Antimicrobial Peptides Can Generate Tolerance by Lag and Interfere with Antimicrobial Therapy
Abstract
:1. Introduction
2. Materials and Methods
2.1. Materials
2.2. Peptide Tolerant Strain Development and Data Processing
2.3. Minimum Inhibitory Concentration (MIC)
2.4. Killing Curve Assay
2.5. DNA Purification and Genome Sequencing
2.6. Statistical Analysis
3. Results
3.1. Antimicrobial Peptides Generate Tolerance by Lag
3.2. Tolerance in AMPs Can Affect Antimicrobial Treatments
3.3. The Tolerance Mutational Landscape Is Diverse
4. Discussion
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Fridman, O.; Goldberg, A.; Ronin, I.; Shoresh, N.; Balaban, N.Q. Optimization of Lag Time Underlies Antibiotic Tolerance in Evolved Bacterial Populations. Nature 2014, 513, 418–421. [Google Scholar] [CrossRef] [PubMed]
- Levin-Reisman, I.; Brauner, A.; Ronin, I.; Balaban, N. Epistasis between Antibiotic Tolerance, Persistence, and Resistance Mutations. Proc. Natl. Acad. Sci. USA 2019, 116, 14734–14739. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Balaban, N.Q.; Helaine, S.; Lewis, K.; Ackermann, M.; Aldridge, B.; Andersson, D.I.; Brynildsen, M.P.; Bumann, D.; Camilli, A.; Collins, J.J.; et al. Definitions and Guidelines for Research on Antibiotic Persistence. Nat. Rev. Microbiol. 2019, 17, 441–448. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Levin-Reisman, I.; Ronin, I.; Gefen, O.; Braniss, I.; Shoresh, N.; Balaban, N. Antibiotic Tolerance Facilitates the Evolution of Resistance. Science 2017, 355, eaaj2191. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Håkansson, J.; Ringstad, L.; Björn, C. Antimicrobial Peptides: An Emerging Category of Therapeutic Agents. Front. Cell. Infect. Microbiol. 2016, 6, 194. [Google Scholar] [CrossRef] [Green Version]
- Zhang, L.; Gallo, R.L. Antimicrobial Peptides. Curr. Biol. 2016, 26, R14–R19. [Google Scholar] [CrossRef]
- Gan, B.H.; Gaynord, J.; Rowe, S.M.; Deingruber, T.; Spring, D.R. The Multifaceted Nature of Antimicrobial Peptides: Current Synthetic Chemistry Approaches and Future Directions. Chem. Soc. Rev. 2021, 50, 7820–7880. [Google Scholar] [CrossRef]
- Wimley, W.C. Describing the Mechanism of Antimicrobial Peptide Action with the Interfacial Activity Model. ACS Chem. Biol. 2010, 5, 905–917. [Google Scholar] [CrossRef] [Green Version]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [Green Version]
- Cardoso, M.; Meneguetti, B.; Costa, B.; Buccini, D.; Oshiro, K.; Preza, S.; Carvalho, C.; Migliolo, L.; Franco, O. Non-Lytic Antibacterial Peptides That Translocate Through Bacterial Membranes to Act on Intracellular Targets. Int. J. Mol. Sci. 2019, 20, 4877. [Google Scholar] [CrossRef]
- Le, C.-F.; Fang, C.-M.; Sekaran, S.D. Intracellular Targeting Mechanisms by Antimicrobial Peptides. Antimicrob. Agents Chemother. 2017, 61, e02340-16. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Seyfi, R.; Kahaki, F.A.; Ebrahimi, T.; Montazersaheb, S.; Eyvazi, S.; Babaeipour, V.; Tarhriz, V. Antimicrobial Peptides (AMPs): Roles, Functions and Mechanism of Action. Int. J. Pept. Res. Ther. 2020, 26, 1451–1463. [Google Scholar] [CrossRef]
- Bialvaei, A.Z.; Samadi Kafil, H. Colistin, Mechanisms and Prevalence of Resistance. Curr. Med. Res. Opin. 2015, 31, 707–721. [Google Scholar] [CrossRef] [PubMed]
- Rodríguez-Rojas, A.; Baeder, D.Y.; Johnston, P.; Regoes, R.R.; Rolff, J. Bacteria Primed by Antimicrobial Peptides Develop Tolerance and Persist. PLoS Pathog. 2021, 17, e1009443. [Google Scholar] [CrossRef] [PubMed]
- Amblard, M.; Fehrentz, J.-A.; Martinez, J.; Subra, G. Methods and Protocols of Modern Solid Phase Peptide Synthesis. Mol. Biotechnol. 2006, 33, 239–254. [Google Scholar] [CrossRef]
- Levin-Reisman, I.; Gefen, O.; Fridman, O.; Ronin, I.; Shwa, D.; Sheftel, H.; Balaban, N.Q. Automated Imaging with ScanLag Reveals Previously Undetectable Bacterial Growth Phenotypes. Nat. Methods 2010, 7, 737–739. [Google Scholar] [CrossRef]
- Wiegand, I.; Hilpert, K.; Hancock, R.E.W. Agar and Broth Dilution Methods to Determine the Minimal Inhibitory Concentration (MIC) of Antimicrobial Substances. Nat. Protoc. 2008, 3, 163–175. [Google Scholar] [CrossRef]
- Li, H. Aligning Sequence Reads, Clone Sequences and Assembly Contigs with BWA-MEM. arXiv 2013, arXiv:1303.3997. [Google Scholar]
- McKenna, A.; Hanna, M.; Banks, E.; Sivachenko, A.; Cibulskis, K.; Kernytsky, A.; Garimella, K.; Altshuler, D.; Gabriel, S.; Daly, M.; et al. The Genome Analysis Toolkit: A MapReduce Framework for Analyzing next-Generation DNA Sequencing Data. Genome Res. 2010, 20, 1297–1303. [Google Scholar] [CrossRef] [Green Version]
- Cingolani, P.; Platts, A.; Wang, L.L.; Coon, M.; Nguyen, T.; Wang, L.; Land, S.J.; Lu, X.; Ruden, D.M. A Program for Annotating and Predicting the Effects of Single Nucleotide Polymorphisms, SnpEff: SNPs in the Genome of Drosophila melanogaster Strain W1118; Iso-2; Iso-3. Fly 2012, 6, 80–92. [Google Scholar] [CrossRef] [Green Version]
- Boeva, V.; Popova, T.; Bleakley, K.; Chiche, P.; Cappo, J.; Schleiermacher, G.; Janoueix-Lerosey, I.; Delattre, O.; Barillot, E. Control-FREEC: A Tool for Assessing Copy Number and Allelic Content Using next-Generation Sequencing Data. Bioinformatics 2012, 28, 423–425. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jeffares, D.C.; Jolly, C.; Hoti, M.; Speed, D.; Shaw, L.; Rallis, C.; Balloux, F.; Dessimoz, C.; Bähler, J.; Sedlazeck, F.J. Transient Structural Variations Have Strong Effects on Quantitative Traits and Reproductive Isolation in Fission Yeast. Nat. Commun. 2017, 8, 14061. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vandamme, D.; Landuyt, B.; Luyten, W.; Schoofs, L. A Comprehensive Summary of LL-37, the Factotum Human Cathelicidin Peptide. Cell. Immunol. 2012, 280, 22–35. [Google Scholar] [CrossRef] [PubMed]
- Bandurska, K.; Berdowska, A.; Barczyńska-Felusiak, R.; Krupa, P. Unique Features of Human Cathelicidin LL-37. BioFactors 2015, 41, 289–300. [Google Scholar] [CrossRef]
- Lee, J.; Lee, D.G. Concentration-Dependent Mechanism Alteration of Pleurocidin Peptide in Escherichia coli. Curr. Microbiol. 2016, 72, 159–164. [Google Scholar] [CrossRef]
- Shah, P.; Hsiao, F.S.-H.; Ho, Y.-H.; Chen, C.-S. The Proteome Targets of Intracellular Targeting Antimicrobial Peptides. Proteomics 2016, 16, 1225–1237. [Google Scholar] [CrossRef] [PubMed]
- Lázár, V.; Martins, A.; Spohn, R.; Daruka, L.; Grézal, G.; Fekete, G.; Számel, M.; Jangir, P.K.; Kintses, B.; Csörgő, B.; et al. Antibiotic-Resistant Bacteria Show Widespread Collateral Sensitivity to Antimicrobial Peptides. Nat. Microbiol. 2018, 3, 718–731. [Google Scholar] [CrossRef] [Green Version]
- Patrzykat, A.; Friedrich, C.L.; Zhang, L.; Mendoza, V.; Hancock, R.E.W. Sublethal Concentrations of Pleurocidin-Derived Antimicrobial Peptides Inhibit Macromolecular Synthesis in Escherichia coli. Antimicrob. Agents Chemother. 2002, 46, 605–614. [Google Scholar] [CrossRef] [Green Version]
- Meylan, S.; Porter, C.B.M.; Yang, J.H.; Belenky, P.; Gutierrez, A.; Lobritz, M.A.; Park, J.; Kim, S.H.; Moskowitz, S.M.; Collins, J.J. Carbon Sources Tune Antibiotic Susceptibility in Pseudomonas aeruginosa via Tricarboxylic Acid Cycle Control. Cell Chem. Biol. 2017, 24, 195–206. [Google Scholar] [CrossRef]
- Tang, X.; Chang, S.; Qiao, W.; Luo, Q.; Chen, Y.; Jia, Z.; Coleman, J.; Zhang, K.; Wang, T.; Zhang, Z.; et al. Structural Insights into Outer Membrane Asymmetry Maintenance in Gram-Negative Bacteria by MlaFEDB. Nat. Struct. Mol. Biol. 2021, 28, 81–91. [Google Scholar] [CrossRef]
- Fair, R.J.; Tor, Y. Antibiotics and Bacterial Resistance in the 21st Century. Perspect. Med. Chem. 2014, 6, PMC.S14459. [Google Scholar] [CrossRef] [PubMed]
- Brauner, A.; Fridman, O.; Gefen, O.; Balaban, N.Q. Distinguishing between Resistance, Tolerance and Persistence to Antibiotic Treatment. Nat. Rev. Microbiol. 2016, 14, 320–330. [Google Scholar] [CrossRef] [PubMed]
- Magana, M.; Pushpanathan, M.; Santos, A.L.; Leanse, L.; Fernandez, M.; Ioannidis, A.; Giulianotti, M.A.; Apidianakis, Y.; Bradfute, S.; Ferguson, A.L.; et al. The Value of Antimicrobial Peptides in the Age of Resistance. Lancet Infect. Dis. 2020, 20, e216–e230. [Google Scholar] [CrossRef]
- Mookherjee, N.; Anderson, M.A.; Haagsman, H.P.; Davidson, D.J. Antimicrobial Host Defence Peptides: Functions and Clinical Potential. Nat. Rev. Drug Discov. 2020, 19, 311–332. [Google Scholar] [CrossRef]
Description | Sequence a | Isoelectric Point | Molecular Weight | MIC c (µM) | |
---|---|---|---|---|---|
Theory | Found | ||||
Polymyxin B | BTB(BBfLBBT) | 10.5 | 1385.6 | - b | 0.2 |
LL-37 | [LL-37, 37 aa] | 11.1 | 4493.3 | 4492.3 | 50 |
Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | 10.8 | 2711.1 | 2710.3 | 6.3 |
Dermaseptin | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | 10.7 | 3455.1 | 3455.1 | 50 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Sandín, D.; Valle, J.; Morata, J.; Andreu, D.; Torrent, M. Antimicrobial Peptides Can Generate Tolerance by Lag and Interfere with Antimicrobial Therapy. Pharmaceutics 2022, 14, 2169. https://doi.org/10.3390/pharmaceutics14102169
Sandín D, Valle J, Morata J, Andreu D, Torrent M. Antimicrobial Peptides Can Generate Tolerance by Lag and Interfere with Antimicrobial Therapy. Pharmaceutics. 2022; 14(10):2169. https://doi.org/10.3390/pharmaceutics14102169
Chicago/Turabian StyleSandín, Daniel, Javier Valle, Jordi Morata, David Andreu, and Marc Torrent. 2022. "Antimicrobial Peptides Can Generate Tolerance by Lag and Interfere with Antimicrobial Therapy" Pharmaceutics 14, no. 10: 2169. https://doi.org/10.3390/pharmaceutics14102169