Peptide Shuttles for Blood–Brain Barrier Drug Delivery
Abstract
:1. Introduction
2. The Blood–Brain Barrier
3. Peptides Designed to Increase Passive Transport of Drugs
4. Peptides Designed to Increase Active Transport of Drugs
5. Sources of BBB Shuttles
5.1. Natural Proteins
5.2. Phage Display
5.3. Chemical Libraries
5.4. Optimization
5.5. Computational Prediction
6. Conclusions
Funding
Conflicts of Interest
References
- Feigin, V.L.; Nichols, E.; Alam, T.; Bannick, M.S.; Beghi, E.; Blake, N.; Culpepper, W.J.; Dorsey, E.R.; Elbaz, A.; Ellenbogen, R.G.; et al. Global, Regional, and National Burden of Neurological Disorders, 1990–2016: A Systematic Analysis for the Global Burden of Disease Study 2016. Lancet Neurol. 2019, 18, 459–480. [Google Scholar] [CrossRef]
- Pardridge, W.M. The blood-brain barrier: Bottleneck in brain drug development. NeuroRX 2005, 2, 3–14. [Google Scholar] [CrossRef] [PubMed]
- Daneman, R.; Prat, A. The Blood–Brain Barrier. Cold Spring Harb. Perspect. Biol. 2015, 7, a020412. [Google Scholar] [CrossRef] [PubMed]
- Pardridge, W.M. Receptor-Mediated Peptide Transport through the Blood-Brain Barrier. Endocr. Rev. 1986, 7, 314–330. [Google Scholar] [CrossRef]
- Terstappen, G.C.; Meyer, A.H.; Bell, R.D.; Zhang, W. Strategies for delivering therapeutics across the blood–brain barrier. Nat. Rev. Drug Discov. 2021, 20, 362–383. [Google Scholar] [CrossRef] [PubMed]
- Bors, L.A.; Erdő, F. Overcoming the Blood–Brain Barrier. Challenges and Tricks for CNS Drug Delivery. Sci. Pharm. 2019, 87, 6. [Google Scholar] [CrossRef]
- Puris, E.; Fricker, G.; Gynther, M. Targeting Transporters for Drug Delivery to the Brain: Can We Do Better? Pharm. Res. 2022, 39, 1415–1455. [Google Scholar] [CrossRef] [PubMed]
- Oller-Salvia, B.; Sánchez-Navarro, M.; Giralt, E.; Teixidó, M. Blood–brain barrier shuttle peptides: An emerging paradigm for brain delivery. Chem. Soc. Rev. 2016, 45, 4690–4707. [Google Scholar] [CrossRef]
- Abulrob, A.; Zhang, J.; Tanha, J.; MacKenzie, R.; Stanimirovic, D. Single domain antibodies as blood–brain barrier delivery vectors. Int. Congr. Ser. 2005, 1277, 212–223. [Google Scholar] [CrossRef]
- Niewoehner, J.; Bohrmann, B.; Collin, L.; Urich, E.; Sade, H.; Maier, P.; Rueger, P.; Stracke, J.O.; Lau, W.; Tissot, A.C.; et al. Increased Brain Penetration and Potency of a Therapeutic Antibody Using a Monovalent Molecular Shuttle. Neuron 2014, 81, 49–60. [Google Scholar] [CrossRef] [Green Version]
- Pardridge, W.M. Blood-Brain Barrier and Delivery of Protein and Gene Therapeutics to Brain. Front. Aging Neurosci. 2020, 11, 373. [Google Scholar] [CrossRef]
- Pardridge, W.M. Kinetics of Blood–Brain Barrier Transport of Monoclonal Antibodies Targeting the Insulin Receptor and the Transferrin Receptor. Pharmaceuticals 2022, 15, 3. [Google Scholar] [CrossRef]
- Giugliani, R.; Giugliani, L.; de Oliveira Poswar, F.; Donis, K.C.; Corte, A.D.; Schmidt, M.; Boado, R.J.; Nestrasil, I.; Nguyen, C.; Chen, S.; et al. Neurocognitive and somatic stabilization in pediatric patients with severe Mucopolysaccharidosis Type I after 52 weeks of intravenous brain-penetrating insulin receptor antibody-iduronidase fusion protein (valanafusp alpha): An open label phase 1-2 trial. Orphanet J. Rare Dis. 2018, 13, 110. [Google Scholar] [CrossRef]
- Schwarze, S.R.; Ho, A.; Vocero-Akbani, A.; Dowdy, S.F. In Vivo Protein Transduction: Delivery of a Biologically Active Protein into the Mouse. Science 1999, 285, 1569–1572. [Google Scholar] [CrossRef]
- Sánchez-Navarro, M.; Giralt, E.; Teixidó, M. Blood–brain barrier peptide shuttles. Curr. Opin. Chem. Biol. 2017, 38, 134–140. [Google Scholar] [CrossRef]
- Abbott, N.J.; Patabendige, A.A.K.; Dolman, D.E.M.; Yusof, S.R.; Begley, D.J. Structure and function of the blood-brain barrier. Neurobiol. Dis. 2010, 37, 13–25. [Google Scholar] [CrossRef]
- Nagpal, K.; Singh, S.K.; Mishra, D.N. Drug targeting to brain: A systematic approach to study the factors, parameters and approaches for prediction of permeability of drugs across BBB. Expert Opin. Drug Deliv. 2013, 10, 927–955. [Google Scholar] [CrossRef]
- Okuyama, T.; Eto, Y.; Sakai, N.; Minami, K.; Yamamoto, T.; Sonoda, H.; Yamaoka, M.; Tachibana, K.; Hirato, T.; Sato, Y. Iduronate-2-Sulfatase with Anti-human Transferrin Receptor Antibody for Neuropathic Mucopolysaccharidosis II: A Phase 1/2 Trial. Mol. Ther. 2019, 27, 456–464. [Google Scholar] [CrossRef]
- Teixidó, M.; Zurita, E.; Malakoutikhah, M.; Tarragó, A.T.; Giralt, E. Diketopiperazines as a Tool for the Study of Transport across the Blood−Brain Barrier (BBB) and Their Potential Use as BBB-Shuttles. J. Am. Chem. Soc. 2007, 129, 11802–11813. [Google Scholar] [CrossRef]
- Malakoutikhah, M.; Guixer, B.; Arranz-Gibert, P.; Teixidó, M.; Giralt, E. ‘À la Carte’ Peptide Shuttles: Tools to Increase Their Passage across the Blood-Brain Barrier. ChemMedChem 2014, 9, 1594–1601. [Google Scholar] [CrossRef]
- Arranz-Gibert, P.; Guixer, B.; Malakoutikhah, M.; Muttenthaler, M.; Guzmán, F.; Teixidó, M.; Giralt, E. Lipid Bilayer Crossing—The Gate of Symmetry. Water-Soluble Phenylproline-Based Blood-Brain Barrier Shuttles. J. Am. Chem. Soc. 2015, 137, 7357–7364. [Google Scholar] [CrossRef] [PubMed]
- Virgone-Carlotta, A.; Dufour, E.; Bacot, S.; Ahmadi, M.; Cornou, M.; Moni, L.; Garcia, J.; Chierici, S.; Garin, D.; Marti-Batlle, D.; et al. New diketopiperazines as vectors for peptide protection and brain delivery: Synthesis and biological evaluation. J. Label. Compd. Radiopharm. 2016, 59, 517–530. [Google Scholar] [CrossRef]
- Malakoutikhah, M.; Teixido, M.; Giralt, E. Toward an Optimal Blood−Brain Barrier Shuttle by Synthesis and Evaluation of Peptide Libraries. J. Med. Chem. 2008, 51, 4881–4889. [Google Scholar] [CrossRef]
- Fadzen, C.M.; Wolfe, J.M.; Cho, C.-F.; Chiocca, E.A.; Lawler, S.E.; Pentelute, B.L. Perfluoroarene–Based Peptide Macrocycles to Enhance Penetration Across the Blood–Brain Barrier. J. Am. Chem. Soc. 2017, 139, 15628–15631. [Google Scholar] [CrossRef]
- Dithmer, S.; Staat, C.; Müller, C.; Ku, M.-C.; Pohlmann, A.; Niendorf, T.; Gehne, N.; Fallier-Becker, P.; Kittel, Á.; Walter, F.R.; et al. Claudin peptidomimetics modulate tissue barriers for enhanced drug delivery. Ann. N. Y. Acad. Sci. 2017, 1397, 169–184. [Google Scholar] [CrossRef]
- Kiptoo, P.; Sinaga, E.; Calcagno, A.M.; Zhao, H.; Kobayashi, N.; Tambunan, U.S.F.; Siahaan, T.J. Enhancement of Drug Absorption through the Blood−Brain Barrier and Inhibition of Intercellular Tight Junction Resealing by E-Cadherin Peptides. Mol. Pharm. 2011, 8, 239–249. [Google Scholar] [CrossRef]
- Wong, V.; Gumbiner, B.M. A Synthetic Peptide Corresponding to the Extracellular Domain of Occludin Perturbs the Tight Junction Permeability Barrier. J. Cell Biol. 1997, 136, 399–409. [Google Scholar] [CrossRef]
- On, N.H.; Kiptoo, P.; Siahaan, T.J.; Miller, D.W. Modulation of Blood–Brain Barrier Permeability in Mice Using Synthetic E-Cadherin Peptide. Mol. Pharm. 2014, 11, 974–981. [Google Scholar] [CrossRef]
- Ulapane, K.R.; Kopec, B.M.; Siahaan, T.J. In Vivo Brain Delivery and Brain Deposition of Proteins with Various Sizes. Mol. Pharm. 2019, 16, 4878–4889. [Google Scholar] [CrossRef]
- Aasen, S.N.; Espedal, H.; Holte, C.F.; Keunen, O.; Karlsen, T.V.; Tenstad, O.; Maherally, Z.; Miletic, H.; Hoang, T.; Eikeland, A.V.; et al. Improved Drug Delivery to Brain Metastases by Peptide-Mediated Permeabilization of the Blood–Brain Barrier. Mol. Cancer Ther. 2019, 18, 2171–2181. [Google Scholar] [CrossRef] [Green Version]
- Linville, R.M.; Komin, A.; Lan, X.; DeStefano, J.G.; Chu, C.; Liu, G.; Walczak, P.; Hristova, K.; Searson, P.C. Reversible blood-brain barrier opening utilizing the membrane active peptide melittin in vitro and in vivo. Biomaterials 2021, 275, 120942. [Google Scholar] [CrossRef] [PubMed]
- Uchida, Y.; Ohtsuki, S.; Katsukura, Y.; Ikeda, C.; Suzuki, T.; Kamiie, J.; Terasaki, T. Quantitative targeted absolute proteomics of human blood-brain barrier transporters and receptors. J. Neurochem. 2011, 117, 333–345. [Google Scholar] [CrossRef] [PubMed]
- Zuchero, Y.J.Y.; Chen, X.; Bien-Ly, N.; Bumbaca, D.; Tong, R.K.; Gao, X.; Zhang, S.; Hoyte, K.; Luk, W.; Huntley, M.A.; et al. Discovery of Novel Blood-Brain Barrier Targets to Enhance Brain Uptake of Therapeutic Antibodies. Neuron 2016, 89, 70–82. [Google Scholar] [CrossRef]
- Zhang, W.; Liu, Q.Y.; Haqqani, A.S.; Leclerc, S.; Liu, Z.; Fauteux, F.; Baumann, E.; Delaney, C.E.; Ly, D.; Star, A.T.; et al. Differential expression of receptors mediating receptor-mediated transcytosis (RMT) in brain microvessels, brain parenchyma and peripheral tissues of the mouse and the human. Fluids Barriers CNS 2020, 17, 47. [Google Scholar] [CrossRef] [PubMed]
- Tam, S.J.; Richmond, D.L.; Kaminker, J.S.; Modrusan, Z.; Martin-McNulty, B.; Cao, T.C.; Weimer, R.M.; Carano, R.A.; van Bruggen, N.; Watts, R.J. Death Receptors DR6 and TROY Regulate Brain Vascular Development. Dev. Cell 2012, 22, 403–417. [Google Scholar] [CrossRef]
- Demeule, M.; Régina, A.; Ché, C.; Poirier, J.; Nguyen, T.; Gabathuler, R.; Castaigne, J.-P.; Béliveau, R. Identification and Design of Peptides as a New Drug Delivery System for the Brain. J. Pharmacol. Exp. Ther. 2008, 324, 1064–1072. [Google Scholar] [CrossRef]
- Shen, J.; Zhan, C.; Xie, C.; Meng, Q.; Gu, B.; Li, C.; Zhang, Y.; Lu, W. Poly(ethylene glycol)-block-poly(d,l-lactide acid) micelles anchored with angiopep-2 for brain-targeting delivery. J. Drug Target. 2011, 19, 197–203. [Google Scholar] [CrossRef]
- Velasco-Aguirre, C.; Morales-Zavala, F.; Salas-Huenuleo, E.; Gallardo-Toledo, E.; Andonie, O.; Muñoz, L.; Rojas, X.; Acosta, G.; Sánchez-Navarro, M.; Giralt, E.; et al. Improving gold nanorod delivery to the central nervous system by conjugation to the shuttle Angiopep-2. Nanomedicine 2017, 12, 2503–2517. [Google Scholar] [CrossRef]
- Demeule, M.; Beaudet, N.; Régina, A.; Besserer-Offroy, É.; Murza, A.; Tétreault, P.; Belleville, K.; Ché, C.; Larocque, A.; Thiot, C.; et al. Conjugation of a brain-penetrant peptide with neurotensin provides antinociceptive properties. J. Clin. Investig. 2014, 124, 1199–1213. [Google Scholar] [CrossRef]
- Eiselt, E.; Otis, V.; Belleville, K.; Yang, G.; Larocque, A.; Regina, A.; Demeule, M.; Sarret, P.; Gendron, L. Use of a Noninvasive Brain-Penetrating Peptide-Drug Conjugate Strategy to Improve the Delivery of Opioid Pain Relief Medications to the Brain. J. Pharmacol. Exp. Ther. 2020, 374, 52–61. [Google Scholar] [CrossRef] [Green Version]
- Regina, A.; Demeule, M.; Tripathy, S.; Lord-Dufour, S.; Currie, J.-C.; Iddir, M.; Annabi, B.; Castaigne, J.-P.; Lachowicz, J.E. ANG4043, a Novel Brain-Penetrant Peptide–mAb Conjugate, Is Efficacious against HER2-Positive Intracranial Tumors in Mice. Mol. Cancer Ther. 2015, 14, 129–140. [Google Scholar] [CrossRef] [PubMed]
- Anami, Y.; Xiong, W.; Yamaguchi, A.; Yamazaki, C.M.; Zhang, N.; An, Z.; Tsuchikama, K. Homogeneous antibody–angiopep 2 conjugates for effective brain targeting. RSC Adv. 2022, 12, 3359–3364. [Google Scholar] [CrossRef]
- Régina, A.; Demeule, M.; Ché, C.; Lavallée, I.; Poirier, J.; Gabathuler, R.; Béliveau, R.; Castaigne, J.-P. Antitumour activity of ANG1005, a conjugate between paclitaxel and the new brain delivery vector Angiopep-2. Br. J. Pharmacol. 2008, 155, 185–197. [Google Scholar] [CrossRef] [PubMed]
- Ché, C.; Yang, G.; Thiot, C.; Lacoste, M.-C.; Currie, J.-C.; Demeule, M.; Régina, A.; Béliveau, R.; Castaigne, J.-P. New Angiopep-Modified Doxorubicin (ANG1007) and Etoposide (ANG1009) Chemotherapeutics With Increased Brain Penetration. J. Med. Chem. 2010, 53, 2814–2824. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.H.; Engler, J.A.; Collawn, J.F.; Moore, B.A. Receptor mediated uptake of peptides that bind the human transferrin receptor. Eur. J. Biochem. 2001, 268, 2004–2012. [Google Scholar] [CrossRef] [PubMed]
- Wang, D.; El-Amouri, S.S.; Dai, M.; Kuan, C.-Y.; Hui, D.Y.; Brady, R.O.; Pan, D. Engineering a lysosomal enzyme with a derivative of receptor-binding domain of apoE enables delivery across the blood–brain barrier. Proc. Natl. Acad. Sci. USA 2013, 110, 2999–3004. [Google Scholar] [CrossRef]
- Böckenhoff, A.; Cramer, S.; Wölte, P.; Knieling, S.; Wohlenberg, C.; Gieselmann, V.; Galla, H.-J.; Matzner, U. Comparison of Five Peptide Vectors for Improved Brain Delivery of the Lysosomal Enzyme Arylsulfatase A. J. Neurosci. 2014, 34, 3122–3129. [Google Scholar] [CrossRef]
- Meng, Y.; Wiseman, J.A.; Nemtsova, Y.; Moore, D.F.; Guevarra, J.; Reuhl, K.; Banks, W.A.; Daneman, R.; Sleat, D.E.; Lobel, P. A Basic ApoE-Based Peptide Mediator to Deliver Proteins across the Blood-Brain Barrier: Long-Term Efficacy, Toxicity, and Mechanism. Mol. Ther. 2017, 25, 1531–1543. [Google Scholar] [CrossRef]
- Kurzrock, R.; Gabrail, N.; Chandhasin, C.; Moulder, S.; Smith, C.; Brenner, A.; Sankhala, K.; Mita, A.; Elian, K.; Bouchard, D.; et al. Safety, Pharmacokinetics, and Activity of GRN1005, a Novel Conjugate of Angiopep-2, a Peptide Facilitating Brain Penetration, and Paclitaxel, in Patients with Advanced Solid Tumors. Mol. Cancer Ther. 2012, 11, 308–316. [Google Scholar] [CrossRef]
- Drappatz, J.; Brenner, A.; Wong, E.T.; Eichler, A.; Schiff, D.; Groves, M.D.; Mikkelsen, T.; Rosenfeld, S.; Sarantopoulos, J.; Meyers, C.A.; et al. Phase I Study of GRN1005 in Recurrent Malignant Glioma. Clin. Cancer Res. 2013, 19, 1567–1576. [Google Scholar] [CrossRef] [Green Version]
- Moroo, I.; Ujiie, M.; Walker, B.L.; Tiong, J.W.; Vitalis, T.Z.; Karkan, D.; Gabathuler, R.; Moise, A.R.; Jefferies, W.A. Identification of a Novel Route of Iron Transcytosis across the Mammalian Blood-Brain Barrier. Microcirculation 2003, 10, 457–462. [Google Scholar] [CrossRef] [PubMed]
- Demeule, M.; Poirier, J.; Jodoin, J.; Bertrand, Y.; Desrosiers, R.R.; Dagenais, C.; Nguyen, T.; Lanthier, J.; Gabathuler, R.; Kennard, M.; et al. High transcytosis of melanotransferrin (P97) across the blood-brain barrier. J. Neurochem. 2002, 83, 924–933. [Google Scholar] [CrossRef] [PubMed]
- Karkan, D.; Pfeifer, C.; Vitalis, T.Z.; Arthur, G.; Ujiie, M.; Chen, Q.; Tsai, S.; Koliatis, G.; Gabathuler, R.; Jefferies, W.A. A Unique Carrier for Delivery of Therapeutic Compounds beyond the Blood-Brain Barrier. PLoS ONE 2008, 3, e2469. [Google Scholar] [CrossRef]
- Nounou, M.I.; Adkins, C.E.; Rubinchik, E.; Terrell-Hall, T.B.; Afroz, M.; Vitalis, T.; Gabathuler, R.; Tian, M.M.; Lockman, P.R. Anti-cancer Antibody Trastuzumab-Melanotransferrin Conjugate (BT2111) for the Treatment of Metastatic HER2+ Breast Cancer Tumors in the Brain: An In-Vivo Study. Pharm. Res. 2016, 33, 2930–2942. [Google Scholar] [CrossRef] [PubMed]
- Singh, C.S.B.; Eyford, B.A.; Abraham, T.; Munro, L.; Choi, K.B.; Okon, M.; Vitalis, T.Z.; Gabathuler, R.; Lu, C.-J.; Pfeifer, C.G.; et al. Discovery of a Highly Conserved Peptide in the Iron Transporter Melanotransferrin that Traverses an Intact Blood Brain Barrier and Localized in Neural Cells. Front. Neurosci. 2021, 15, 473. [Google Scholar] [CrossRef]
- Thom, G.; Tian, M.-M.; Hatcher, J.P.; Rodrigo, N.; Burrell, M.; Gurrell, I.; Vitalis, T.Z.; Abraham, T.; Jefferies, W.A.; I Webster, C.; et al. A peptide derived from melanotransferrin delivers a protein-based interleukin 1 receptor antagonist across the BBB and ameliorates neuropathic pain in a preclinical model. J. Cereb. Blood Flow Metab. 2018, 39, 2074–2088. [Google Scholar] [CrossRef]
- Kumar, P.; Wu, H.; McBride, J.L.; Jung, K.-E.; Kim, M.H.; Davidson, B.; Lee, S.K.; Shankar, P.; Manjunath, N. Transvascular delivery of small interfering RNA to the central nervous system. Nature 2007, 448, 39–43. [Google Scholar] [CrossRef]
- Neves, V.; Aires-Da-Silva, F.; Morais, M.; Gano, L.; Ribeiro, E.; Pinto, A.; Aguiar, S.; Gaspar, D.; Fernandes, C.; Correia, J.D.G.; et al. Novel Peptides Derived from Dengue Virus Capsid Protein Translocate Reversibly the Blood–Brain Barrier through a Receptor-Free Mechanism. ACS Chem. Biol. 2017, 12, 1257–1268. [Google Scholar] [CrossRef]
- Oller-Salvia, B.; Sánchez-Navarro, M.; Ciudad, S.; Guiu, M.; Arranz-Gibert, P.; Garcia, C.; Gomis, R.R.; Cecchelli, R.; García, J.; Giralt, E.; et al. MiniAp-4: A Venom-Inspired Peptidomimetic for Brain Delivery. Angew. Chem. Int. Ed. 2016, 55, 572–575. [Google Scholar] [CrossRef]
- Díaz-Perlas, C.; Varese, M.; Guardiola, S.; García, J.; Sánchez-Navarro, M.; Giralt, E.; Teixidó, M. From venoms to BBB-shuttles. MiniCTX3: A molecular vector derived from scorpion venom. Chem. Commun. 2018, 54, 12738–12741. [Google Scholar] [CrossRef]
- Salinas, S.; Schiavo, G.; Kremer, E. A hitchhiker's guide to the nervous system: The complex journey of viruses and toxins. Nat. Rev. Microbiol. 2010, 8, 645–655. [Google Scholar] [CrossRef] [PubMed]
- Lentz, T.L.; Hawrot, E.; Wilson, P.T. Synthetic peptides corresponding to sequences of snake venom neurotoxins and rabies virus glycoprotein bind to the nicotinic acetylcholine receptor. Proteins Struct. Funct. Bioinform. 1987, 2, 298–307. [Google Scholar] [CrossRef]
- Oswald, M.; Geissler, S.; Goepferich, A. Targeting the Central Nervous System (CNS): A Review of Rabies Virus-Targeting Strategies. Mol. Pharm. 2017, 14, 2177–2196. [Google Scholar] [CrossRef] [PubMed]
- Cavaco, M.; Frutos, S.; Oliete, P.; Valle, J.; Andreu, D.; Castanho, M.A.R.B.; Vila-Perelló, M.; Neves, V. Conjugation of a Blood Brain Barrier Peptide Shuttle to an Fc Domain for Brain Delivery of Therapeutic Biomolecules. ACS Med. Chem. Lett. 2021, 12, 1663–1668. [Google Scholar] [CrossRef]
- Mendonça, D.A.; Bakker, M.; Cruz-Oliveira, C.; Neves, V.; Jiménez, M.A.; Defaus, S.; Cavaco, M.; Veiga, A.S.; Cadima-Couto, I.; Castanho, M.A.R.B.; et al. Penetrating the Blood-Brain Barrier with New Peptide–Porphyrin Conjugates Having anti-HIV Activity. Bioconj. Chem. 2021, 32, 1067–1077. [Google Scholar] [CrossRef] [PubMed]
- King, G.F. Venoms as a platform for human drugs: Translating toxins into therapeutics. Expert Opin. Biol. Ther. 2011, 11, 1469–1484. [Google Scholar] [CrossRef] [PubMed]
- De Castro Figueiredo Bordon, K.; Cologna, C.T.; Fornari-Baldo, E.C.; Pinheiro-Júnior, E.L.; Cerni, F.A.; Amorim, F.G.; Anjolette, F.A.P.; Cordeiro, F.A.; Wiezel, G.A.; Cardoso, I.A.; et al. From Animal Poisons and Venoms to Medicines: Achievements, Challenges and Perspectives in Drug Discovery. Front. Pharmacol. 2020, 11, 1132. [Google Scholar] [CrossRef]
- Ojeda, P.G.; Wang, C.; Craik, D.J. Chlorotoxin: Structure, activity, and potential uses in cancer therapy. Pept. Sci. 2015, 106, 25–36. [Google Scholar] [CrossRef]
- Andrieu, J.; Re, F.; Russo, L.; Nicotra, F. Phage-displayed peptides targeting specific tissues and organs. J. Drug Target. 2019, 27, 555–565. [Google Scholar] [CrossRef]
- Xia, H.; Anderson, B.; Mao, Q.; Davidson, B.L. Recombinant Human Adenovirus: Targeting to the Human Transferrin Receptor Improves Gene Transfer to Brain Microcapillary Endothelium. J. Virol. 2000, 74, 11359–11366. [Google Scholar] [CrossRef] [Green Version]
- Liu, J.K.; Teng, Q.; Garrity-Moses, M.; Federici, T.; Tanase, D.; Imperiale, M.J.; Boulis, N.M. A novel peptide defined through phage display for therapeutic protein and vector neuronal targeting. Neurobiol. Dis. 2005, 19, 407–418. [Google Scholar] [CrossRef] [PubMed]
- Malcor, J.-D.; Payrot, N.; David, M.; Faucon, A.; Abouzid, K.; Jacquot, G.; Floquet, N.; Debarbieux, F.; Rougon, G.; Martinez, J.; et al. Chemical Optimization of New Ligands of the Low-Density Lipoprotein Receptor as Potential Vectors for Central Nervous System Targeting. J. Med. Chem. 2012, 55, 2227–2241. [Google Scholar] [CrossRef] [PubMed]
- Díaz-Perlas, C.; Sánchez-Navarro, M.; Oller-Salvia, B.; Moreno, M.; Teixidó, M.; Giralt, E. Phage display as a tool to discover blood-brain barrier (BBB)-shuttle peptides: Panning against a human BBB cellular model. Biopolymers 2017, 108, e22928. [Google Scholar] [CrossRef] [PubMed]
- Yamaguchi, S.; Ito, S.; Masuda, T.; Couraud, P.-O.; Ohtsuki, S. Novel cyclic peptides facilitating transcellular blood-brain barrier transport of macromolecules in vitro and in vivo. J. Control. Release 2020, 321, 744–755. [Google Scholar] [CrossRef]
- Majerova, P.; Hanes, J.; Olesova, D.; Sinsky, J.; Pilipcinec, E.; Kovac, A. Novel Blood–Brain Barrier Shuttle Peptides Discovered through the Phage Display Method. Molecules 2020, 25, 874. [Google Scholar] [CrossRef] [PubMed]
- Pasqualini, R.; Ruoslahti, E. Organ targeting In vivo using phage display peptide libraries. Nature 1996, 380, 364–366. [Google Scholar] [CrossRef]
- Fan, X.; Venegas, R.; Fey, R.; van der Heyde, H.; Bernard, M.A.; Lazarides, E.; Woods, C.M. An In Vivo Approach to Structure Activity Relationship Analysis of Peptide Ligands. Pharm. Res. 2007, 24, 868–879. [Google Scholar] [CrossRef] [PubMed]
- Zhang, X.; Chai, Z.; Dobbins, A.L.; Itano, M.S.; Askew, C.; Miao, Z.; Niu, H.; Samulski, R.J.; Li, C. Customized blood-brain barrier shuttle peptide to increase AAV9 vector crossing the BBB and augment transduction in the brain. Biomaterials 2022, 281, 121340. [Google Scholar] [CrossRef]
- Acharya, B.; Meka, R.R.; Venkatesha, S.H.; Lees, J.R.; Teesalu, T.; Moudgil, K.D. A novel CNS-homing peptide for targeting neuroinflammatory lesions in experimental autoimmune encephalomyelitis. Mol. Cell. Probes 2020, 51, 101530. [Google Scholar] [CrossRef]
- van Rooy, I.; Cakir-Tascioglu, S.; Couraud, P.-O.; Romero, I.; Weksler, B.; Storm, G.; Hennink, W.E.; Schiffelers, R.; Mastrobattista, E. Identification of Peptide Ligands for Targeting to the Blood-Brain Barrier. Pharm. Res. 2010, 27, 673–682. [Google Scholar] [CrossRef] [Green Version]
- Li, J.; Feng, L.; Fan, L.; Zha, Y.; Guo, L.; Zhang, Q.; Chen, J.; Pang, Z.; Wang, Y.; Jiang, X.; et al. Targeting the brain with PEG–PLGA nanoparticles modified with phage-displayed peptides. Biomaterials 2011, 32, 4943–4950. [Google Scholar] [CrossRef] [PubMed]
- Staquicini, F.I.; Ozawa, M.G.; Moya, C.A.; Driessen, W.H.; Barbu, E.M.; Nishimori, H.; Soghomonyan, S.; Flores, L.G.; Liang, X.; Paolillo, V.; et al. Systemic combinatorial peptide selection yields a non-canonical iron-mimicry mechanism for targeting tumors in a mouse model of human glioblastoma. J. Clin. Investig. 2011, 121, 161–173. [Google Scholar] [CrossRef]
- Li, J.; Zhang, Q.; Pang, Z.; Wang, Y.; Liu, Q.; Guo, L.; Jiang, X. Identification of peptide sequences that target to the brain using in vivo phage display. Amino Acids 2012, 42, 2373–2381. [Google Scholar] [CrossRef]
- Smith, M.W.; Al-Jayyoussi, G.; Gumbleton, M. Peptide sequences mediating tropism to intact blood–brain barrier: An in vivo biodistribution study using phage display. Peptides 2012, 38, 172–180. [Google Scholar] [CrossRef] [PubMed]
- Li, J.; Feng, L.; Jiang, X. In vivo phage display screen for peptide sequences that cross the blood–cerebrospinal-fluid barrier. Amino Acids 2015, 47, 401–405. [Google Scholar] [CrossRef]
- Urich, E.; Schmucki, R.; Ruderisch, N.; Kitas, E.; Certa, U.; Jacobsen, H.; Schweitzer, C.; Bergadano, A.; Ebeling, M.; Loetscher, H.; et al. Cargo Delivery into the Brain by in vivo identified Transport Peptides. Sci. Rep. 2015, 5, 14104. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Zeng, D.; Xu, N.; Li, C.; Zhang, W.; Zhu, X.-J.; Gao, Y.; Chen, P.R.; Lin, J. Blood–Brain Barrier- and Blood–Brain Tumor Barrier-Penetrating Peptide-Derived Targeted Therapeutics for Glioma and Malignant Tumor Brain Metastases. ACS Appl. Mater. Interfaces 2019, 11, 41889–41897. [Google Scholar] [CrossRef]
- He, B.; Chai, G.; Duan, Y.; Yan, Z.; Qiu, L.; Zhang, H.; Liu, Z.; He, Q.; Han, K.; Ru, B.; et al. BDB: Biopanning data bank. Nucleic Acids Res. 2016, 44, D1127–D1132. [Google Scholar] [CrossRef]
- Macarron, R.; Banks, M.N.; Bojanic, D.; Burns, D.J.; Cirovic, D.A.; Garyantes, T.; Green, D.V.S.; Hertzberg, R.P.; Janzen, W.P.; Paslay, J.W.; et al. Impact of high-throughput screening in biomedical research. Nat. Rev. Drug Discov. 2011, 10, 188–195. [Google Scholar] [CrossRef]
- Cai, B.; Kim, D.; Akhand, S.; Sun, Y.; Cassell, R.J.; Alpsoy, A.; Dykhuizen, E.C.; Van Rijn, R.M.; Wendt, M.K.; Krusemark, C.J. Selection of DNA-Encoded Libraries to Protein Targets within and on Living Cells. J. Am. Chem. Soc. 2019, 141, 17057–17061. [Google Scholar] [CrossRef]
- Goto, Y.; Suga, H. The RaPID Platform for the Discovery of Pseudo-Natural Macrocyclic Peptides. Acc. Chem. Res. 2021, 54, 3604–3617. [Google Scholar] [CrossRef] [PubMed]
- Lam, K.S.; Salmon, S.E.; Hersh, E.M.; Hruby, V.J.; Kazmierski, W.M.; Knapp, R.J. A new type of synthetic peptide library for identifying ligand-binding activity. Nature 1991, 354, 82–84. [Google Scholar] [CrossRef]
- Guixer, B.; Arroyo, X.; Belda, I.; Sabidó, E.; Teixidó, M.; Giralt, E. Chemically synthesized peptide libraries as a new source of BBB shuttles. Use of mass spectrometry for peptide identification. J. Pept. Sci. 2016, 22, 577–591. [Google Scholar] [CrossRef] [PubMed]
- Spreckelsen, N.; Fadzen, C.M.; Hartrampf, N.; Ghotmi, Y.; Wolfe, J.M.; Dubey, S.; Yang, B.Y.; Kijewski, M.F.; Wang, S.; Farquhar, C.; et al. Targeting Glioblastoma Using a Novel Peptide Specific to a Deglycosylated Isoform of Brevican. Adv. Ther. 2021, 4, 2000244. [Google Scholar] [CrossRef] [PubMed]
- Cho, C.-F.; Farquhar, C.E.; Fadzen, C.M.; Scott, B.; Zhuang, P.; von Spreckelsen, N.; Loas, A.; Hartrampf, N.; Pentelute, B.L.; Lawler, S.E. A Tumor-Homing Peptide Platform Enhances Drug Solubility, Improves Blood–Brain Barrier Permeability and Targets Glioblastoma. Cancers 2022, 14, 2207. [Google Scholar] [CrossRef]
- Lucana, M.C.; Arruga, Y.; Petrachi, E.; Roig, A.; Lucchi, R.; Oller-Salvia, B. Protease-Resistant Peptides for Targeting and Intracellular Delivery of Therapeutics. Pharmaceutics 2021, 13, 2065. [Google Scholar] [CrossRef]
- Wei, X.; Zhan, C.; Chen, X.; Hou, J.; Xie, C.; Lu, W. Retro-Inverso Isomer of Angiopep-2: A Stable d-Peptide Ligand Inspires Brain-Targeted Drug Delivery. Mol. Pharm. 2014, 11, 3261–3268. [Google Scholar] [CrossRef]
- Prades, R.; Oller-Salvia, B.; Schwarzmaier, S.M.; Selva, J.; Moros, M.; Balbi, M.; Grazú, V.; de la Fuente, J.M.; Egea, G.; Plesnila, N.; et al. Applying the Retro-Enantio Approach To Obtain a Peptide Capable of Overcoming the Blood-Brain Barrier. Angew. Chem. Int. Ed. 2015, 54, 3967–3972. [Google Scholar] [CrossRef]
- Wei, X.; Zhan, C.; Shen, Q.; Fu, W.; Xie, C.; Gao, J.; Peng, C.; Zheng, P.; Lu, W. AD-Peptide Ligand of Nicotine Acetylcholine Receptors for Brain-Targeted Drug Delivery. Angew. Chem. Int. Ed. 2015, 54, 3023–3027. [Google Scholar] [CrossRef]
- Javed, H.; Menon, S.A.; Al-Mansoori, K.M.; Al-Wandi, A.; Majbour, N.K.; Ardah, M.T.; Varghese, S.; Vaikath, N.N.; Haque, M.E.; Azzouz, M.; et al. Development of Nonviral Vectors Targeting the Brain as a Therapeutic Approach For Parkinson’s Disease and Other Brain Disorders. Mol. Ther. 2016, 24, 746–758. [Google Scholar] [CrossRef] [Green Version]
- Arranz-Gibert, P.; Ciudad, S.; Seco, J.; García, J.; Giralt, E.; Teixidó, M. Immunosilencing peptides by stereochemical inversion and sequence reversal: Retro-D-peptides. Sci. Rep. 2018, 8, 6446. [Google Scholar] [CrossRef] [PubMed]
- Bukchin, A.; Sanchez-Navarro, M.; Carrera, A.; Resa-Pares, C.; Castillo-Ecija, H.; Balaguer-Lluna, L.; Teixidó, M.; Olaciregui, N.G.; Giralt, E.; Carcaboso, A.M.; et al. Amphiphilic Polymeric Nanoparticles Modified with a Protease-Resistant Peptide Shuttle for the Delivery of SN-38 in Diffuse Intrinsic Pontine Glioma. ACS Appl. Nano Mater. 2021, 4, 1314–1329. [Google Scholar] [CrossRef]
- de Oliveira, E.C.L.; da Costa, K.S.; Taube, P.S.; Lima, A.H.; Junior, C.D.S.D.S. Biological Membrane-Penetrating Peptides: Computational Prediction and Applications. Front. Cell. Infect. Microbiol. 2022, 12, 276. [Google Scholar] [CrossRef] [PubMed]
- Teixidó, M.; Belda, I.; Roselló, X.; González, S.; Fabre, M.; Llorá, X.; Bacardit, J.; Garrell, J.M.; Vilaró, S.; Albericio, F.; et al. Development of a Genetic Algorithm to Design and Identify Peptides that can Cross the Blood-Brain Barrier. QSAR Comb. Sci. 2003, 22, 745–753. [Google Scholar] [CrossRef]
- Belda, I.; Madurga, S.; Tarragó, T.; Llorà, X.; Giralt, E. Evolutionary computation and multimodal search: A good combination to tackle molecular diversity in the field of peptide design. Mol. Divers. 2006, 11, 7–21. [Google Scholar] [CrossRef]
- Dai, R.; Zhang, W.; Tang, W.; Wynendaele, E.; Zhu, Q.; Bin, Y.; De Spiegeleer, B.; Xia, J. BBPpred: Sequence-Based Prediction of Blood-Brain Barrier Peptides with Feature Representation Learning and Logistic Regression. J. Chem. Inf. Model. 2021, 61, 525–534. [Google Scholar] [CrossRef]
- Kumar, V.; Patiyal, S.; Dhall, A.; Sharma, N.; Raghava, G.P.S. B3Pred: A Random-Forest-Based Method for Predicting and Designing Blood–Brain Barrier Penetrating Peptides. Pharmaceutics 2021, 13, 1237. [Google Scholar] [CrossRef]
- Chen, X.; Zhang, Q.; Li, B.; Lu, C.; Yang, S.; Long, J.; He, B.; Chen, H.; Huang, J. BBPpredict: A Web Service for Identifying Blood-Brain Barrier Penetrating Peptides. Front. Genet. 2022, 13, 916. [Google Scholar] [CrossRef]
- Kumar, V.; Patiyal, S.; Kumar, R.; Sahai, S.; Kaur, D.; Lathwal, A.; Raghava, G.P.S. B3Pdb: An archive of blood–brain barrier-penetrating peptides. Brain Struct. Funct. 2021, 226, 2489–2495. [Google Scholar] [CrossRef]
- Van Dorpe, S.; Bronselaer, A.; Nielandt, J.; Stalmans, S.; Wynendaele, E.; Audenaert, K.; De Spiegeleer, B. Brainpeps: The blood-brain barrier peptide database. Brain Struct. Funct. 2012, 217, 687–718. [Google Scholar] [CrossRef]
- Marrink, S.J.; Risselada, H.J.; Yefimov, S.; Tieleman, D.P.; de Vries, A.H. The MARTINI force field: Coarse grained model for biomolecular simulations. J. Phys. Chem. B 2007, 111, 7812–7824. [Google Scholar] [CrossRef] [PubMed]
- Sugita, M.; Sugiyama, S.; Fujie, T.; Yoshikawa, Y.; Yanagisawa, K.; Ohue, M.; Akiyama, Y. Large-Scale Membrane Permeability Prediction of Cyclic Peptides Crossing a Lipid Bilayer Based on Enhanced Sampling Molecular Dynamics Simulations. J. Chem. Inf. Model. 2021, 61, 3681–3695. [Google Scholar] [CrossRef] [PubMed]
- Guidotti, G.; Brambilla, L.; Rossi, D. Peptides in clinical development for the treatment of brain tumors. Curr. Opin. Pharmacol. 2019, 47, 102–109. [Google Scholar] [CrossRef] [PubMed]
- Cabri, W.; Cantelmi, P.; Corbisiero, D.; Fantoni, T.; Ferrazzano, L.; Martelli, G.; Mattellone, A.; Tolomelli, A. Therapeutic Peptides Targeting PPI in Clinical Development: Overview, Mechanism of Action and Perspectives. Front. Mol. Biosci. 2021, 8, 697586. [Google Scholar] [CrossRef]
- Lau, J.L.; Dunn, M.K. Therapeutic peptides: Historical perspectives, current development trends, and future directions. Bioorg. Med. Chem. 2018, 26, 2700–2707. [Google Scholar] [CrossRef]


| Peptide | Origin | Target | Ref |
|---|---|---|---|
| (LRKLRKLL)2 | ApoE (Aa 141–149)2 | LDLR | [46,47] |
| TEELRVRLASHLRKLRKRLLRDA | ApoE (Aa 130–152) | LDLR | [47] |
| SVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS | ApoB (Aa 3371–3409) | LDLR | [47] |
| TFFYGGSRGKRNNFKTEEY | Sequence alignment of human Kunitz domains | LRP1 | [36] |
| DSSHAFTLDELR | MTf (Aa 441–452) | LDLR | [56] |
| YTIWMPENPRPGTPCDIFTNSRGKRASNG | RVG glycoprotein (Aa 175–203) | AchR | [57] |
| VQQLTKRFSL | DEN2C [a] (Aa 26–35) | None | [58] |
| KLFMALVAFLRFLT | DEN2C (Aa 45–59) | None | [58] |
| AGILKRW | DEN2C (Aa 63–69) | None | [58] |
| KSKAINVLRGFRKEIGRMLNILN | DEN2C (Aa 74–97) | None | [58] |
| [Dap](&)KAPETALD(&) [b] | Apamin | Unknown | [59] |
| [Dap](&)YGPQD(&) | Chlorotoxin | Unknown | [60] |
| Peptide | Target | Panned Against | Ref |
|---|---|---|---|
| C(&)LSSRLDAC(&) | Brain | BALB/c mice | [76] |
| GHKAKGPRK | hTfR | hTfR | [70] |
| THRPPMWSPVWP | TfR | hTfR (chicken fibroblast) | [45] |
| HLNILSTLWKYR | GM1 | Trisialoganglioside (GT1b) | [71] |
| C(&)AGALC(&)Y | Brain endothelium | BALB/c, FVB/N, and C57BL mice | [77] |
| GLAHSFSDFARDFV | Brain endothelium | C57Bl/6 and BALB/c mice | [80] |
| GYRPVHNIRGHWAPG | Brain endothelium | C57Bl/6 and BALB/c mice | [80] |
| TGNYKALHPHNG | Brain | ICR mice | [81] |
| C(&)RTIGPSVC(&) | Apo-TfR | BALB/c mice | [82] |
| C(&)TSTSAPYC(&) | Brain | ICR mice | [83] |
| C(&)SYTSSTMC(&) | Brain | Sprague-Dawley rats | [84] |
| DSGLC(&)MPRLRGC(&)DPR | LDLR | hLDLR | [72] |
| TPSYDTYAAELR | Brain through the BCSFB | Sprague-Dawley rats | [85] |
| RLSSVDSDLSGC | BBB/BCSFB | Wistar rats | [86] |
| SGVYKVAYDWQH | Brain endothelium | Human BBB cellular model | [73] |
| TFYGGRPKRNNFLRGIRSRGD | BBB/BTB | BALB/c mice | [87] |
| C(&)SLSHSPQC(&) | Brain endothelium | hCMEC/D3 cell monolayers | [74] |
| VAARTGEIYVPW | Brain endothelium | Primary endothelial rat cellular model | [75] |
| GLHTSATNLYLH | Brain endothelium | Primary endothelial rat cellular model | [75] |
| C(&)SLSHSPQC(&) | Brain endothelium | hCMEC/D3 cell monolayers | [74] |
| C(&)RGGKRSSC(&) | CNS | Ex vivo and in vivo EAE [a] mice | [79] |
| QFAALPVRAHYG | Brain | C57BL/6J mice | [78] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Sánchez-Navarro, M.; Giralt, E. Peptide Shuttles for Blood–Brain Barrier Drug Delivery. Pharmaceutics 2022, 14, 1874. https://doi.org/10.3390/pharmaceutics14091874
Sánchez-Navarro M, Giralt E. Peptide Shuttles for Blood–Brain Barrier Drug Delivery. Pharmaceutics. 2022; 14(9):1874. https://doi.org/10.3390/pharmaceutics14091874
Chicago/Turabian StyleSánchez-Navarro, Macarena, and Ernest Giralt. 2022. "Peptide Shuttles for Blood–Brain Barrier Drug Delivery" Pharmaceutics 14, no. 9: 1874. https://doi.org/10.3390/pharmaceutics14091874
APA StyleSánchez-Navarro, M., & Giralt, E. (2022). Peptide Shuttles for Blood–Brain Barrier Drug Delivery. Pharmaceutics, 14(9), 1874. https://doi.org/10.3390/pharmaceutics14091874
