Identification of a Novel O-Conotoxin Reveals an Unusual and Potent Inhibitor of the Human α9α10 Nicotinic Acetylcholine Receptor
Abstract
:1. Introduction
2. Results
2.1. Purification and Identification of a Five-Cys-Containing Component from the Venom of Conus generalis
2.2. Sequence Determination and cDNA Cloning
2.3. Oxidative Refolding of GeXXVIIA
2.4. Inhibitory Effects of GeXXVIIA Monomeric Isomers on nAChRs
2.5. Inhibition Activity of the Linear GeXXVIIA and Its Two Fragments
2.6. IC50 Values of the GeXXVIIA-L and GeXXVIIA-L-Nter
2.7. Mechanism of Action of GeXXVIIA-L at hα9α10 nAChR
3. Discussion
4. Materials and Methods
4.1. Toxin Isolation and Purification
4.2. Toxin Characterization and N-Terminal Sequencing
4.3. cDNA Cloning
4.4. Peptide Synthesis and Refolding
4.5. Peptide Alkylation and Digestion by Protease Asp-N
4.6. Oocyte Two-Electrode-Voltage Clamp Recordings
Acknowledgments
Author Contributions
Conflicts of Interest
References
- Olivera, B.M. Conus Venom Peptides: Reflections from the biology of clades and species. Annu. Rev. Ecol. Syst. 2002, 33, 25–47. [Google Scholar] [CrossRef]
- Dutertre, S.; Jin, A.H.; Vetter, I.; Hamilton, B.; Sunagar, K.; Lavergne, V.; Dutertre, V.; Fry, B.G.; Antunes, A.; Venter, D.J.; et al. Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat. Commun. 2014, 5, 3521. [Google Scholar] [CrossRef] [PubMed]
- Olivera, B.M.; Showers Corneli, P.; Watkins, M.; Fedosov, A. Biodiversity of cone snails and other venomous marine gastropods: Evolutionary success through neuropharmacology. Annu. Rev. Anim. Biosci. 2014, 2, 487–513. [Google Scholar] [CrossRef] [PubMed]
- Terlau, H.; Olivera, B.M. Conus venoms: A rich source of novel ion channel-targeted peptides. Physiol. Rev. 2004, 84, 41–68. [Google Scholar] [CrossRef] [PubMed]
- Lewis, R.J.; Dutertre, S.; Vetter, I.; Christie, M.J. Conus venom peptide pharmacology. Pharmacol. Rev. 2012, 64, 259–298. [Google Scholar] [CrossRef] [PubMed]
- Essack, M.; Bajic, V.B.; Archer, J.A. Conotoxins that confer therapeutic possibilities. Mar. Drugs 2012, 10, 1244–1265. [Google Scholar] [CrossRef] [PubMed]
- Mir, R.; Karim, S.; Kamal, M.A.; Wilson, C.M.; Mirza, Z. Conotoxins: Structure, therapeutic potential and pharmacological applications. Curr. Pharm. Des. 2016, 22, 582–589. [Google Scholar] [CrossRef] [PubMed]
- Wermeling, D.P. Ziconotide, an intrathecally administered N-type calcium channel antagonist for the treatment of chronic pain. Pharmacotherapy 2005, 25, 1084–1094. [Google Scholar] [CrossRef] [PubMed]
- Schmidtko, A.; Lotsch, J.; Freynhagen, R.; Geisslinger, G. Ziconotide for treatment of severe chronic pain. Lancet 2010, 375, 1569–1577. [Google Scholar] [CrossRef]
- Webster, L.R. The relationship between the mechanisms of action and safety profiles of intrathecal morphine and Ziconotide: A review of the literature. Pain Med. 2015, 16, 1265–1277. [Google Scholar] [CrossRef] [PubMed]
- Kaas, Q.; Yu, R.; Jin, A.H.; Dutertre, S.; Craik, D.J. ConoServer: Updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Res. 2012, 40, D325–D330. [Google Scholar] [CrossRef] [PubMed]
- Heinemann, S.H.; Leipold, E. Conotoxins of the O-superfamily affecting voltage-gated sodium channels. Cell. Mol. Life Sci. 2007, 64, 1329–1340. [Google Scholar] [CrossRef] [PubMed]
- Gotti, C.; Clementi, F. Neuronal nicotinic receptors: From structure to pathology. Prog. Neurobiol. 2004, 74, 363–396. [Google Scholar] [CrossRef] [PubMed]
- Albuquerque, E.X.; Pereira, E.F.; Alkondon, M.; Rogers, S.W. Mammalian nicotinic acetylcholine receptors: From structure to function. Physiol. Rev. 2009, 89, 73–120. [Google Scholar] [CrossRef] [PubMed]
- Del Bufalo, A.; Cesario, A.; Salinaro, G.; Fini, M.; Russo, P. α9α10 nicotinic acetylcholine receptors as target for the treatment of chronic pain. Curr. Pharm. Des. 2014, 20, 6042–6047. [Google Scholar] [CrossRef] [PubMed]
- Vázquez, A. α9α10 acetylcholine receptors: Structure and functions. Neurotransmitter 2016, 3, e1298. [Google Scholar]
- Xu, S.; Shao, X.; Yan, M.; Chi, C.; Lu, A.; Wang, C. Identification of Two Novel O2-Conotoxins from Conus generalis. Int. J. Pept. Res. Ther. 2015, 21, 81–89. [Google Scholar] [CrossRef]
- Xu, S.; Zhang, T.; Kompella, S.N.; Yan, M.; Lu, A.; Wang, Y.; Shao, X.; Chi, C.; Adams, D.J.; Ding, J.; et al. Conotoxin αD-GeXXA utilizes a novel strategy to antagonize nicotinic acetylcholine receptors. Sci. Rep. 2015, 5, 14261. [Google Scholar] [CrossRef] [PubMed]
- Luo, S.; Zhangsun, D.; Feng, J.; Wu, Y.; Zhu, X.; Hu, Y. Diversity of the O-superfamily conotoxins from Conus miles. J. Pept. Sci. 2007, 13, 44–53. [Google Scholar] [CrossRef] [PubMed]
- Luo, S.; Zhangsun, D.; Harvey, P.J.; Kaas, Q.; Wu, Y.; Zhu, X.; Hu, Y.; Li, X.; Tsetlin, V.I.; Christensen, S.; et al. Cloning, synthesis, and characterization of αO-conotoxin GeXIVA, a potent α9α10 nicotinic acetylcholine receptor antagonist. Proc. Natl. Acad. Sci. USA 2015, 112, E4026–E4035. [Google Scholar] [CrossRef] [PubMed]
- Lu, A.; Yang, L.; Xu, S.; Wang, C. Various conotoxin diversifications revealed by a venomic study of Conus flavidus. Mol. Cell. Proteom. 2014, 13, 105–118. [Google Scholar] [CrossRef] [PubMed]
- Walker, C.S.; Jensen, S.; Ellison, M.; Matta, J.A.; Lee, W.Y.; Imperial, J.S.; Duclos, N.; Brockie, P.J.; Madsen, D.M.; Isaac, J.T.; et al. A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors. Curr. Biol. 2009, 19, 900–908. [Google Scholar] [CrossRef] [PubMed]
- Quinton, L.; Gilles, N.; De Pauw, E. TxXIIIA, an atypical homodimeric conotoxin found in the Conus textile venom. J. Proteom. 2009, 72, 219–226. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Durr, K.L.; Gouaux, E. X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism. Science 2014, 345, 1021–1026. [Google Scholar] [CrossRef] [PubMed]
- Elgoyhen, A.B.; Johnson, D.S.; Boulter, J.; Vetter, D.E.; Heinemann, S. α9: An acetylcholine receptor with novel pharmacological properties expressed in rat cochlear hair cells. Cell 1994, 79, 705–715. [Google Scholar] [CrossRef]
- Elgoyhen, A.B.; Vetter, D.E.; Katz, E.; Rothlin, C.V.; Heinemann, S.F.; Boulter, J. α10: A determinant of nicotinic cholinergic receptor function in mammalian vestibular and cochlear mechanosensory hair cells. Proc. Natl. Acad. Sci. USA 2001, 98, 3501–3506. [Google Scholar] [CrossRef] [PubMed]
- Elgoyhen, A.B.; Katz, E.; Fuchs, P.A. The nicotinic receptor of cochlear hair cells: A possible pharmacotherapeutic target? Biochem. Pharmacol. 2009, 78, 712–719. [Google Scholar] [CrossRef] [PubMed]
- Haberberger, R.V.; Bernardini, N.; Kress, M.; Hartmann, P.; Lips, K.S.; Kummer, W. Nicotinic acetylcholine receptor subtypes in nociceptive dorsal root ganglion neurons of the adult rat. Auton. Neurosci. 2004, 113, 32–42. [Google Scholar] [CrossRef] [PubMed]
- Kurzen, H.; Berger, H.; Jager, C.; Hartschuh, W.; Naher, H.; Gratchev, A.; Goerdt, S.; Deichmann, M. Phenotypical and molecular profiling of the extraneuronal cholinergic system of the skin. J. Investig. Dermatol. 2004, 123, 937–949. [Google Scholar] [CrossRef] [PubMed]
- Peng, H.; Ferris, R.L.; Matthews, T.; Hiel, H.; Lopez-Albaitero, A.; Lustig, L.R. Characterization of the human nicotinic acetylcholine receptor subunit α9 (CHRNA9) and α10 (CHRNA10) in lymphocytes. Life Sci. 2004, 76, 263–280. [Google Scholar] [CrossRef] [PubMed]
- Kumar, P.; Meizel, S. Nicotinic acetylcholine receptor subunits and associated proteins in human sperm. J. Biol. Chem. 2005, 280, 25928–25935. [Google Scholar] [CrossRef] [PubMed]
- Simard, A.R.; Gan, Y.; St-Pierre, S.; Kousari, A.; Patel, V.; Whiteaker, P.; Morley, B.J.; Lukas, R.J.; Shi, F.D. Differential modulation of EAE by α9*- and β2*-nicotinic acetylcholine receptors. Immunol. Cell Biol. 2013, 91, 195–200. [Google Scholar] [CrossRef] [PubMed]
- Vincler, M.; Wittenauer, S.; Parker, R.; Ellison, M.; Olivera, B.M.; McIntosh, J.M. Molecular mechanism for analgesia involving specific antagonism of α9α10 nicotinic acetylcholine receptors. Proc. Natl. Acad. Sci. USA 2006, 103, 17880–17884. [Google Scholar] [CrossRef] [PubMed]
- Callaghan, B.; Haythornthwaite, A.; Berecki, G.; Clark, R.J.; Craik, D.J.; Adams, D.J. Analgesic α-conotoxins Vc1.1 and Rg1A inhibit N-type calcium channels in rat sensory neurons via GABAB receptor activation. J. Neurosci. 2008, 28, 10943–10951. [Google Scholar] [CrossRef] [PubMed]
- Mohammadi, S.A.; Christie, M.J. Conotoxin interactions with α9α10-nAChRs: Is the α9α10-nicotinic acetylcholine receptor an important therapeutic target for pain management? Toxins (Basel) 2015, 7, 3916–3932. [Google Scholar] [CrossRef] [PubMed]
- Vincler, M.; McIntosh, J.M. Targeting the α9α10 nicotinic acetylcholine receptor to treat severe pain. Expert Opin. Ther. Targets 2007, 11, 891–897. [Google Scholar] [CrossRef] [PubMed]
- McIntosh, J.M.; Absalom, N.; Chebib, M.; Elgoyhen, A.B.; Vincler, M. α9 nicotinic acetylcholine receptors and the treatment of pain. Biochem. Pharmacol. 2009, 78, 693–702. [Google Scholar] [CrossRef] [PubMed]
- Pacini, A.; Micheli, L.; Maresca, M.; Branca, J.J.; McIntosh, J.M.; Ghelardini, C.; Di Cesare Mannelli, L. The α9α10 nicotinic receptor antagonist α-conotoxin RgIA prevents neuropathic pain induced by oxaliplatin treatment. Exp. Neurol. 2016, 282, 37–48. [Google Scholar] [CrossRef] [PubMed]
- Adams, D.J.; Callaghan, B.; Berecki, G. Analgesic conotoxins: Block and G protein-coupled receptor modulation of N-type CaV2.2 calcium channels. Br. J. Pharmacol. 2012, 166, 486–500. [Google Scholar] [CrossRef] [PubMed]
- Lee, C.H.; Huang, C.S.; Chen, C.S.; Tu, S.H.; Wang, Y.J.; Chang, Y.J.; Tam, K.W.; Wei, P.L.; Cheng, T.C.; Chu, J.S.; et al. Overexpression and activation of the α9-nicotinic receptor during tumorigenesis in human breast epithelial cells. J. Natl. Cancer Inst. 2010, 102, 1322–1335. [Google Scholar] [CrossRef] [PubMed]
- Zhangsun, D.; Zhu, X.; Kaas, Q.; Wu, Y.; Craik, D.J.; McIntosh, J.M.; Luo, S. αO-Conotoxin GeXIVA disulfide bond isomers exhibit differential sensitivity for various nicotinic acetylcholine receptors but retain potency and selectivity for the human α9α10 subtype. Neuropharmacology 2017. [Google Scholar] [CrossRef] [PubMed]
- Morales-Perez, C.L.; Noviello, C.M.; Hibbs, R.E. X-ray structure of the human α4β2 nicotinic receptor. Nature 2016, 538, 411–415. [Google Scholar] [CrossRef] [PubMed]
- Azam, L.; McIntosh, J.M. Molecular basis for the differential sensitivity of rat and human α9α10 nAChRs to α-conotoxin RgIA. J. Neurochem. 2012, 122, 1137–1144. [Google Scholar] [CrossRef] [PubMed]
- Christensen, S.B.; Bandyopadhyay, P.K.; Olivera, B.M.; McIntosh, J.M. αS-conotoxin GVIIIB potently and selectively blocks α9α10 nicotinic acetylcholine receptors. Biochem. Pharmacol. 2015, 96, 349–356. [Google Scholar] [CrossRef] [PubMed]





| Super-Family | Toxin Name | Conus Species | Toxin Sequence | Species of α9α10 nAChR | IC50 (nM) | Reference | 
|---|---|---|---|---|---|---|
| O | GeXXVIIA | C. generalis | ALMSTGTNYRLLKTCRGSGRYCRSPYDCRRRYCRRISDACV | H. sapiens | 16.2 | This study | 
| O | GeXIVA | C. generalis | TCRSSGRYCRSPYDRRRRYCRRITDACV | R. norvegicus | 4.6 | [20] | 
| H. sapiens | 20.3 | [41] | ||||
| A | RgIA | C. regius | GCCSDPRCRYRCR | R. norvegicus | 1.5 | [43] | 
| H. sapiens | 494 | |||||
| A | Vc1.1 | C. victoriae | GCCSDPRCNYDHPEIC * | R. norvegicus | 19 | [33] | 
| S | GVIIIB | C. geographus | SGSTCTCFTSTNCQGSCECLSPPGCYCSNNGIRQRGCSCTCPGT * | R. norvegicus | 9.8 | [44] | 
| D | GeXXA | C. generalis | DVHRP CQSVRPGRVWGKCCLTRLCSTMCCARADCTCVYHTWRGHGCSCVM | R. norvegicus | 1.2 | [12] | 
| H. sapiens | 28 | 
© 2017 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Jiang, S.; Tae, H.-S.; Xu, S.; Shao, X.; Adams, D.J.; Wang, C. Identification of a Novel O-Conotoxin Reveals an Unusual and Potent Inhibitor of the Human α9α10 Nicotinic Acetylcholine Receptor. Mar. Drugs 2017, 15, 170. https://doi.org/10.3390/md15060170
Jiang S, Tae H-S, Xu S, Shao X, Adams DJ, Wang C. Identification of a Novel O-Conotoxin Reveals an Unusual and Potent Inhibitor of the Human α9α10 Nicotinic Acetylcholine Receptor. Marine Drugs. 2017; 15(6):170. https://doi.org/10.3390/md15060170
Chicago/Turabian StyleJiang, Shantong, Han-Shen Tae, Shaoqiong Xu, Xiaoxia Shao, David J. Adams, and Chunguang Wang. 2017. "Identification of a Novel O-Conotoxin Reveals an Unusual and Potent Inhibitor of the Human α9α10 Nicotinic Acetylcholine Receptor" Marine Drugs 15, no. 6: 170. https://doi.org/10.3390/md15060170
APA StyleJiang, S., Tae, H.-S., Xu, S., Shao, X., Adams, D. J., & Wang, C. (2017). Identification of a Novel O-Conotoxin Reveals an Unusual and Potent Inhibitor of the Human α9α10 Nicotinic Acetylcholine Receptor. Marine Drugs, 15(6), 170. https://doi.org/10.3390/md15060170
 
         
                                                


 
       