, 42, 52–65. [Google Scholar] [CrossRef] [PubMed]
- Zou, L.; Tao, Y.; Payne, G.; Do, L.; Thomas, T.; Rodriguez, J.; Dou, H. Targeted delivery of nano-PTX to the brain tumor-associated macrophages. Oncotarget 2017, 8, 6564–6578. [Google Scholar] [CrossRef] [PubMed]
- Chen, Q.; Liang, H.; Sun, Y.; Chen, Y.; He, W.; Fang, X.; Sha, X.; Li, J. A carbohydrate mimetic peptide modified size-shrinkable micelle nanocluster for anti-tumor targeting and penetrating drug delivery. Int. J. Nanomed. 2019, 14, 7339–7352. [Google Scholar] [CrossRef] [PubMed]
- Zhong, Y.; Su, T.; Shi, Q.; Feng, Y.; Tao, Z.; Huang, Q.; Li, L.; Hu, L.; Li, S.; Tan, H.; et al. Co-administration of iRGD enhances tumor-targeted delivery and anti-tumor effects of paclitaxel-loaded PLGA nanoparticles for colorectal cancer treatment. Int. J. Nanomed. 2019, 14, 8543–8560. [Google Scholar] [CrossRef]
- Li, L.; Yang, M.; Li, R.; Hu, J.; Yu, L.; Qian, X. iRGD co-administration with paclitaxel-loaded PLGA nanoparticles enhance targeting and antitumor effect in colorectal cancer treatment. Anti-Cancer Agents Med. Chem. 2021, 21, 910–918. [Google Scholar] [CrossRef] [PubMed]
- Hu, H.; Wang, B.; Lai, C.; Xu, X.; Zhen, Z.; Zhou, H.; Xu, D. iRGD-paclitaxel conjugate nanoparticles for targeted paclitaxel delivery. Drug Dev. Res. 2019, 80, 1080–1088. [Google Scholar] [CrossRef] [PubMed]
- Wang, G.; Wang, Z.; Li, C.; Duan, G.; Wang, K.; Li, Q.; Tao, T. RGD peptide-modified, paclitaxel prodrug-based, dual-drugs loaded, and redox-sensitive lipid-polymer nanoparticles for the enhanced lung cancer therapy. Biomed. Pharmacother. 2018, 106, 275–284. [Google Scholar] [CrossRef] [PubMed]
- Shi, J.; Liu, S.; Yu, Y.; He, C.; Tan, L.; Shen, Y.M. RGD peptide-decorated micelles assembled from polymer-paclitaxel conjugates towards gastric cancer therapy. Colloids Surf. B Biointerfaces 2019, 180, 58–67. [Google Scholar] [CrossRef]
- Huang, Z.G.; Lv, F.M.; Wang, J.; Ca, S.J.; Liu, Z.P.; Liu, Y.; Lu, W.Y. RGD-modified PEGylated paclitaxel nanocrystals with enhanced stability and tumor-targeting capability. Int. J. Pharm. 2019, 556, 217–225. [Google Scholar] [CrossRef]
- Zhang, P.; Hu, L.; Yin, Q.; Feng, L.; Li, Y. Transferrin-modified c[RGDfK]-paclitaxel loaded hybrid micelle for sequential blood-brain barrier penetration and glioma targeting therapy. Mol. Pharm. 2012, 9, 1590–1598. [Google Scholar] [CrossRef]
- Pan, A.; Zhang, H.; Li, Y.; Lin, T.Y.; Wang, F.; Lee, J.; Cheng, M.; Dall’Era, M.; Li, T.; deVere White, R.; et al. Disulfide-crosslinked nanomicelles confer cancer-specific drug delivery and improve efficacy of paclitaxel in bladder cancer. Nanotechnology 2016, 27, 425103. [Google Scholar] [CrossRef] [PubMed]
- Xiao, K.; Li, Y.; Lee, J.S.; Gonik, A.M.; Dong, T.; Fung, G.; Sanchez, E.; Xing, L.; Cheng, H.R.; Luo, J.; et al. “OA02” peptide facilitates the precise targeting of paclitaxel-loaded micellar nanoparticles to ovarian cancer in vivo. Cancer Res. 2012, 72, 2100–2110. [Google Scholar] [CrossRef] [PubMed]
- Li, S.; Gray, B.P.; McGuire, M.J.; Brown, K.C. Synthesis and biological evaluation of a peptide-paclitaxel conjugate which targets the integrin alphavbeta(6). Bioorganic Med. Chem. 2011, 19, 5480–5489. [Google Scholar] [CrossRef]
- Zaiden, M.; Rütter, M.; Shpirt, L.; Ventura, Y.; Feinshtein, V.; David, A. CD44-Targeted Polymer–Paclitaxel Conjugates to Control the Spread and Growth of Metastatic Tumors. Mol. Pharm. 2018, 15, 3690–3699. [Google Scholar] [CrossRef] [PubMed]
- Gu, G.; Hu, Q.; Feng, X.; Gao, X.; Menglin, J.; Kang, T.; Jiang, D.; Song, Q.; Chen, H.; Chen, J. PEG-PLA nanoparticles modified with APTEDB peptide for enhanced anti-angiogenic and anti-glioma therapy. Biomaterials 2014, 35, 8215–8226. [Google Scholar] [CrossRef] [PubMed]
- Lin, Z.L.; Ding, J.; Sun, G.P.; Li, D.; He, S.S.; Liang, X.F.; Huang, X.R.; Xie, J. Application of paclitaxel-loaded EGFR peptide-conjugated magnetic polymeric liposomes for liver cancer therapy. Curr. Med. Sci. 2020, 40, 145–154. [Google Scholar] [CrossRef] [PubMed]
- Sun, Z.; Zhang, Y.; Cao, D.; Wang, X.; Yan, X.; Li, H.; Huang, L.; Qu, X.; Kong, C.; Qin, H.; et al. PD-1/PD-L1 pathway and angiogenesis dual recognizable nanoparticles for enhancing chemotherapy of malignant cancer. Drug Deliv. 2018, 25, 1746–1755. [Google Scholar] [CrossRef]
- Lin, W.J.; Kao, L.T. Cytotoxic enhancement of hexapeptide-conjugated micelles in EGFR high-expressed cancer cells. Expert Opin. Drug Deliv. 2014, 11, 1537–1550. [Google Scholar] [CrossRef]
- Ran, D.; Mao, J.; Shen, Q.; Xie, C.; Zhan, C.; Wang, R.; Lu, W. GRP78 enabled micelle-based glioma targeted drug delivery. J. Control. Release 2017, 255, 120–131. [Google Scholar] [CrossRef]
- Niu, S.; Bremner, D.H.; Wu, J.; Wu, J.; Wang, H.; Li, H.; Qian, Q.; Zheng, H.; Zhu, L. l-peptide functionalized dual-responsive nanoparticles for controlled paclitaxel release and enhanced apoptosis in breast cancer cells. Drug Deliv. 2018, 25, 1275–1288. [Google Scholar] [CrossRef]
- Passarella, R.J.; Spratt, D.E.; van der Ende, A.E.; Phillips, J.G.; Wu, H.; Sathiyakumar, V.; Zhou, L.; Hallahan, D.E.; Harth, E.; Diaz, R. Targeted nanoparticles that deliver a sustained, specific release of Paclitaxel to irradiated tumors. Cancer Res. 2010, 70, 4550–4559. [Google Scholar] [CrossRef]
- Gibbens-Bandala, B.; Morales-Avila, E.; Ferro-Flores, G.; Santos-Cuevas, C.; Melendez-Alafort, L.; Trujillo-Nolasco, M.; Ocampo-Garcia, B. (177)Lu-Bombesin-PLGA (paclitaxel): A targeted controlled-release nanomedicine for bimodal therapy of breast cancer. Mater. Sci. Eng. C Mater. Biol. Appl. 2019, 105, 110043. [Google Scholar] [CrossRef] [PubMed]
- Safavy, A.; Raisch, K.P.; Matusiak, D.; Bhatnagar, S.; Helson, L. Single-drug multiligand conjugates: Synthesis and preliminary cytotoxicity evaluation of a paclitaxel-dipeptide “scorpion” molecule. Bioconjugate Chem. 2006, 17, 565–570. [Google Scholar] [CrossRef] [PubMed]
- Hu, Q.; Gao, X.; Kang, T.; Feng, X.; Jiang, D.; Tu, Y.; Song, Q.; Yao, L.; Jiang, X.; Chen, H.; et al. CGKRK-modified nanoparticles for dual-targeting drug delivery to tumor cells and angiogenic blood vessels. Biomaterials 2013, 34, 9496–9508. [Google Scholar] [CrossRef] [PubMed]
- Ahmed, M.S.U.; Salam, A.B.; Yates, C.; Willian, K.; Jaynes, J.; Turner, T.; Abdalla, M.O. Double-receptor-targeting multifunctional iron oxide nanoparticles drug delivery system for the treatment and imaging of prostate cancer. Int. J. Nanomed. 2017, 12, 6973–6984. [Google Scholar] [CrossRef]
- Wang, C.; Ma, Y.; Feng, S.; Liu, K.; Zhou, N. Gonadotropin-releasing hormone receptor-targeted paclitaxel-degarelix conjugate: Synthesis and in vitro evaluation. J. Pept. Sci. 2015, 21, 569–576. [Google Scholar] [CrossRef]
- Vossen, L.I.; Markovsky, E.; Eldar-Boock, A.; Tschiche, H.R.; Wedepohl, S.; Pisarevsky, E.; Satchi-Fainaro, R.; Calderon, M. PEGylated dendritic polyglycerol conjugate targeting NCAM-expressing neuroblastoma: Limitations and challenges. Nanomed. Nanotechnol. Biol. Med. 2018, 14, 1169–1179. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Y.; Lu, Y.; Zhang, Y.; He, X.; Chen, Q.; Liu, L.; Chen, X.; Ruan, C.; Sun, T.; Jiang, C. Tumor-targeting micelles based on linear-dendritic PEG-PTX8 conjugate for triple negative breast cancer therapy. Mol. Pharm. 2017, 14, 3409–3421. [Google Scholar] [CrossRef] [PubMed]
- Kang, T.; Gao, X.; Hu, Q.; Jiang, D.; Feng, X.; Zhang, X.; Song, Q.; Yao, L.; Huang, M.; Jiang, X.; et al. iNGR-modified PEG-PLGA nanoparticles that recognize tumor vasculature and penetrate gliomas. Biomaterials 2014, 35, 4319–4332. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Zhao, H.; Peng, J.; Chen, L.; Tan, L.; Huang, Y.; Qian, Z. Targeting therapy of neuropilin-1 receptors overexpressed breast cancer by paclitaxel-loaded CK3-conjugated polymeric micelles. J. Biomed. Nanotechnol. 2016, 12, 2097–2111. [Google Scholar] [CrossRef] [PubMed]
- Ma, Y.; Dong, Y.; Li, X.; Wang, F.; Zhang, Y. Tumor-Penetrating Peptide-Functionalized Ferritin Enhances Antitumor Activity of Paclitaxel. ACS Appl. Bio Mater. 2021, 4, 2654–2663. [Google Scholar] [CrossRef]
- Wang, H.; Wang, X.; Xie, C.; Zhang, M.; Ruan, H.; Wang, S.; Jiang, K.; Wang, F.; Zhan, C.; Lu, W.; et al. Nanodisk-based glioma-targeted drug delivery enabled by a stable glycopeptide. J. Control. Release 2018, 284, 26–38. [Google Scholar] [CrossRef] [PubMed]
- Karmali, P.P.; Kotamraju, V.R.; Kastantin, M.; Black, M.; Missirlis, D.; Tirrell, M.; Ruoslahti, E. Targeting of albumin-embedded paclitaxel nanoparticles to tumors. Nanomed. Nanotechnol. Biol. Med. 2009, 5, 73–82. [Google Scholar] [CrossRef]
- Kim, J.H.; Bae, C.; Kim, M.J.; Song, I.H.; Ryu, J.H.; Choi, J.H.; Lee, C.J.; Nam, J.S.; Kim, J.I. A novel nucleolin-binding peptide for cancer theranostics. Theranostics 2020, 10, 9153–9171. [Google Scholar] [CrossRef] [PubMed]
- Cai, Y.; Xu, Z.M.; Shuai, Q.; Zhu, F.T.; Xu, J.; Gao, X.; Sun, X.R. Tumor-targeting peptide functionalized PEG-PLA micelles for efficient drug delivery. Biomater. Sci. 2020, 8, 2274–2282. [Google Scholar] [CrossRef]
- Chang, H.N.; Liu, B.Y.; Qi, Y.K.; Zhou, Y.; Chen, Y.P.; Pan, K.M.; Li, W.W.; Zhou, X.M.; Ma, W.W.; Fu, C.Y.; et al. Blocking of the PD-1/PD-L1 interaction by a d-peptide antagonist for cancer immunotherapy. Angew. Chem. 2015, 54, 11760–11764. [Google Scholar] [CrossRef]
- Banerjee, I.; De, K.; Mukherjee, D.; Dey, G.; Chattopadhyay, S.; Mukherjee, M.; Mandal, M.; Bandyopadhyay, A.K.; Gupta, A.; Ganguly, S.; et al. Paclitaxel-loaded solid lipid nanoparticles modified with Tyr-3-octreotide for enhanced anti-angiogenic and anti-glioma therapy. Acta Biomater. 2016, 38, 69–81. [Google Scholar] [CrossRef] [PubMed]
- Patel, Y.C. Somatostatin and its receptor family. Front. Neuroendocrinol. 1999, 20, 157–198. [Google Scholar] [CrossRef] [PubMed]
- Zheng, N.; Dai, W.; Du, W.; Zhang, H.; Lei, L.; Zhang, H.; Wang, X.; Wang, J.; Zhang, X.; Gao, J.; et al. A novel lanreotide-encoded micelle system targets paclitaxel to the tumors with overexpression of somatostatin receptors. Mol. Pharm. 2012, 9, 1175–1188. [Google Scholar] [CrossRef]
- Sun, P.; Xiao, Y.; Di, Q.; Ma, W.; Ma, X.; Wang, Q.; Chen, W. Transferrin receptor-targeted PEG-PLA polymeric micelles for chemotherapy against glioblastoma multiforme. Int. J. Nanomed. 2020, 15, 6673–6688. [Google Scholar] [CrossRef]
- Cui, Y.; Zhang, M.; Zeng, F.; Jin, H.; Xu, Q.; Huang, Y. Dual-targeting magnetic PLGA nanoparticles for codelivery of paclitaxel and curcumin for brain tumor therapy. ACS Appl. Mater. Interfaces 2016, 8, 32159–32169. [Google Scholar] [CrossRef]
- Zhang, H.; Wu, T.; Yu, W.; Ruan, S.; He, Q.; Gao, H. Ligand Size and Conformation Affect the Behavior of Nanoparticles Coated with in Vitro and in Vivo Protein Corona. ACS Appl. Mater. Interfaces 2018, 10, 9094–9103. [Google Scholar] [CrossRef]
- Hariri, G.; Edwards, A.D.; Merrill, T.B.; Greenbaum, J.M.; van der Ende, A.E.; Harth, E. Sequential targeted delivery of paclitaxel and camptothecin using a cross-linked “nanosponge” network for lung cancer chemotherapy. Mol. Pharm. 2014, 11, 265–275. [Google Scholar] [CrossRef] [PubMed]
- Zhang, M.; Chen, X.; Ying, M.; Gao, J.; Zhan, C.; Lu, W. Glioma-targeted drug delivery enabled by a multifunctional peptide. Bioconjug. Chem. 2017, 28, 775–781. [Google Scholar] [CrossRef] [PubMed]
- Guo, P.; Song, S.; Li, Z.; Tian, Y.; Zheng, J.; Yang, X.; Pan, W. In vitro and in vivo evaluation of APRPG-modified angiogenic vessel targeting micelles for anticancer therapy. Int. J. Pharm. 2015, 486, 356–366. [Google Scholar] [CrossRef] [PubMed]
- Lei, H.T.; An, P.; Song, S.M.; Liu, X.Y.; He, L.W.; Wu, J.; Meng, L.; Liu, M.S.; Yang, J.S.; Shou, C.C. A novel peptide isolated from a phage display library inhibits tumor growth and metastasis by blocking the binding of vascular endothelial growth factor to its kinase domain receptor. J. Biol. Chem. 2002, 277, 43137–43142. [Google Scholar] [CrossRef]
- Wang, L.; Zhao, C.; Lu, L.; Jiang, H.; Wang, F.; Zhang, X. Transcytosable Peptide-Paclitaxel Prodrug Nanoparticle for Targeted Treatment of Triple-Negative Breast Cancer. Int. J. Mol. Sci. 2023, 24, 4646. [Google Scholar] [CrossRef]
- Li, Y.; Zheng, X.; Gong, M.; Zhang, J. Delivery of a peptide-drug conjugate targeting the blood brain barrier improved the efficacy of paclitaxel against glioma. Oncotarget 2016, 7, 79401–79407. [Google Scholar] [CrossRef] [PubMed]
- Maletinska, L.; Blakely, E.A.; Bjornstad, K.A.; Deen, D.F.; Knoff, L.J.; Forte, T.M. Human glioblastoma cell lines: Levels of low-density lipoprotein receptor and low-density lipoprotein receptor-related protein. Cancer Res. 2000, 60, 2300–2303. [Google Scholar] [PubMed]
- Sarantopoulos, J.; Gabrail, N.Y.; Moulder, S.L.; Brenner, A.J.; Smith, C.L.; Bouchard, D.; Elian, K.; Lawrence, B.; Castaigne, J.; Kurzrock, R. ANG1005: Results of a phase I study in patients with advanced solid tumors and brain metastases. J. Clin. Oncol. 2010, 28 (Suppl. S15), 2556. [Google Scholar] [CrossRef]
- Kumthekar, P.; Tang, S.; Brenner, A.J.; Kesari, S.; Anders, C.K.; Carrillo, J.A.; Chalasani, P.; Kabos, P.; Ahluwalia, M.S.; Ibrahim, N.K. OS7.2 A Phase II Study of ANG1005, a novel BBB/BCB Penetratant Taxane in Patients with Recurrent Brain Metastases and Leptomeningeal Carcinomatosis from Breast Cancer. Neuro-Oncology 2016, 18 (Suppl. S4), iv16. [Google Scholar] [CrossRef][Green Version]
- Kumthekar, P.; Lawrence, B.; Iordanova, V.; Ibrahim, N.; Mazanet, R. Abstract OT1-06-01: ANG1005 in leptomeningeal disease (ANGLeD) trial: A randomized, open-label, phase 3 study of ANG1005 compared with Physician’s Best Choice in HER2-negative breast cancer patients with newly diagnosed leptomeningeal carcinomatosis and previously treated brain metastases. Cancer Res. 2019, 79 (Suppl. S4), OT1-06-01-OT01-06-01. [Google Scholar] [CrossRef]
- Drappatz, J.; Brenner, A.; Wong, E.T.; Eichler, A.; Schiff, D.; Groves, M.D.; Mikkelsen, T.; Rosenfeld, S.; Sarantopoulos, J.; Meyers, C.A.; et al. Phase I study of GRN1005 in recurrent malignant glioma. Clin. Cancer Res. 2013, 19, 1567–1576. [Google Scholar] [CrossRef] [PubMed]
- Kozma, G.T.; Shimizu, T.; Ishida, T.; Szebeni, J. Anti-PEG antibodies: Properties, formation, testing and role in adverse immune reactions to PEGylated nano-biopharmaceuticals. Adv. Drug Deliv. Rev. 2020, 154–155, 163–175. [Google Scholar] [CrossRef]
- Xin, H.L.; Jiang, X.Y.; Gu, J.J.; Sha, X.Y.; Chen, L.C.; Law, K.; Chen, Y.Z.; Wang, X.; Jiang, Y.; Fang, X.L. Angiopep-conjugated poly(ethylene glycol)-co-poly(epsilon-caprolactone) nanoparticles as dual-targeting drug delivery system for brain glioma. Biomaterials 2011, 32, 4293–4305. [Google Scholar] [CrossRef] [PubMed]
- Xin, H.; Sha, X.; Jiang, X.; Zhang, W.; Chen, L.; Fang, X. Anti-glioblastoma efficacy and safety of paclitaxel-loading angiopep-conjugated dual targeting PEG-PCL nanoparticles. Biomaterials 2012, 33, 8167–8176. [Google Scholar] [CrossRef]
- Pachane, B.C.; Selistre-de-Araujo, H.S. The Role of alphavbeta3 Integrin in Cancer Therapy Resistance. Biomedicines 2024, 12, 1163. [Google Scholar] [CrossRef]
- Debordeaux, F.; Chansel-Debordeaux, L.; Pinaquy, J.-B.; Fernandez, P.; Schulz, J. What about αvβ3 integrins in molecular imaging in oncology? Nucl. Med. Biol. 2018, 62–63, 31–46. [Google Scholar] [CrossRef] [PubMed]
- Ganipineni, L.P.; Ucakar, B.; Joudiou, N.; Riva, R.; Jerome, C.; Gallez, B.; Danhier, F.; Preat, V. Paclitaxel-loaded multifunctional nanoparticles for the targeted treatment of glioblastoma. J. Drug Target. 2019, 27, 614–623. [Google Scholar] [CrossRef]
- Meng, S.; Su, B.; Li, W.; Ding, Y.; Tang, L.; Zhou, W.; Song, Y.; Caicun, Z. Integrin-targeted paclitaxel nanoliposomes for tumor therapy. Med. Oncol. 2011, 28, 1180–1187. [Google Scholar] [CrossRef]
- Rizvi, S.F.A.; Abbas, N.; Zhang, H.; Fang, Q. Identification of a pH-Responsive Peptide-Paclitaxel Conjugate as a Novel Drug with Improved Therapeutic Potential. J. Med. Chem. 2023, 66, 8324–8337. [Google Scholar] [CrossRef] [PubMed]
- Ren, L.; Chen, S.; Li, H.; Zhang, Z.; Ye, C.; Liu, M.; Zhou, X. MRI-visible liposome nanovehicles for potential tumor-targeted delivery of multimodal therapies. Nanoscale 2015, 7, 12843–12850. [Google Scholar] [CrossRef] [PubMed]
- Huang, S.; Zhang, Y.; Wang, L.; Liu, W.; Xiao, L.; Lin, Q.; Gong, T.; Sun, X.; He, Q.; Zhang, Z.; et al. Improved melanoma suppression with target-delivered TRAIL and paclitaxel by a multifunctional nanocarrier. J. Control. Release 2020, 325, 10–24. [Google Scholar] [CrossRef]
- Colombo, R.; Mingozzi, M.; Belvisi, L.; Arosio, D.; Piarulli, U.; Carenini, N.; Perego, P.; Zaffaroni, N.; De Cesare, M.; Castiglioni, V.; et al. Synthesis and Biological Evaluation (in Vitro and in Vivo) of Cyclic Arginine–Glycine–Aspartate (RGD) Peptidomimetic–Paclitaxel Conjugates Targeting Integrin αVβ3. J. Med. Chem. 2012, 55, 10460–10474. [Google Scholar] [CrossRef]
- Zhang, J.; Wang, S.; Deng, Z.; Li, L.; Tan, G.; Liu, X.; Zheng, H.; Yan, F. Ultrasound-triggered drug delivery for breast tumor therapy through iRGD-targeted paclitaxel-loaded liposome-microbubble complexes. J. Biomed. Nanotechnol. 2018, 14, 1384–1395. [Google Scholar] [CrossRef]
- Kang, T.; Li, Y.; Wang, Y.; Zhu, J.; Yang, L.; Huang, Y.; Xiong, M.; Liu, J.; Wang, S.; Huang, M.; et al. Modular engineering of targeted dual-drug nanoassemblies for cancer chemoimmunotherapy. ACS Appl. Mater. Interfaces 2019, 11, 36371–36382. [Google Scholar] [CrossRef]
- Li, Y.; Chen, M.; Yao, B.; Lu, X.; Song, B.; Vasilatos, S.N.; Zhang, X.; Ren, X.; Yao, C.; Bian, W.; et al. Dual pH/ROS-responsive nanoplatform with deep tumor penetration and self-amplified drug release for enhancing tumor chemotherapeutic efficacy. Small 2020, 16, 2002188. [Google Scholar] [CrossRef] [PubMed]
- Ma, Y.; Zhu, Y.; Wang, C.; Pan, D.; Liu, S.; Yang, M.; Xiao, Z.; Yang, X.; Zhao, W.; Zhou, X. Annealing novel nucleobase-lipids with oligonucleotides or plasmid DNA based on H-bonding or π-π interaction: Assemblies and transfections. Biomaterials 2018, 178, 147–157. [Google Scholar] [CrossRef]
- Schleich, N.; Po, C.; Jacobs, D.; Ucakar, B.; Gallez, B.; Danhier, F.; Preat, V. Comparison of active, passive and magnetic targeting to tumors of multifunctional paclitaxel/SPIO-loaded nanoparticles for tumor imaging and therapy. J. Control. Release 2014, 194, 82–91. [Google Scholar] [CrossRef]
- Shu, C.; Sabi-mouka, E.M.B.; Wang, X.; Ding, L. Self-assembly hydrogels as multifunctional drug delivery of paclitaxel for synergistic tumour-targeting and biocompatibility in vitro and in vivo. J. Pharm. Pharmacol. 2017, 69, 967–977. [Google Scholar] [CrossRef] [PubMed]
- Yan, H.; You, Y.; Li, X.; Liu, L.; Guo, F.; Zhang, Q.; Liu, D.; Tong, Y.; Ding, S.; Wang, J. Preparation of RGD peptide/folate acid double-targeted mesoporous silica nanoparticles and its application in human breast cancer MCF-7 cells. Front. Pharmacol. 2020, 11, 898. [Google Scholar] [CrossRef] [PubMed]
- Liu, X.; Ma, Z.; Jing, X.; Wang, G.; Zhao, L.; Zhao, X.; Zhang, Y. The deubiquitinase OTUD5 stabilizes SLC7A11 to promote progression and reduce paclitaxel sensitivity in triple-negative breast cancer. Cancer Lett. 2024, 604, 217232. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Fan, P.; Shen, P.; Fan, C.; Zhao, P.; Yao, S.; Dong, K.; Ling, R.; Chen, S.; Zhang, J. XBP1s activates METTL3/METTL14 for ER-phagy and paclitaxel sensitivity regulation in breast cancer. Cancer Lett. 2024, 596, 216846. [Google Scholar] [CrossRef] [PubMed]
- Fu, Q.; Zhao, Y.; Yang, Z.; Yue, Q.; Xiao, W.; Chen, Y.; Yang, Y.; Guo, L.; Wu, Y. Liposomes actively recognizing the glucose transporter GLUT(1) and integrin alpha(v) beta(3) for dual-targeting of glioma. Arch. Pharm. 2019, 352, e1800219. [Google Scholar] [CrossRef] [PubMed]
- Pu, Y.; Zhang, H.; Peng, Y.; Fu, Q.; Yue, Q.; Zhao, Y.; Guo, L.; Wu, Y. Dual-targeting liposomes with active recognition of GLUT5 and alphavbeta3 for triple-negative breast cancer. Eur. J. Med. Chem. 2019, 183, 111720. [Google Scholar] [CrossRef]
- Lin, T.Y.; Li, Y.; Liu, Q.; Chen, J.L.; Zhang, H.; Lac, D.; Zhang, H.; Ferrara, K.W.; Wachsmann-Hogiu, S.; Li, T.; et al. Novel theranostic nanoporphyrins for photodynamic diagnosis and trimodal therapy for bladder cancer. Biomaterials 2016, 104, 339–351. [Google Scholar] [CrossRef] [PubMed]
- Cao, P.; Zhang, Q.; Wu, S.; Sullivan, M.A.; Huang, Y.; Gong, W.; Lv, Y.; Zhai, X.; Zhang, Y. Baseline differences in metabolic profiles of patients with lung squamous cell carcinoma responding or not responding to treatment with nanoparticle albumin-bound paclitaxel (nab-paclitaxel). Acta Mater. Medica 2023, 2, 347–356. [Google Scholar] [CrossRef]
- Jiang, H.; Xi, Q.; Wang, F.; Sun, Z.; Huang, Z.; Qi, L. Increased expression of neuropilin 1 is associated with epithelial ovarian carcinoma. Mol. Med. Rep. 2015, 12, 2114–2120. [Google Scholar] [CrossRef][Green Version]
- Feng, G.K.; Liu, R.B.; Zhang, M.Q.; Ye, X.X.; Zhong, Q.; Xia, Y.F.; Li, M.Z.; Wang, J.; Song, E.W.; Zhang, X.; et al. SPECT and near-infrared fluorescence imaging of breast cancer with a neuropilin-1-targeting peptide. J. Control. Release 2014, 192, 236–242. [Google Scholar] [CrossRef]
- Gray, M.J.; Wey, J.S.; Belcheva, A.; McCarty, M.F.; Trevino, J.G.; Evans, D.B.; Ellis, L.M.; Gallick, G.E. Neuropilin-1 suppresses tumorigenic properties in a human pancreatic adenocarcinoma cell line lacking neuropilin-1 coreceptors. Cancer Res. 2005, 65, 3664–3670. [Google Scholar] [CrossRef] [PubMed]
- Yang, Y.; Xie, X.; Yang, Y.; Zhang, H.; Mei, X. Photo-responsive and NGR-mediated multifunctional nanostructured lipid carrier for tumor-specific therapy. J. Pharm. Sci. 2015, 104, 1328–1339. [Google Scholar] [CrossRef]
- Amu, G.; Zhang, X.; Lu, A.; Zhang, B.; Ma, Y.; Zhang, G. Nucleic acid amphiphiles: Synthesis, properties and applications. Mol. Ther. Nucleic Acids 2023, 33, 144–163. [Google Scholar] [CrossRef]
- Chen, Z.; Luo, H.; Gubu, A.; Yu, S.; Zhang, H.; Dai, H.; Zhang, Y.; Zhang, B.; Ma, Y.; Lu, A.; et al. Chemically modified aptamers for improving binding affinity to the target proteins via enhanced non-covalent bonding. Front. Cell Dev. Biol. 2023, 11, 1091809. [Google Scholar] [CrossRef]
- Yu, J.; Sun, L.; Zhou, J.; Gao, L.; Nan, L.; Zhao, S.; Peng, T.; Han, L.; Wang, J.; Lu, W.; et al. Self-assembled tumor-penetrating peptide-modified poly(l-gamma-glutamylglutamine)-paclitaxel nanoparticles based on hydrophobic interaction for the treatment of glioblastoma. Bioconjug. Chem. 2017, 28, 2823–2831. [Google Scholar] [CrossRef]
- Cao, J.Y.; Wang, R.; Gao, N.; Li, M.H.; Tian, X.Y.; Yang, W.L.; Ruan, Y.; Zhou, C.L.; Wang, G.T.; Liu, X.Y.; et al. A7RC peptide modified paclitaxel liposomes dually target breast cancer. Biomater. Sci. 2015, 3, 1545–1554. [Google Scholar] [CrossRef] [PubMed]
- Meng, S.; Su, B.; Li, W.; Ding, Y.; Tang, L.; Zhou, W.; Song, Y.; Li, H.; Zhou, C. Enhanced antitumor effect of novel dual-targeted paclitaxel liposomes. Nanotechnology 2010, 21, 415103. [Google Scholar] [CrossRef]
- Wang, W.; Li, M.; Zhang, Z.; Cui, C.; Zhou, J.; Yin, L.; Lv, H. Design, synthesis and evaluation of multi-functional tLyP-1-hyaluronic acid-paclitaxel conjugate endowed with broad anticancer scope. Carbohydr. Polym. 2017, 156, 97–107. [Google Scholar] [CrossRef]
- Zhang, X.; Wang, F.; Shen, Q.; Xie, C.; Liu, Y.; Pan, J.; Lu, W. Structure Reconstruction of LyP-1: (L)c(LyP-1) Coupling by Amide Bond Inspires the Brain Metastatic Tumor Targeted Drug Delivery. Mol. Pharm. 2018, 15, 430–436. [Google Scholar] [CrossRef] [PubMed]
- Ciardiello, F.; Tortora, G. Epidermal growth factor receptor (EGFR) as a target in cancer therapy: Understanding the role of receptor expression and other molecular determinants that could influence the response to anti-EGFR drugs. Eur. J. Cancer 2003, 39, 1348–1354. [Google Scholar] [CrossRef]
- Gandullo-Sanchez, L.; Pandiella, A. An anti-EGFR antibody-drug conjugate overcomes resistance to HER2-targeted drugs. Cancer Lett. 2023, 554, 216024. [Google Scholar] [CrossRef]
- Spannuth, W.A.; Nick, A.M.; Jennings, N.B.; Armaiz-Pena, G.N.; Mangala, L.S.; Danes, C.G.; Lin, Y.G.; Merritt, W.M.; Thaker, P.H.; Kamat, A.A.; et al. Functional significance of VEGFR-2 on ovarian cancer cells. Int. J. Cancer 2009, 124, 1045–1053. [Google Scholar] [CrossRef]
- Zhong, M.; Li, N.; Qiu, X.; Ye, Y.; Chen, H.; Hua, J.; Yin, P.; Zhuang, G. TIPE regulates VEGFR2 expression and promotes angiogenesis in colorectal cancer. Int. J. Biol. Sci. 2020, 16, 272–283. [Google Scholar] [CrossRef]
- Higgins, K.J.; Liu, S.; Abdelrahim, M.; Yoon, K.; Vanderlaag, K.; Porter, W.; Metz, R.P.; Safe, S. Vascular Endothelial Growth Factor Receptor-2 Expression Is Induced by 17β-Estradiol in ZR-75 Breast Cancer Cells by Estrogen Receptor α/Sp Proteins. Endocrinology 2006, 147, 3285–3295. [Google Scholar] [CrossRef]
- Yu, D.H.; Lu, Q.; Xie, J.; Fang, C.; Chen, H.Z. Peptide-conjugated biodegradable nanoparticles as a carrier to target paclitaxel to tumor neovasculature. Biomaterials 2010, 31, 2278–2292. [Google Scholar] [CrossRef]
- Bai, F.; Wang, C.; Lu, Q.; Zhao, M.; Ban, F.Q.; Yu, D.H.; Guan, Y.Y.; Luan, X.; Liu, Y.R.; Chen, H.Z.; et al. Nanoparticle-mediated drug delivery to tumor neovasculature to combat P-gp expressing multidrug resistant cancer. Biomaterials 2013, 34, 6163–6174. [Google Scholar] [CrossRef]
- Wang, H.; Wang, S.; Wang, R.; Wang, X.; Jiang, K.; Xie, C.; Zhan, C.; Wang, H.; Lu, W. Co-delivery of paclitaxel and melittin by glycopeptide-modified lipodisks for synergistic anti-glioma therapy. Nanoscale 2019, 11, 13069–13077. [Google Scholar] [CrossRef] [PubMed]
- Feng, G.; Arima, Y.; Midorikawa, K.; Kobayashi, H.; Oikawa, S.; Zhao, W.; Zhang, Z.; Takeuchi, K.; Murata, M. Knockdown of TFRC suppressed the progression of nasopharyngeal carcinoma by downregulating the PI3K/Akt/mTOR pathway. Cancer Cell Int. 2023, 23, 185. [Google Scholar] [CrossRef] [PubMed]
- Yu, M.; Su, D.; Yang, Y.; Qin, L.; Hu, C.; Liu, R.; Zhou, Y.; Yang, C.; Yang, X.; Wang, G.; et al. D-T7 peptide-modified PEGylated bilirubin nanoparticles loaded with cediranib and paclitaxel for antiangiogenesis and chemotherapy of glioma. ACS Appl. Mater. Interfaces 2019, 11, 176–186. [Google Scholar] [CrossRef] [PubMed]
- Cervera, P.; Videau, C.; Viollet, C.; Petrucci, C.; Lacombe, J.; Winsky-Sommerer, R.; Csaba, Z.; Helboe, L.; Daumas-Duport, C.; Reubi, J.C.; et al. Comparison of somatostatin receptor expression in human gliomas and medulloblastomas. J. Neuroendocrinol. 2002, 14, 458–471. [Google Scholar] [CrossRef]
- Sun, M.L.; Wei, J.M.; Wang, X.W.; Li, L.; Wang, P.; Li, M.; Yi, C.H. Paclitaxel-octreotide conjugates inhibit growth of human non-small cell lung cancer cells in vitro. Exp. Oncol. 2007, 29, 186–191. [Google Scholar] [PubMed]
- Ma, Y.; Zhao, W.; Li, Y.; Pan, Y.; Wang, S.; Zhu, Y.; Kong, L.; Guan, Z.; Wang, J.; Zhang, L.; et al. Structural optimization and additional targets identification of antisense oligonucleotide G3139 encapsulated in a neutral cytidinyl-lipid combined with a cationic lipid in vitro and in vivo. Biomaterials 2019, 197, 182–193. [Google Scholar] [CrossRef]
- Shen, Y.; Zhang, X.Y.; Chen, X.; Fan, L.L.; Ren, M.L.; Wu, Y.P.; Chanda, K.; Jiang, S.W. Synthetic paclitaxel-octreotide conjugate reverses the resistance of paclitaxel in A2780/Taxol ovarian cancer cell line. Oncol. Rep. 2017, 37, 219–226. [Google Scholar] [CrossRef]
- Thompson, E.G.; Sontheimer, H. Acetylcholine Receptor Activation as a Modulator of Glioblastoma Invasion. Cells 2019, 8, 1203. [Google Scholar] [CrossRef]
- Egleton, R.D.; Brown, K.C.; Dasgupta, P. Nicotinic acetylcholine receptors in cancer: Multiple roles in proliferation and inhibition of apoptosis. Trends Pharmacol. Sci. 2008, 29, 151–158. [Google Scholar] [CrossRef]
- McIntosh, J.M.; Yoshikami, D.; Mahe, E.; Nielsen, D.B.; Rivier, J.E.; Gray, W.R.; Olivera, B.M. A nicotinic acetylcholine receptor ligand of unique specificity, alpha-conotoxin ImI. J. Biol. Chem. 1994, 269, 16733–16739. [Google Scholar] [CrossRef]
- Kim, M.S.; Ma, S.; Chelariu-Raicu, A.; Leuschner, C.; Alila, H.W.; Lee, S.; Coleman, R.L.; Sood, A.K. Enhanced Immunotherapy with LHRH-R Targeted Lytic Peptide in Ovarian Cancer. Mol. Cancer Ther. 2020, 19, 2396–2406. [Google Scholar] [CrossRef]
- Saad, M.; Garbuzenko, O.B.; Ber, E.; Chandna, P.; Khandare, J.J.; Pozharov, V.P.; Minko, T. Receptor targeted polymers, dendrimers, liposomes: Which nanocarrier is the most efficient for tumor-specific treatment and imaging? J. Control. Release 2008, 130, 107–114. [Google Scholar] [CrossRef]
- Ghanghoria, R.; Tekade, R.K.; Mishra, A.K.; Chuttani, K.; Jain, N.K. Luteinizing hormone-releasing hormone peptide tethered nanoparticulate system for enhanced antitumoral efficacy of paclitaxel. Nanomedicine 2016, 11, 797–816. [Google Scholar] [CrossRef]
- Baun, C.; Naghavi-Behzad, M.; Hildebrandt, M.G.; Gerke, O.; Thisgaard, H. Gastrin-releasing peptide receptor as a theranostic target in breast cancer: A systematic scoping review. Semin. Nucl. Med. 2024, 54, 256–269. [Google Scholar] [CrossRef]
- Peng, S.; Zhan, Y.; Zhang, D.; Ren, L.; Chen, A.; Chen, Z.F.; Zhang, H. Structures of human gastrin-releasing peptide receptors bound to antagonist and agonist for cancer and itch therapy. Proc. Natl. Acad. Sci. USA 2023, 120, e2216230120. [Google Scholar] [CrossRef] [PubMed]
- Arap, M.A.; Lahdenranta, J.; Mintz, P.J.; Hajitou, A.; Sarkis, A.S.; Arap, W.; Pasqualini, R. Cell surface expression of the stress response chaperone GRP78 enables tumor targeting by circulating ligands. Cancer Cell 2004, 6, 275–284. [Google Scholar] [CrossRef] [PubMed]
- Zhang, W.; Wan, L.; Han, M.; Guo, W.; Wang, Z.; Zhang, X.; Liu, X.; Wang, J.; Mao, Y. Nose-to-brain drug delivery by HS15 micelles for brain targeting of insoluble drug. Acta Mater. Medica 2024, 3, 119–132. [Google Scholar] [CrossRef]
- Huang, Y.; Ma, Y.; Guo, Y.; Zou, L.; Jin, H.; Zhong, L.; Wu, Y.; Zhang, L.; Yang, Z. Exploring directional invasion of serum nuclease into siRNA duplexes by asymmetrical terminal modifications. ChemMedChem 2014, 9, 2111–2119. [Google Scholar] [CrossRef]
- Ma, Y.; Liu, S.; Wang, Y.; Zhao, Y.; Huang, Y.; Zhong, L.; Guan, Z.; Zhang, L.; Yang, Z. Isonucleotide incorporation into middle and terminal siRNA duplexes exhibits high gene silencing efficacy and nuclease resistance. Org. Biomol. Chem. 2017, 15, 5161–5170. [Google Scholar] [CrossRef] [PubMed]
- Li, F.; Lu, J.; Liu, J.; Liang, C.; Wang, M.; Wang, L.; Li, D.; Yao, H.; Zhang, Q.; Wen, J.; et al. A water-soluble nucleolin aptamer-paclitaxel conjugate for tumor-specific targeting in ovarian cancer. Nat. Commun. 2017, 8, 1390–1403. [Google Scholar] [CrossRef]
- Lin, Q.; Ma, X.; Hu, S.; Li, R.; Wei, X.; Han, B.; Ma, Y.; Liu, P.; Pang, Y. Overexpression of Nucleolin is a Potential Prognostic Marker in Endometrial Carcinoma. Cancer Manag. Res. 2021, 13, 1955–1965. [Google Scholar] [CrossRef]
- Chen, M.; Zhou, P.; Kong, Y.; Li, J.; Li, Y.; Zhang, Y.; Ran, J.; Zhou, J.; Chen, Y.; Xie, S. Inducible Degradation of Oncogenic Nucleolin Using an Aptamer-Based PROTAC. J. Med. Chem. 2023, 66, 1339–1348. [Google Scholar] [CrossRef]
- Ma, Y.; Xie, D.; Chen, Z.; Shen, X.; Wu, X.; Ding, F.; Ding, S.; Pan, Y.; Li, F.; Lu, A.; et al. Advancing targeted combination chemotherapy in triple negative breast cancer: Nucleolin aptamer-mediated controlled drug release. J. Transl. Med. 2024, 22, 604. [Google Scholar] [CrossRef]
- Hefler, L.A.; Concin, N.; Mincham, D.; Thompson, J.; Swarte, N.B.; van Eijkeren, M.A.; Sie-Go, D.M.; Hammond, I.; McCartney, A.J.; Tempfer, C.B.; et al. The prognostic value of immunohistochemically detected CD44v3 and CD44v6 expression in patients with surgically staged vulvar carcinoma: A multicenter study. Cancer 2002, 94, 125–130. [Google Scholar] [CrossRef]
- Wachowiak, R.; Rawnaq, T.; Metzger, R.; Quaas, A.; Fiegel, H.; Kahler, N.; Rolle, U.; Izbicki, J.R.; Kaifi, J.; Till, H. Universal expression of cell adhesion molecule NCAM in neuroblastoma in contrast to L1: Implications for different roles in tumor biology of neuroblastoma? Pediatr. Surg. Int. 2008, 24, 1361–1364. [Google Scholar] [CrossRef]
- Xue, F.; Lin, X.; Cai, Z.; Liu, X.; Ma, Y.; Wu, M. Doxifluridine-based pharmacosomes delivering mir-122 as tumor microenvironments-activated nanoplatforms for synergistic treatment of hepatocellular carcinoma. Colloids Surf. B Biointerfaces 2021, 197, 111367. [Google Scholar] [CrossRef]
- Lv, L.; Li, X.; Qian, W.; Li, S.; Jiang, Y.; Xiong, Y.; Xu, J.; Lv, W.; Liu, X.; Chen, Y.; et al. Enhanced anti-glioma efficacy by borneol combined with CGKRK-modified paclitaxel self-assembled redox-sensitive nanoparticles. Front. Pharmacol. 2020, 11, 558. [Google Scholar] [CrossRef] [PubMed]
- de Graauw, M.; van Miltenburg, M.H.; Schmidt, M.K.; Pont, C.; Lalai, R.; Kartopawiro, J.; Pardali, E.; Le Devedec, S.E.; Smit, V.T.; van der Wal, A.; et al. Annexin A1 regulates TGF-beta signaling and promotes metastasis formation of basal-like breast cancer cells. Proc. Natl. Acad. Sci. USA 2010, 107, 6340–6345. [Google Scholar] [CrossRef]
- McArthur, S.; Cristante, E.; Paterno, M.; Christian, H.; Roncaroli, F.; Gillies, G.E.; Solito, E. Annexin A1: A central player in the anti-inflammatory and neuroprotective role of microglia. J. Immunol. 2010, 185, 6317–6328. [Google Scholar] [CrossRef]
- Lim, S.H.; Saluja, A.; Vickers, S.; Hong, J.Y.; Kim, S.T.; Lavania, S.; Pandey, S.; Gupta, V.K.; Velagapudi, M.R.; Lee, J. The safety and efficacy outcomes of Minnelide given alone or in combination with paclitaxel in advanced gastric cancer: A phase I trial. Cancer Lett. 2024, 597, 217041. [Google Scholar] [CrossRef]
- Liu, Y.; Liang, J.; Zhu, R.; Yang, Y.; Wang, Y.; Wei, W.; Li, H.; Chen, L. Application of PROTACs in Target Identification and Target Validation. Acta Mater. Medica 2024, 3, 72–87. [Google Scholar] [CrossRef]
- Zhou, Y.; Xu, S.; López-Carrobles, N.; Ding, D.; Liu, X.; Menéndez-Arias, L.; Zhan, P. Recent advances in the molecular design and applications of proteolysis targeting chimera-based multi-specific antiviral modality. Acta Mater. Medica 2023, 2, 285–298. [Google Scholar] [CrossRef]
- Dong, W.; Lin, M.; Zhang, R.; Sun, X.; Li, H.; Liu, T.; Xu, Y.; Lv, L. d-mannose targets PD-1 to lysosomal degradation and enhances T cell-mediated anti-tumor immunity. Cancer Lett. 2024, 591, 216883. [Google Scholar] [CrossRef]
- Liu, J.K.; Lubelski, D.; Schonberg, D.L.; Wu, Q.; Hale, J.S.; Flavahan, W.A.; Mulkearns-Hubert, E.E.; Man, J.; Hjelmeland, A.B.; Yu, J.; et al. Phage display discovery of novel molecular targets in glioblastoma-initiating cells. Cell Death Differ. 2014, 21, 1325–1339. [Google Scholar] [CrossRef][Green Version]
- Wynendaele, E.; Verbeke, F.; Stalmans, S.; Gevaert, B.; Janssens, Y.; Van De Wiele, C.; Peremans, K.; Burvenich, C.; De Spiegeleer, B. Quorum Sensing Peptides Selectively Penetrate the Blood-Brain Barrier. PLoS ONE 2015, 10, e0142071. [Google Scholar] [CrossRef]
- Kandasamy, P.; Mori, S.; Matsuda, S.; Erande, N.; Datta, D.; Willoughby, J.L.S.; Taneja, N.; O’Shea, J.; Bisbe, A.; Manoharan, R.M.; et al. Metabolically Stable Anomeric Linkages Containing GalNAc-siRNA Conjugates: An Interplay among ASGPR, Glycosidase, and RISC Pathways. J. Med. Chem. 2023, 66, 2506–2523. [Google Scholar] [CrossRef] [PubMed]
- Ran, D.; Mao, J.; Zhan, C.; Xie, C.; Ruan, H.; Ying, M.; Zhou, J.; Lu, W.L.; Lu, W. d-Retroenantiomer of quorum-sensing peptide-modified polymeric micelles for brain tumor-targeted drug delivery. ACS Appl. Mater. Interfaces 2017, 9, 25672–25682. [Google Scholar] [CrossRef] [PubMed]
- Han, M.; Wang, H.; Zhang, H.T.; Han, Z. The PDZ protein TIP-1 facilitates cell migration and pulmonary metastasis of human invasive breast cancer cells in athymic mice. Biochem. Biophys. Res. Commun. 2012, 422, 139–145. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Han, M.; Whetsell, W., Jr.; Wang, J.; Rich, J.; Hallahan, D.; Han, Z. Tax-interacting protein 1 coordinates the spatiotemporal activation of Rho GTPases and regulates the infiltrative growth of human glioblastoma. Oncogene 2014, 33, 1558–1569. [Google Scholar] [CrossRef] [PubMed]
- Yao, J.-F.; Yang, H.; Zhao, Y.-Z.; Xue, M. Metabolism of peptide drugs and strategies to improve their metabolic stability. Curr. Drug Metab. 2018, 19, 892–901. [Google Scholar] [CrossRef]
- Puente, X.S.; Gutiérrez-Fernández, A.; Ordóñez, G.R.; Hillier, L.W.; López-Otín, C. Comparative genomic analysis of human and chimpanzee proteases. Genomics 2005, 86, 638–647. [Google Scholar] [CrossRef]
- Tugyi, R.; Mezö, G.; Fellinger, E.; Andreu, D.; Hudecz, F. The effect of cyclization on the enzymatic degradation of herpes simplex virus glycoprotein D derived epitope peptide. J. Pept. Sci. Off. Publ. Eur. Pept. Soc. 2005, 11, 642–649. [Google Scholar] [CrossRef]
- Di, L. Strategic approaches to optimizing peptide ADME properties. AAPS J. 2015, 17, 134–143. [Google Scholar] [CrossRef] [PubMed]
- Ballarotto, M.; Willems, S.; Stiller, T.; Nawa, F.; Marschner, J.A.; Grisoni, F.; Merk, D. De Novo Design of Nurr1 Agonists via Fragment-Augmented Generative Deep Learning in Low-Data Regime. J. Med. Chem. 2023, 66, 8170–8177. [Google Scholar] [CrossRef]
Target | High Expression 1 | Peptide Ligand | Sequence | Phase | Ref 2 |
---|---|---|---|---|---|
LRP-1 | Glioma cancer | Angiopep-2 | TFFYGGSRGKRNNFKTEEY | Clinical stage III | [28] |
RAP12 | EAKIEKHNHYQK | Preclinical | [29] | ||
AChR | Glioblastomas | ImI | Gc[Cc(CSDPRC]AWRC)-NH2 | Preclinical | [30] |
RVG | YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGC | Preclinical | [31] | ||
Annexin A1 | Gastric and breast cancers | IF-7 | IFLLWQR | Preclinical | [32] |
αvβ3 integrin α-3 integrin | Osteosarcomas, neuroblastomas, glioblastomas, malignant melanomas, breast, lung, and prostate cancers | iRGD | c[CRGDKGPDC] | Preclinical | [33,34,35] |
RGD | RGD/c[RGD] | Preclinical | [36,37,38] | ||
c(RGDfK) | c[RGDfK] | Preclinical | [39] | ||
PLZ4 | c[CQDGRMGFC] | Preclinical | [40] | ||
OA02 | cdG-HoCit-GPQc-Ebes-K-alkyne | Preclinical | [41] | ||
αvβ6 integrin | H2009.1 | DALRLQGTLR | Preclinical | [42] | |
CD44 isoforms | Pancreatic, ovarian, and liver cancers | A5G27 | Ac-KRLVSYNGIIFFLR | Preclinical | [43] |
EDB | Glioma cancer | APTEDB | SSSPIQGSWTWENGKCWTWKGIIRLEQ | Preclinical | [44] |
EGFR | Breast, head and neck, non-small cell lung, and prostate cancers | EGFR-p | YHWYGYTPQNVI-GGGSGGGSC | Preclinical | [45] |
AEYLR | AEYLR | Preclinical | [46] | ||
LT6 | LARLLT | Preclinical | [47] | ||
GRP78 | Glioma cancer | L-VAP | SNTRVAP | Preclinical | [48] |
D-VAP | sntrvap | Preclinical | |||
RI-VAP | pavrtns | Preclinical | |||
L-peptide | RLLDTNRPLLPY | Preclinical | [49] | ||
GIRLRG | GIRLRG | Preclinical | [50] | ||
GRPR | Breast, prostate, lung, and gastrointestinal cancers | BN | PYR-QRLGNQWAVGHLM-NH2 | Preclinical | [51] |
BBN(6_14) | YQWAVGHLM-NH2 | Preclinical | [52] | ||
Heparan sulfate | Glioma cancer | CGKRK | CGKRK | Preclinical | [53] |
LHRH-R | Breast, prostate, endometrial, ovarian, bladder, pancreatic, colorectal, renal, and hepatic cancers, uveal melanoma, melanoma, and non-Hodgkin lymphoma | AE105 | D-Cha-FsrYLWS | Preclinical | [54] |
Degarelix | Ac-DβNal-f(4-Cl)-γPal-S-F(4-S-dihydroorotamido)-f(4-ureido)-L-K(iPr)-P-a-NH2 | Preclinical | [55] | ||
NCAM | Glioblastoma, melanoma, neuroblastoma, and small cell lung cancers | NTP | GASKKPAANIKA | Preclinical | [56] |
NRP-1 | Ovarian, breast, prostate, and pancreatic cancers | iNGR | c[CRNGRGPDC] | Preclinical | [57,58] |
CK3 | CLKADKAKC | Preclinical | [59] | ||
RGE | RGERPPR | Preclinical | [60] | ||
A7R | ATWLPPR | Preclinical | [61] | ||
tLyP-1 | CGNKRTR | Preclinical | [62] | ||
NCL | Ovarian, gastric, breast, liver and non-small cell lung cancers, pancreatic ductal adeno-carcinoma, and acute myeloid leukemia | AGM-330 | RHGAMVYLK | Preclinical | [63] |
F3 | KDEPQRRSARLSAKPAPPKPEPKPKKAPAKKC | Preclinical | [64] | ||
PD-L1 | Ovarian, melanoma, and lung cancers | D-PPA-1 | nyskptdrqyhf | Preclinical | [65] |
SSTR2 | Glioma cancer | Tyr-3-octreotide | F c[CYWK-ξThr-C]-ξThr-ol | Preclinical | [66] |
lanreotide | βNal-c[CVKWYC]T-NH2 | Preclinical | [67,68] | ||
TfR | Breast, liver, brain, lung, ovarian, thyroid, esophageal, and colon cancers | TfR-T12 | THRPPMWSPVWP | Preclinical | [69] |
T7 | HAIYPRH | Preclinical | [70] | ||
DT7 | haiyprh | Preclinical | [71] | ||
TIP-1 | Breast cancer and glioblastoma | HVGGSSV | HVGGSSV | Preclinical | [72] |
VAV3 | Glioma cancer | GICP | SSQPFWS | Preclinical | [73] |
WSW | SYPGWSW | Preclinical | [48] | ||
VEGFR2 | Ovarian, colorectal, and breast cancers | APRPG | APRPG | Preclinical | [74] |
K237 | HTMYYHHYQHHL | Preclinical | [75] | ||
A7R | ATWLPPR | Preclinical | [76] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Shen, X.; Ma, Y.; Luo, H.; Abdullah, R.; Pan, Y.; Zhang, Y.; Zhong, C.; Zhang, B.; Zhang, G. Peptide Aptamer–Paclitaxel Conjugates for Tumor Targeted Therapy. Pharmaceutics 2025, 17, 40. https://doi.org/10.3390/pharmaceutics17010040
Shen X, Ma Y, Luo H, Abdullah R, Pan Y, Zhang Y, Zhong C, Zhang B, Zhang G. Peptide Aptamer–Paclitaxel Conjugates for Tumor Targeted Therapy. Pharmaceutics. 2025; 17(1):40. https://doi.org/10.3390/pharmaceutics17010040
Chicago/Turabian StyleShen, Xinyang, Yuan Ma, Hang Luo, Razack Abdullah, Yufei Pan, Yihao Zhang, Chuanxin Zhong, Baoting Zhang, and Ge Zhang. 2025. "Peptide Aptamer–Paclitaxel Conjugates for Tumor Targeted Therapy" Pharmaceutics 17, no. 1: 40. https://doi.org/10.3390/pharmaceutics17010040
APA StyleShen, X., Ma, Y., Luo, H., Abdullah, R., Pan, Y., Zhang, Y., Zhong, C., Zhang, B., & Zhang, G. (2025). Peptide Aptamer–Paclitaxel Conjugates for Tumor Targeted Therapy. Pharmaceutics, 17(1), 40. https://doi.org/10.3390/pharmaceutics17010040