Next Article in Journal
Identification of POU1F1 Variants in Vietnamese Patients with Combined Pituitary Hormone Deficiency
Next Article in Special Issue
A Novel CFEM Effector in Fusarium verticillioides Required for Virulence Involved in Plant Immunity Suppression and Fungal Cell Wall Integrity
Previous Article in Journal
Histone Phosphorylation in DNA Damage Response
Previous Article in Special Issue
Enhancing the Resilience of Agroecosystems Through Improved Rhizosphere Processes: A Strategic Review
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare

1
State Key Laboratory of Aridland Crop Science, Gansu Key Laboratory of Crop Improvement and Germplasm Enhancement, Lanzhou 730070, China
2
College of Agronomy, Gansu Agricultural University, Lanzhou 730070, China
3
Western Barley Genetics Alliance, College of Science, Health, Engineering and Education, Murdoch University, Murdoch, WA 6150, Australia
4
College of Life Science and Technology, Gansu Agricultural University, Lanzhou 730070, China
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Int. J. Mol. Sci. 2025, 26(6), 2401; https://doi.org/10.3390/ijms26062401
Submission received: 22 November 2024 / Revised: 24 February 2025 / Accepted: 27 February 2025 / Published: 7 March 2025
(This article belongs to the Special Issue Plant Pathogen Interactions: 2nd Edition)

Abstract

Barley leaf stripe, caused by Pyrenophora graminea, significantly reduces yield. Polygalacturonase, a key fungal pectinase, facilitates cell wall degradation for nutrition acquisition and colonization. To determine whether P. graminea contains polygalacturonase (PgPG)-encoding genes and their role in pathogenicity, four PgPG genes (PgPG1PgPG4) were identified in the P. graminea genome. Quantitative RT-PCR revealed that PgPG1 had the highest inducible expression during barley infection, suggesting its critical vital role in pathogenesis. PgPG1 was silenced and overexpressed in P. graminea QWC (wild-type) using CaCl2-PEG4000-mediated protoplast transformation. The PgPG1 RNAi mutants exhibited slower growth, while overexpression mutants grew faster. Relative to the wild-type, the disease incidence of Alexis, a highly susceptible barley variety, decreased by 62.94%, 42.19%, 45.74%, and 40.67% for RNAi mutants, and increased by 12.73%, 12.10%, 12.63%, and 10.31% for overexpression mutants. Pathogenicity analysis showed decreased disease incidence with PgPG1 RNAi mutants and increased severity with overexpression mutants. Trypan blue staining and polygalacturonase activity assays confirmed that overexpression mutants caused more severe damage compared to wild-type and RNAi mutants. These findings indicate that PgPG1 plays a vital role in the pathogenicity of P. graminea in barley and has great potential as a pathogen target gene to develop a durable resistance variety to P. graminea.

1. Introduction

Barley leaf stripe, caused by Pyrenophora graminea, is widespread in many countries and regions, including Europe, North America, North Africa, Russia, India, and China [1]. A 1% increase in disease incidence reduces production by 1% [2]; when the disease incidence is high, it leads to significant yield and economic losses, underscoring the need for effective disease control strategies [3,4]. Despite its importance, the pathogenic mechanisms of P. graminea remain poorly understood, with only the mitogen-activated protein kinase kinase gene (PGPBS) identified as contributing to P. graminea pathogenicity [5]. Research has shown that P. graminea mycelia invade the host by spreading within the middle lamella during infection [6,7]. Since the middle lamella primarily comprises pectin, its degradation by P. graminea-secreted enzymes is likely critical for colonization. Among the key enzymes involved in pectin degradation are polygalacturonase (PG), pectate lyase, and pectin methyl esterase. Polygalacturonases break down pectin in plant cell walls, facilitating nutrient release to support pathogen growth and development [8,9,10,11,12].
Molecular genetic studies on other plant pathogens have highlighted the role of PG-encoding genes in fungal pathogenicity. For instance, polygalacturonase P2c in Aspergillus flavus influences virulence by enhancing host invasion, as demonstrated through gene expression and targeted disruption of the pecA gene [13]. Similarly, the Bcpg1 gene in Botrytis cinerea and the PG1 gene in Fusarium oxysporum contributed to host infection [14]. Targeted disruption of PG-encoding genes in other fungi, such as Alternaria citri [15], Claviceps purpurea [16], and Xylella fastidiosa [17], has also resulted in weakened or lost pathogenicity, further underscoring the importance of PGs in fungal virulence.
However, not all PG genes are essential for pathogenicity. For instance, disrupting the enPG1 in Cryphonectria parasitica [18] or the PG5 gene in F. oxysporum [19] had no measurable effect on pathogenicity, likely due to functional redundancy among PG isozymes. Similarly, the AaPG1 gene in A. alternata did not impact virulence, as mutants exhibited the same disease symptoms as the wild-type [15]. These findings suggest that while PGs are critical for the virulence of many plant pathogens, their contribution can vary depending on the organism and host–pathogen interaction.
Little is known about PG-encoding genes in P. graminea. All known PG genes belong to the glycosylhydrolase gene family (GH28), which hydrolyzes glycosidic bonds. RNA interference (RNAi) technology based on the pSilent-1 vector has been successfully applied in P. graminea [5], offering a valuable tool for functional gene studies in this pathogen. Polygalacturonase production is critical for the success and survival of many fungal pathogens during host infection [20]. However, the specific contribution of PGs to P. graminea pathogenicity in barley remains unclear. To address this, we identified members of the GH28 gene family in P. graminea and selected PgPG1 as a key candidate gene. We investigated its subcellular localization, validated its signal peptide secretion function, and evaluated its role in pathogenicity by comparing the virulence of RNAi and overexpression mutants with that of the wild-type strain QWC. This study will provide the pathogen target gene for the creation of disease-resistant germplasm based on host-induced gene silencing.

2. Results

2.1. Identification of PgPG Proteins in P. graminea

Four Pg genes, designated PgPG1PgPG4, were identified at the genomic level (Table 1). These genes were predicted to encode polygalacturonase enzymes, suggesting a potential role in pectin degradation in barley. Sequence analysis using the InterPro database confirmed their involvement in carbohydrate metabolism. The proteins encoded by these genes ranged from 370 to 705 aa, with molecular weights between 37.04 and 74.98 kD. Signal peptides were detected in all four proteins (Figure S2), and their subcellular localization was predicted to be extracellular, identifying them as apoplastic proteins (Table 1).

2.2. Gene Structure and Conserved Motif Analysis of PgPG Proteins

The MEME tool (v5.5.7), annotated with InterPro (v87.0), identified ten conserved motifs (Figure 1A), and the conserved amino acid sequences are listed in Table 2. Gene structure analysis showed variability in intron numbers, with PgPG4 containing five introns, while the other three genes had two introns each (Figure 1B). Conserved amino acid residue analysis revealed that all PgPG proteins had at least one NTD, DD, GHG, and RIK: the NTD and DD were located in motif 1, and GHG and RIK were found in motif 2 and motif 8, respectively (Figure 1C, Table 2).

2.3. Phylogenetic Analysis of the PgPG Protein Family

Phylogenetic analysis using the neighbor-joining method classified PgPG proteins into eight subfamilies, comprising 20, 2, 15, 2, 2, 1, 6, and 5 members each. PgPG1 clustered with the PG gene of Botryotinia fuckeliana, indicating close evolutionary relatedness, while PgPG4 shared a branch with Cochliobolus carbonum (Figure 2), revealing functional diversification within the PgPG protein family.

2.4. PgPG Gene Expression During Infection Stages

All four PgPG genes were expressed during P. graminea infection of the barley cultivar Alexis. The expression levels of PgPG1 and PgPG3 increased consistently over time, while PgPG2 and PgPG4 slightly declined by 7 days post-infection before gradually increasing. All four PgPG genes reached the highest relative expression at 18 days post-infection (Figure 3). Among them, PgPG1 exhibited the highest relative expression across all time points, warranting further investigation into its role in pathogenesis.

2.5. Signal Peptide Functionality, Capability of Inducion Cell Death, and Subcellular Location of PgPG1

The TTC staining results showed that Avr1b and the PgPG1 signal peptide facilitated the secretion of invertase, which degraded sucrose into monosaccharides. In contrast, neither the blank control YTK12 nor pSUC2 exhibited this activity (Figure 4A and Figure S2). These results confirm that the signal peptide from PgPG1 has a functional secretory role. Transient expression of the PgPG1 protein in N. benthamiana was performed using the potato virus X (PVX) expression system, with the results showing that PgPG1 could induce cell death in N. benthamiana (Figure 4B).
To determine the subcellular localization of PgPG1, a fusion protein of PgPG1 and GFP was transiently expressed in N. benthamiana. Confocal microscopy analysis revealed green fluorescence primarily localized to the cell membrane and nucleus, with minor fluorescence detected in the cytoplasm, suggesting that the PgPG1 gene is expressed predominantly in the cell membrane and nucleus (Figure 4C).

2.6. Identification of PgPG1 Transformants

To confirm the presence of positive transformants, including RNAi transformants and expression transformants, we verified the presence of the hygromycin phosphotransferase gene, which acted as a reporter gene for screening transformants containing an exogenous target fragment. PCR amplification produced a band of approximately 1000 bp in transformants containing RNAi and overexpression constructs (Figure S3). Four RNAi transformants (PgPG1-RNAi-1, PgPG1-RNAi-2, PgPG1-RNAi-3, and PgPG1-RNAi-4) (Figure S3A) and four overexpression transformants (PgPG1-OE-1, PgPG1-OE-2, PgPG1-OE-3, and PgPG1-OE-4) (Figure S3B) were identified.
qRT-PCR analysis was performed on the transformants to assess PgPG1 gene expression levels. Relative expression levels of PgPG1-RNAi-1, PgPG1-RNAi-2, PgPG1-RNAi-3, and PgPG1-RNAi-4 were measured at 35.58%, 41.89%, 41.33%, and 54.86%, respectively, indicating decreases of 64.42%, 58.11%, 58.67%, and 45.14% compared to the wild-strain (Figure 5A). In contrast, relative expression levels of the overexpression transformants (PgPG1-OE-1, PgPG1-OE-2, PgPG1-OE-3, and PgPG1-OE-4) were significantly elevated, 19.94%, 13.03%, 17.28%, and 16.50% higher than the wild-strain, respectively (Figure 5B).

2.7. Role of PgPG1 in Vegetative Growth and Polygalacturonase Activity

The colony morphology of wild-strain and PgPG1 mutants was observed after 7 days of growth on PDA. All strains exhibited similar morphology, characterized as white, flat, relatively compact, and villose (Figure 6A), indicating that the PgPG1 gene does not influence colony morphology. Measurements of colony diameter revealed that all PgPG1 RNAi mutants had smaller diameters than the wild-strain (Figure 6A). Among the overexpression mutants, PgPG1-OE-2 had a smaller diameter, while PgPG1-OE-1 and PgPG1-OE-3 had larger diameters than the wild-strain. The diameter of PgPG1-OE-4 was comparable to the wild-strain. These findings suggest that the PgPG1 gene plays a role in P. graminea growth.
Polygalacturonase activity was measured in the PgPG1 mutant to assess the role of the PgPG1 gene in PG activity. The results showed that PgPG1-OE-1 had 6.11% higher PG activity than the wild-type, while PgPG1-RNAi-1 had 9.38% lower PG activity (Figure 7D).

2.8. Impact of PgPG1 on Pathogenicity

The disease incidence of the barley cultivar Alexis was recorded for the infection of RNAi and overexpression mutants. Infections with RNAi mutants PgPG1-RNAi-1, PgPG1-RNAi-2, PgPG1-RNAi-3, and PgPG1-RNAi-4 resulted in disease incidences of 22.58%, 43.33%, 39.78%, and 44.85%, respectively (Figure 7A). Infections with overexpression mutants PgPG1-OE-1, PgPG1-OE-2, PgPG1-OE-3, and PgPG1-OE-4 led to disease incidences of 98.25%, 97.62%, 98.15%, and 95.83%, respectively (Figure 7B). Relative to the wild-type, disease incidence decreased by 62.94%, 42.19%, 45.74%, and 40.67% for RNAi mutants, and increased by 12.73%, 12.10%, 12.63%, and 10.31% for overexpression mutants. These findings indicate that the PgPG1 gene plays a significant role in the pathogenicity of P. graminea.
The growth of plants uninfected by P. graminea and those infected by different strains were observed. Because these plants were not infected by P. graminea, the growth of the plant in CK (Alexis plants uninfected by P. graminea) is the best in Figure 7C; plants infected with PgPG1-RNAi-1 performed the second best, and plants infected with PgPG1-OE-1 performed the worst (Figure 7C). To further assess tissue damage, trypan blue dye was used to stain entire barley leaves infected with the wild-type, PgPG1-RNAi-1, and PgPG1-OE-1 strains. Following staining and decolorizing with chloral hydrate, leaves infected with PgPG1-OE-1 showed greater damage than the control group. In contrast, leaves infected with PgPG1-RNAi-1 exhibited minimal damage, and no staining was observed in the leaves of the control group (Figure 7E). We examined the chlorophyll content of the leaves infected by the wild-type, PgPG1-RNAi-1, and PgPG1-OE-1 strains, and the SPAD value of leaves infected by PgPG1-RNAi-1 was the highest; however, that of leaves infected by PgPG1-OE-1 was the lowest (Figure 7F).

3. Discussion

Fungal pathogens interact with host plants by degrading cell walls, often using PG enzymes as the initial tools for breaking down these structures [21]. We identified and characterized the PgPG1 gene from P. graminea, evaluating its role in growth, infection, and pathogenicity. This work provides insights into the molecular mechanisms underlying fungal pathogenicity, emphasizing the importance of PG genes in host–pathogen interactions.
Polygalacturonase genes play varied roles in fungal pathogenicity. For example, necrotrophic fungi often possess more GH28 genes than non-pathogenic or biotrophic fungi [22]. Phytophthora cinnamomi contains a large endoPG gene family with 19 members [23]. In P. graminea, we identified four PgPG genes at the whole-genome level, demonstrating extensive diversification through differences in intron–exon structures.
Expression analysis during the infection stages revealed that PgPG1 and PgPG3 were upregulated over time, with PgPG1 exhibiting the highest relative increase. This pattern suggests that PgPG1 is integral to degrading polygalacturonic acid, a primary component of plant cell middle lamellae. These findings identify PgPG1 as a key player in P. graminea pathogenicity.
Fungal PG genes exhibit functional differentiation in their roles in pathogenicity. Some studies have demonstrated that certain PG genes contribute significantly to fungal virulence, including pecA gene in Aspergillus flavus [24], BcPG1 in Botrytis cinerea [25], PG1 in Fusarium oxysporum [14], CpPG1 and CpPG2 in Claviceps purpurea [16], the PGLA gene in Xylella fastidiosa [17], and many others. Conversely, other studies have shown that some PG genes do not contribute to pathogenicity, including enPG1 in Cryphonectria parasitica [18], PG5 in F. oxysporum [19], and AaPG1 in A. alternat [15]. This apparent discrepancy may stem from the functional redundancy of PG genes. These findings highlight the controversial role of the PG gene in host–pathogen interactions.
Cell-wall-degrading enzymes serve as tools for pathogenic fungi to breach host defenses and as elicitors that trigger plant immune responses, acting as critical warning signals [26]. For instance, PG from Sclerotinia sclerotiorum can induce plant cell death [27]. Secreted effectors from diverse organisms have been extensively studied and linked to various physiological functions, including cell proliferation, immune responses, and pathogenic mechanisms [28,29]. To fully understand PG’s role in plant–pathogen interactions, it is essential to consider its pathogenic function and capacity to induce immune responses. In B. cinerea, at least five PGs have been confirmed to trigger immune responses in host plants [30]. Similarly, proteins like VmE02 from Valsa mali and cerato-platanin SsCP1 from Sclerotinia sclerotiorum can induce cell death independently of signal peptide presence [31]. This study identified that PgPG1 possesses secretory activity and induces cell death. Moreover, subcellular localization studies revealed PgPG1’s presence in the cell membrane and nucleus, where maybe the interaction regions between PgPG1 and the host cause an immune response. These findings underscore the importance of the apoplastic space in PgPG1’s functional activity, providing new insights into its contribution to P. graminea pathogenicity.
The pathogenic process of fungal infection in host plants is complex, with successful invasion and establishment within the host being critical for the pathogen’s impact [32,33]. Polygalacturonase, secreted by pathogenic fungi, plays a pivotal role by degrading the middle lamella and the intercellular layers of the plant’s primary cell wall, facilitating the pathogen’s smooth infiltration [34]. Research has consistently shown the strong association between PGs and fungal pathogenicity. For instance, mutating the PG gene in Alternaria citri significantly reduces the incidence of citrus and horse boll infections [15]. Similarly, the loss of BcPG1 in Botrytis cinerea markedly decreases pathogenicity across various host plants [35]. In Claviceps purpurea, deletion of the endo-PG gene results in near-complete loss of pathogenicity to rye [16]. In this study, we explored the role of PgPG1 in P. graminea by generating RNAi and overexpression mutants, which revealed its essential function in infection-related morphogenesis. Our results demonstrated that the PgPG1-RNAi mutants exhibited reduced pathogenicity, while the PgPG1-OE mutants displayed enhanced pathogenicity in barley. These findings were corroborated by trypan blue staining and polygalacturonase activity assays, which confirmed PgPG1’s involvement in facilitating pathogenicity.
In conclusion, we identified PgPG1 as a key pathogenicity factor in P. graminea. Our study highlights its critical roles in fungal growth, host infection, and disease development, advancing our understanding of the mechanisms underlying fungal pathogenicity.

4. Materials and Methods

4.1. Plant Materials, Strains, and Culture Conditions

Barley cultivar Alexis was used for inoculation assays. The P. graminea strain QWC (wild-type) was cultured at 25 °C on PDA medium, comprising 200 g/L potato decoction, 20 g/L D-glucose anhydrous, and 17 g/L agar.

4.2. Identification of PG Genes from the P. graminea Genome

Genomic data of P. graminea were downloaded from NCBI (BioProject: PRJNA373892). The Hidden Markov Model corresponding to the peptidase Glyco_hydro_28 domain (PF00295) was obtained from the Pfam database. Candidate PG genes were identified using HMMER 3.3.2 [36] with an E-value threshold <e−10, and their Glyco_hydro_28 conserved domain was confirmed using CDD research [37].

4.3. Sequence Feature, Gene Structure, and Motif Analysis

Protein-coding sequences (CDSs) and amino acid sequences of PG were extracted from the P. graminea genome. ProtParam (https://web.expasy.org/protparam/, accessed on 14 September 2021) [38] was used to calculate properties such as amino acid count, molecular weight, isoelectric point (pI), grand average of hydropathicity (GRAVY) index, instability index, and aliphatic index of PgPG proteins. SignalP6.0 [39] and Cell-PLoc (v2.0) [40] were used to predict signal peptides and subcellular locations. Exon–intron positions were mapped with TBtools (v2.121) [41], while conserved motifs were analyzed using MEME with default parameters (motif set to 10) and visualized using TBtools.

4.4. Phylogenetic Tree Construction

Protein sequences with locus IDs were retrieved from NCBI to perform a phylogenetic analysis of PgPG and other pathogenic fungi. Phylogenetic trees were constructed using MEGA 7 with the maximum likelihood and neighbor-joining methods, and graphical representations were refined using the Evolview website.

4.5. RNA Extraction and Gene Expression Assay

For gene expression analysis, sterilized barley seeds (cultivar Alexis) were inoculated by sandwiching them between two layers of P. graminea mycelia grown for seven days and then incubating at 6 °C. Infected seed embryos were collected at 7, 14, and 18 d post-infection and rapidly frozen in liquid nitrogen. Mycelia pre-infection were used as the control. RNA was extracted using a TRIzol RNA extraction kit, and cDNA was synthesized using a FastKing One Step RT-qPCR kit (Tiangen, Beijing, China, FP313). Relative expression levels were calculated using the 2−∆∆Ct method. All primers used are listed in Table 3, and qPCR analysis was performed with three independent biological replicates.

4.6. Plasmid Construction

Primers for the RNAi segments, including positive and reverse segments, to amplify the PgPG1 gene were created using the E-RNAi (v3.2) based on the CDS region of the PgPG1 gene, including responsive restriction sites. The positive segment included Kpn I and Xho I sites, and the reverse segment included Bgl II and Hind III sites (Table 3; Figure S1). The amplification process comprised 1 μL cDNA template, 1 μL each of forward and reverse primers, 12.5 μL Premix Taq, and 9.5 μL ddH2O. The RNAi segments were cloned following the protocol for the PgPG1 gene clone. The RNAi segments and pSilent-1 vector were digested using Kpn I/Xho I and Bgl II/Hind III, respectively. Initially, the forward RNAi segment was ligated into pSilent-1 using T4 ligase, and then the reverse RNAi segment was ligated into the pSilent-1 vector containing the forward RNAi segment, resulting in the construction of RNAi pSilent-1: PgPG1. For the PgPG1 gene clone, the fragment was digested with Xho I and EcoR I (Table 3; Figure S1) and subsequently ligated into the pBARGPE1-Hyg vector, resulting in the construction of the overexpression plasmid pBARGPE1-Hyg: PgPG1.

4.7. Transient Expression of PgPG1 in Nicotiana Benthamiana

The PVX: PgPG1 construct was transformed into A. tumefaciens GV3101 and cultured in LB medium at 28 °C at 200 rpm for 48 h. The bacterial pellets were collected after centrifugation at 3500 rpm for 5 min, resuspended in the infiltration buffer (10 mM MgCl2, 10 mM MES, 100 μM AS; pH = 5.7), centrifuged again at 3500 rpm for 5 min, and adjusted to OD600 = 0.4. The Agrobacterium suspension was infiltrated into the abaxial side of 3-week-old N. benthamiana leaves using a 1 mL syringe without a needle. Plants were grown under 16 h light/8 h dark conditions at 24 °C, and symptoms were observed 3–5 days post-infiltration.

4.8. Signal Peptide Functional Validation

Primers for PgPG1 PCR amplification, including gene clones and subcellular locations, were designed using DNAMAN (v5.2.2). After PCR amplification, the target fragment of the PgPG1 gene was recovered using a DNA recovery kit (Tiangen, Beijing, China, DP204), ligated to a T-vector, and transformed into E. coli DH5α. Following blue–white selection, positive clones were identified, and the E. coli cultures containing these clones were sent to a professional sequencing company (Tsing ke, Xi’an, China) for sequencing.
The yeast signal sequence trap system was used to verify the secretion function of the PgPG1 signal peptide. The YTK12 strain, a sucrase-deficient mutant, was used for functional validation. The chemically synthesized PgPG1 signal peptide sequence was cloned into the pSUC2 vector, resulting in the pSUC2: PgPG1sp construct (Table 3; Figure S1). This construction, the negative control vector pSUC2, and the positive control vector pSUC2-Avr1b were transformed into YTK12, respectively. If the PgPG1 signal peptide exhibited secretory functionality, the sucrase from YTK12 would be secreted successfully outside the cell. The hydrolysis of sucrose into monosaccharides by the secreted sucrase would then react with 2, 3, 5-triphenyl tetrazolium chloride (TTC) to produce a red triphenyl tetrazolium chloride precipitate, confirming the peptide’s secretion capability.

4.9. Subcellular Localization

The PgPG1 CDS was inserted into the pCAMBIA1300-35S-EGFP vector (Table 3; Figure S1). This recombinant vector (pCAMBIA1300-35S-EGFP: PgPG1) was transformed into N. benthamiana leaves using an Agrobacterium-mediated transformation method. The leaves of 3–4-week-old tobacco plants were infiltrated and subsequently incubated in a controlled chamber at 22 °C with a 12 h light/dark cycle for 48–72 h. The distribution of green fluorescence in the transformed tobacco leaves was observed and photographed using a laser confocal scanning microscope with an excitation wavelength of 488 nm.

4.10. Protoplast Transformation

Protoplast preparation and genetic transformation were mainly referenced to Aragona and Porta-Puglia [42]. Mycelia cultured for 48 h were harvested by filtration through a sterilized funnel, washed three times, and blotted dry using sterile filter paper. Approximately 0.1 g of mycelia was added to 10 mL enzymatic hydrolysate in a wide-mouth conical flask and incubated at 30 °C with shaking at 80 rpm for 3 h. The enzymatic hydrolysis mixture was filtered using sterilized cellophane, and the filtrate was centrifuged at 1996 rpm for 5 min, discarding the supernatant. Protoplasts were obtained by washing twice with 300 μL of 1.2 mol/L NaCl and resuspended in 100 μL NTC for transformation.
pSilent-1: PgPG1 DNA (1–10 μg) was added to the 100 μL protoplast suspension, blended, and incubated on ice for 20 min. Sequential additions of 200 μL, 200 μL, and 800 μL PTC were made, mixing well after each addition. Following a 15 min rest at room temperature, 3 mL rPD medium was added and gently mixed. The culture was incubated at 25 °C for 24 h and subsequently mixed with 20 mL rPDA medium before being incubated at 25 °C.

4.11. Selection and Identification of Mutants

Once mycelia appeared on PDA plates, the plates were overlaid with 10 mL PDA medium containing Hygromycin B. Single colonies were picked and subcultured on fresh PDA containing Hygromycin B for three consecutive cycles, resulting in the isolation of transformants. Positive transformants for RNAi and overexpression were identified through Hygromycin phosphotransferase gene segment amplification and qRT-PCR using the primers listed in Table 3.

4.12. Morphology Observation and Transformant Colony Diameter Measurement

Agar disks (5 mm diameter) containing mycelia were placed on blank PDA plates and incubated in the dark at 25 °C. Colony morphology was observed and photographed, and colony diameters were measured. Three biological replicates were used for each strain.
After placing the mycelia in the center of the PDA plate, a coverslip was inserted into the PDA at a 45° angle, 1 cm away from the mycelia. Mycelium morphology was observed under an optical microscope when the mycelia covered two-thirds of the coverslip.

4.13. Pathogenicity Testing of Mutants

The highly susceptible barley cultivar Alexis was used to test the pathogenicity of the transformants. Surface-sterilized Alexis seeds were sandwiched between PDA plates covered with 7-day-old mycelia and incubated in the dark at 25 °C for 20 days. The thirty infected seeds were then planted in pots containing a mixture of vermiculite and nutrient soil. The plants were grown under controlled conditions in a phytotron with alternating 12 h of light at 16 °C and 12 h of dark at 12 °C cycles. When stripe symptoms appeared, diseased plants were counted, and disease incidence was calculated for three biological replicates.

4.14. Trypan Blue Staining

Leaves infected for three weeks were harvested, rinsed with water, and stained with 0.4% (w/v) trypan blue solution for 3 min in boiling water. The staining solution was then removed before applying a decolorizing solution. Leaves were decolorized for 48 h until they appeared transparent.

4.15. Determination of PG Activity

Wild-type and mutant strains were cultured on PDA medium at 25 °C for seven days. The mycelia were then harvested for PG activity analysis, following the protocol outlined in the polygalacturonase test kit (Aoqing, Nanjing, China, SP7096).

5. Conclusions

In this study, we identified four PgPG genes (PgPG1-PgPG4) in the P. graminea genome and obtained the highest inducible expression of the PgPG1 gene during barley infection. In addition, the PgPG1 was verified to be a secretory protein and had the ability to cause immune response. The PgPG1 gene was involved in the pathogenicity of P. graminea in barley and has great potential as a pathogen target gene to develop a durable resistance variety to P. graminea.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms26062401/s1.

Author Contributions

H.W., Y.M. and C.L. designed the research; E.S., M.G., H.L., J.W., L.Y., B.L. and X.S. performed the research; E.S., M.G., H.L., X.M. and K.Y. analyzed the data; E.S. and M.G. wrote the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the Gansu Provincial Key Laboratory of Aridland Crop Science, Gansu Agricultural University (No. GSCS-2018-6); the China Agriculture Research System of MOF and MARA (CARS-05-02A-02); the National Natural Science Foundation of China (No. 32160496); the Industrial Support Project of the Gansu Provincial Education Department (2021 CYZC-12); the Innovation Fund Project of the Education Department of Gansu Province (No. 2021A-055); the Gansu Province Youth Science and Technology Fund (No. 20JR5RA010); and the Gannan Technology Plan Project (22CX8NA047).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data can be provided by the corresponding author upon reasonable request.

Acknowledgments

The authors thank the editor and the anonymous reviewers for their efforts to improve the manuscript.

Conflicts of Interest

The authors declare no conflicts of interest regarding this article.

References

  1. Valè, G.; Tacconi, G.; Francia, E.; Dall’Aglio, E.; Govoni, C.; Pecchioni, N.; Arru, L.; Delogu, G.; Haegi, A.; Porta-Puglia, A.; et al. Advances in understanding barley Pyrenophora graminea interactions. In Proceedings of the 2nd International Workshop on Barley Leaf Blights, Aleppo, Syria, 7–11 April 2002. [Google Scholar]
  2. Porta-Puglia, A.; Delogu, G.; Vannacci, G. Pyrenophora graminea on Winter Barley Seed: Effect on Disease Incidence and Yield Losses. J. Phytopathol. 1986, 117, 26–33. [Google Scholar] [CrossRef]
  3. Si, E.J.; Meng, Y.X.; Ma, X.L.; Li, B.C.; Wang, J.C.; Yao, L.R.; Yang, K.; Yu Zhang, Y.; Shang, X.W.; Wang, H.J. Genome resource for barley leaf stripe pathogen Pyrenophora graminea. Plant Dis. 2020, 104, 320–322. [Google Scholar] [CrossRef]
  4. Ackah, M.; Boateng, N.A.S.; Foku, J.M.; Ngea, G.L.N.N.; Godana, E.A.; Zhang, H.Y.; Yang, Q.Y. Genome-wide analysis of the PG gene family in Penicillium expansum: Expression during the infection stage in pear fruits (Pyrus bretschneideri). Physiol. Mol. Plant Pathol. 2024, 131, 102270. [Google Scholar] [CrossRef]
  5. Liang, Q.Q.; Li, B.C.; Wang, J.C.; Ren, P.R.; Yao, L.R.; Meng, Y.X.; Shang, X.W.; Wang, H.J. PGPBS, a mitogen-activated protein kinase kinase, is required for vegetative differentiation, cell wall integrity, and pathogenicity of the barley leaf stripe fungus Pyrenophora graminea. Gene 2019, 696, 95–104. [Google Scholar] [CrossRef] [PubMed]
  6. Haegi, A.; Bonardi, V.; Dall’Aglio, E.; Glissant, D.; Tumino, G.; Collins, N.C.; Bulgarelli, D.; Infantino, A.; Stanca, M.; Mdelledonne, M.; et al. Histological and molecular analysis of Rdg2a barley resistance to leaf stripe. Mol. Plant Pathol. 2008, 9, 463–478. [Google Scholar] [CrossRef]
  7. Si, E.J.; Meng, Y.X.; Ma, X.L.; Li, B.C.; Wang, J.C.; Ren, P.R.; Yao, L.R.; Yang, K.; Zhang, Y.; Shang, X.W.; et al. Development and characterization of microsatellite markers based on whole-genome sequences and pathogenicity differentiation of Pyrenophora graminea, the causative agent of barley leaf stripe. Eur. J. Plant Pathol. 2019, 154, 227–241. [Google Scholar] [CrossRef]
  8. Xia, K.F.; Pan, X.Q.; Zeng, X.; Zhang, M.Y. Xoo-responsive transcriptome reveals the role of the circular RNA133 in disease resistance by regulating expression of OsARAB in rice. Phytopathol. Res. 2023, 5, 33. [Google Scholar] [CrossRef]
  9. Haeger, W.; Pauchet, Y.; Kirsch, R. Evolution of polygalacturonases and polygalacturonase-inhibiting proteins: A view beyond the classical perspective. Annu. Plant Rev. 2022, 5, 81–122. [Google Scholar]
  10. Xu, M.; Wang, Q.H.; Wang, G.H.; Zhang, X.; Liu, H.Q.; Jiang, C. Combatting Fusarium head blight: Advances in molecular interactions between Fusarium graminearum and wheat. Phytopathol. Res. 2022, 4, 37. [Google Scholar] [CrossRef]
  11. Hamann, T. Plant cell wall integrity maintenance as an essential component of biotic stress response mechanisms. Front. Plant Sci. 2012, 3, 77. [Google Scholar] [CrossRef]
  12. Duan, W.K.; Huang, Z.N.; Song, X.M.; Liu, T.K.; Liu, H.L.; Hou, X.L.; Li, Y. Comprehensive analysis of the polygalacturonase and pectin methylesterase genes in Brassica rapa shed light on their different evolutionary patterns. Sci. Rep. 2016, 6, 25107. [Google Scholar] [CrossRef]
  13. Shieh, S.Y.; Ikeda, M.; Taya, Y.; Prives, C. DNA damage-induced phosphorylation of p53 alleviates inhibition by MDM2. Cell 1997, 91, 325–334. [Google Scholar] [CrossRef] [PubMed]
  14. Di Pietro, A.; Roncero, M.I.G. Cloning, expression, and role in pathogenicity of pg1 encoding the major extracellular endopolygalacturonase of the vascular wilt pathogen Fusarium oxysporum. Mol. Plant-Microbe Interact. 1998, 11, 91–98. [Google Scholar] [CrossRef]
  15. Isshiki, A. Endopolygalacturonase is essential for citrus black rot caused by Alternaria citri but not brown spot caused by Alternaria alternata. Mol. Plant-Microbe Interact. 2001, 14, 749–757. [Google Scholar] [CrossRef]
  16. Oeser, B.; Heidrich, P.M.; Müller, U.; Tudzynski, P.; Tenberge, K.B. Polygalacturonase is a pathogenicity factor in the Claviceps purpurearye interaction. Fungal Genet. Biol. 2002, 36, 176–186. [Google Scholar] [CrossRef] [PubMed]
  17. Roper, M.C.; Greve, L.C.; Warren, J.G.; Labavitch, J.M.; Kirkpatrick, B.C. Xylella fastidiosa requires polygalacturonase for colonization and pathogenicity in Vitis vinifera grapevines. Mol. Plant-Microbe Interact. 2007, 20, 411–419. [Google Scholar] [CrossRef]
  18. Gao, S.; Choi, G.H.; Shain, L.; Nuss, D.L. Cloning and targeted disruption of enpg-1, encoding the major in vitro extracellular endopolygalacturonase of the chestnut blight fungus, Cryphonectria parasitica. Appl. Environ. Microb. 1996, 62, 1984–1990. [Google Scholar] [CrossRef] [PubMed]
  19. García-Maceira, F.I.; Di Pietro, A.; Huertas-González, M.D.; Ruiz-Roldán, M.C.; Roncero, M.I.G. Molecular characterization of an endopolygalacturonase from Fusarium oxysporum expressed during early stages of infection. Appl. Environ. Microb. 2001, 67, 2191–2196. [Google Scholar] [CrossRef]
  20. Mahmood, U.; Fan, Y.H.; Wei, S.Y.; Niu, Y.; Li, Y.H.; Huang, H.L.; Yuling Chen, Y.L.; Tang, Z.L.; Liu, L.Z.; Qu, C.M. Comprehensive analysis of polygalacturonase genes offers new insights into their origin and functional evolution in land plants. Genomics 2021, 113, 1096–1108. [Google Scholar] [CrossRef]
  21. Chakraborty, A.; Fernando, L.D.; Fang, W.X.; Widanage, M.C.D.; Wei, P.Z.; Jin, C.; Fontaine, T.; Latgé, J.P.; Wang, T. A molecular vision of fungal cell wall organization by functional genomics and solid-state NMR. Nat. Commun. 2021, 12, 6346. [Google Scholar] [CrossRef]
  22. Sprockett, D.D.; Piontkivska, H.; Blackwood, C.B. Evolutionary analysis of glycosyl hydrolase family 28 (GH28) suggests lineage-specific expansions in necrotrophic fungal pathogens. Gene 2011, 479, 29–36. [Google Scholar] [CrossRef]
  23. Wu, C.H.; Yan, H.Z.; Liu, L.F.; Liou, R.F. Functional characterization of a gene family encoding polygalacturonases in Phytophthora parasitica. Mol. Plant-Microbe Interact. 2008, 21, 480–489. [Google Scholar] [CrossRef]
  24. Pennerman, K.K.; Yin, G.; Glenn, A.E.; Bennett, J.W. Identifying candidate Aspergillus pathogenicity factors by annotation frequency. BMC Microbiol. 2020, 20, 1–11. [Google Scholar] [CrossRef]
  25. Have, A.; Mulder, W.; Visser, J.; Kan, J.A.L.V. The endopolygalacturonase gene Bcpg1 is required for full virulence of Botrytis cinerea. Mol. Plant-Microbe Interact. 1998, 11, 1009–1016. [Google Scholar] [CrossRef]
  26. Yang, C.; Liu, R.; Pang, J.H.; Ren, B.; Zhou, H.B.; Wang, G.; Wang, E.T.; Liu, J. Poaceae-specific cell wall-derived oligosaccharides activate plant immunity via OsCERK1 during Magnaporthe oryzae infection in rice. Nat. Commun. 2021, 12, 2178. [Google Scholar] [CrossRef]
  27. Zuppini, A.; Navazio, L.; Sella, L.; Castiglioni, C.; Favaron, F.; Mariani, P. An endopolygalacturonase from Sclerotinia sclerotiorum induces calcium-mediated signaling and programmed cell death in soybean cells. Mol. Plant-Microbe Interact. 2005, 18, 849–855. [Google Scholar] [CrossRef]
  28. Chen, X.M.; Pan, S.; Bai, H.M.; Fan, J.X.; Batool, W.; Shabbir, A.; Han, Y.J.; Zheng, H.K.; Lu, G.D.; Lin, L.L.; et al. A nonclassically secreted effector of Magnaporthe oryzae targets host nuclei and plays important roles in fungal growth and plant infection. Mol. Plant Pathol. 2023, 24, 1093–1106. [Google Scholar] [CrossRef]
  29. Maricchiolo, E.; Panfili, E.; Pompa, A.; Marchis, F.D.; Bellucci, M.; Pallotta, M.T. Unconventional pathways of protein secretion: Mammals vs. plants. Front. Cell Dev. Biol. 2022, 10, 895853. [Google Scholar] [CrossRef]
  30. Silva, C.J.; Adaskaveg, J.A.; Mesquida-Pesci, S.D.; Ortega-Salazar, I.B.; Pattathil, S.; Zhang, L.S.; Hahn, M.G.; Kan, J.A.L.V.; Cantu, D.; Powell, A.L.T.; et al. Botrytis cinerea infection accelerates ripening and cell wall disassembly to promote disease in tomato fruit. Plant Physiol. 2023, 191, 575–590. [Google Scholar] [CrossRef]
  31. Nie, J.J.; Yin, Z.Y.; Li, Z.P.; Wu, Y.X.; Huang, L.L. A small cysteine-rich protein from two kingdoms of microbes is recognized as a novel pathogen-associated molecular pattern. New Phytol. 2019, 222, 995–1011. [Google Scholar] [CrossRef]
  32. Feurtey, A.; Lorrain, C.; McDonald, M.C.; Milgate, A.; Solomon, P.S.; Warren, R.; Puccetti, G.; Scalliet, G.; Torriani, S.F.F.; Gout, L.; et al. A thousand-genome panel retraces the global spread and adaptation of a major fungal crop pathogen. Nat. Commun. 2023, 14, 1059. [Google Scholar] [CrossRef]
  33. Jaroszuk-Ściseł, J.; Kurek, E. Hydrolysis of fungal and plant cell walls by enzymatic complexes from cultures of Fusarium isolates with different aggressiveness to rye (Secale cereale). Arch. Microbiol. 2012, 194, 653–665. [Google Scholar] [CrossRef]
  34. D’Ovidio, R.; Mattei, B.; Roberti, S.; Bellincampi, D. Polygalacturonases, polygalacturonase-inhibiting proteins and pectic oligomers in plant-pathogen interactions. BBA-Proteins Proteom. 2004, 1696, 237–244. [Google Scholar] [CrossRef]
  35. Kars, I.; Krooshof, G.H.; Wagemakers, L.; Joosten, R.; Benen, J.A.E.; Kan, J.A.L.V. Necrotizing activity of five Botrytis cinerea endopolygalacturonases produced in Pichia pastoris. Plant J. 2010, 43, 213–225. [Google Scholar] [CrossRef]
  36. Mistry, J.; Finn, R.D.; Eddy, S.R.; Bateman, A.; Punta, M. Challenges in homology search: HMMER3 and convergent evolution of coiled-coil regions. Nucleic Acids Res. 2013, 41, e121. [Google Scholar] [CrossRef]
  37. Marchler-Bauer, A.; Bo, Y.; Han, L.; He, J.; Lanczycki, C.J.; Lu, S.; Chitsaz, F.; Derbyshire, M.K.; Geer, R.C.; Gonzales, N.R.; et al. CDD/SPARCLE: Functional classification of proteins via subfamily domain architectures. Nucleic Acids Res. 2017, 45, 200–203. [Google Scholar] [CrossRef]
  38. Gasteiger, E.; Hoogland, C.; Gattiker, A.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein identification and analysis tools in the ExPASy server. In The Proteomics Protocols Handbook; Springer Nature: Berlin, Germany, 2005; pp. 571–607. [Google Scholar]
  39. Teufel, F.; Almagro Armenteros, J.J.; Johansen, A.R.; Gíslason, M.H.; Pihl, S.I.; Tsirigos, K.D.; Winther, O.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 6.0 predicts all five types of signal peptides using protein language models. Nat. Biotechnol. 2022, 40, 1023–1025. [Google Scholar] [CrossRef]
  40. Chou, K.; Shen, H. Cell-PLoc: A package of Web servers for predicting subcellular localization of proteins in various organisms. Nat. Protoc. 2008, 3, 153–162. [Google Scholar] [CrossRef]
  41. Chen, C.; Wu, Y.; Li, J.; Wang, X.; Zeng, Z.; Xu, J.; Liu, Y.; Feng, F.; Chen, H.; He, Y.; et al. TBtools-II: A “one for all, all for one” bioinformatics platform for biological big-data mining. Mol. Plant 2023, 16, 1733–1742. [Google Scholar] [CrossRef]
  42. Aragona, M.; Porta-Puglia, A. Genetic transformation of the phytopathogenic fungus Pyrenophora graminea. Mycol. Res. 1993, 97, 1143–1147. [Google Scholar] [CrossRef]
Figure 1. Conserved motif and gene structure analysis of PG family genes in P. graminea. (A) Distributions of conserved motifs in PgPG genes. Each motif is represented by a particular color. (B) The exon/intron structure of the PgPG genes. Green represents the exon regions, and the black lines represent introns. (C) The pattern identification of ten conserved sequences. The letters represent the amino acid sequence, and the size of the letters indicates the degree of sequence conservation; larger letters signify higher conservation.
Figure 1. Conserved motif and gene structure analysis of PG family genes in P. graminea. (A) Distributions of conserved motifs in PgPG genes. Each motif is represented by a particular color. (B) The exon/intron structure of the PgPG genes. Green represents the exon regions, and the black lines represent introns. (C) The pattern identification of ten conserved sequences. The letters represent the amino acid sequence, and the size of the letters indicates the degree of sequence conservation; larger letters signify higher conservation.
Ijms 26 02401 g001
Figure 2. Circular cladogram showing the phylogenetic relationships of the 53 fungal PG proteins. The phylogenetic tree was generated using MEGA with the maximum likelihood method, employing 1000 bootstrap replicates. The same color indicates proteins with the same domain structure.
Figure 2. Circular cladogram showing the phylogenetic relationships of the 53 fungal PG proteins. The phylogenetic tree was generated using MEGA with the maximum likelihood method, employing 1000 bootstrap replicates. The same color indicates proteins with the same domain structure.
Ijms 26 02401 g002
Figure 3. Expression level of PgPG genes in the interaction period between P. graminea and barley. (A) Expression level of PgPG1 gene at different infection periods. (B) Expression level of PgPG2 gene at different infection periods. (C) Expression level of PgPG3 gene at different infection periods. (D) Expression level of PgPG4 gene at different infection periods. Samples were collected at 0, 7, 14, and 18 d after inoculation. The expression level of each gene is compared to the abundance of actin, which was used as a reference gene. Different lowercase letters show standard errors based on three technical replicates.
Figure 3. Expression level of PgPG genes in the interaction period between P. graminea and barley. (A) Expression level of PgPG1 gene at different infection periods. (B) Expression level of PgPG2 gene at different infection periods. (C) Expression level of PgPG3 gene at different infection periods. (D) Expression level of PgPG4 gene at different infection periods. Samples were collected at 0, 7, 14, and 18 d after inoculation. The expression level of each gene is compared to the abundance of actin, which was used as a reference gene. Different lowercase letters show standard errors based on three technical replicates.
Ijms 26 02401 g003
Figure 4. Functional verification of signal peptide, cell death detection and subcellular location of PgPG1. (A) The signal peptide (SP) functionality of PgPG1 was validated using a yeast signal trap assay. The yeast strain YTK12 was unable to grow on CMD-W medium (which lacks tryptophan) unless it contained the pSUC2 vector, which allows for the expression of the Trp operon. When the functional SP of PgPG1 is fused in-frame with the mature yeast invertase, it enables the secretion of invertase, allowing the yeast to grow on YPRAA medium. The known functional SP of Avr1b was utilized as a positive control. (B) The ability of PgPG1 from P. graminea to induce cell death was assessed in N. benthamiana. The leaves of 3-week-old N. benthamiana were infiltrated with Agrobacterium tumefaciens harboring the gene of interest. INF1 (BAX) and green fluorescent protein (GFP) were used as positive and negative controls, respectively. Photographs were taken 72 h after agroinfiltration. (C) Subcellular location of PgPG1 in N. benthamiana. PgPG1-EGFP fusion proteins or EGFP were expressed in N. benthamiana.
Figure 4. Functional verification of signal peptide, cell death detection and subcellular location of PgPG1. (A) The signal peptide (SP) functionality of PgPG1 was validated using a yeast signal trap assay. The yeast strain YTK12 was unable to grow on CMD-W medium (which lacks tryptophan) unless it contained the pSUC2 vector, which allows for the expression of the Trp operon. When the functional SP of PgPG1 is fused in-frame with the mature yeast invertase, it enables the secretion of invertase, allowing the yeast to grow on YPRAA medium. The known functional SP of Avr1b was utilized as a positive control. (B) The ability of PgPG1 from P. graminea to induce cell death was assessed in N. benthamiana. The leaves of 3-week-old N. benthamiana were infiltrated with Agrobacterium tumefaciens harboring the gene of interest. INF1 (BAX) and green fluorescent protein (GFP) were used as positive and negative controls, respectively. Photographs were taken 72 h after agroinfiltration. (C) Subcellular location of PgPG1 in N. benthamiana. PgPG1-EGFP fusion proteins or EGFP were expressed in N. benthamiana.
Ijms 26 02401 g004
Figure 5. Relative expression of PgPG1-gene-transforming strains. (A) PgPG1 relative expression of RNAi mutants. (B) PgPG1 relative expression of overexpression mutants. Different lowercase letters show standard errors based on three technical replicates.
Figure 5. Relative expression of PgPG1-gene-transforming strains. (A) PgPG1 relative expression of RNAi mutants. (B) PgPG1 relative expression of overexpression mutants. Different lowercase letters show standard errors based on three technical replicates.
Ijms 26 02401 g005
Figure 6. WT and mutant strains of P. graminea grown in PDA medium. (A) Mycelia growth of the WT and PgPG1 mutants on PDA for 7 days. (B) Microscopic structural examination of PgPG1 mutants and WT incubated on PDA for 7 days. The red arrow indicates the position of mycelium distortion.
Figure 6. WT and mutant strains of P. graminea grown in PDA medium. (A) Mycelia growth of the WT and PgPG1 mutants on PDA for 7 days. (B) Microscopic structural examination of PgPG1 mutants and WT incubated on PDA for 7 days. The red arrow indicates the position of mycelium distortion.
Ijms 26 02401 g006
Figure 7. Pathogenicity detection of PgPG1 mutant strains of P. graminea. (A,B) Disease incidence of barley that had been inoculated with WT and mutant strains for 20 days at 18 °C. (C) Growth trends of barley seeds inoculated with fungal mycelium from WT and transformants for 20 days at 4 °C. Barleys were observed after sowing for 14 days. The CK is Alexis plants uninfected by P. graminea. (D) Activity evaluation of the secreted polygalacturonase of WT, PgPG1-RNAi-1, and PgPG1-OE-1. (E) Trypan blue staining to detect the degree of cell necrosis in WT, PgPG1-RNAi-1, and PgPG1-OE-1 leaves. The CK is Alexis leaves uninfected by P. graminea. (F) The content of SPAD in Alexis infected by WT, PgPG1-RNAi-1, and PgPG1-OE-1, respectively. Different letters indicate a significant difference between the WT and transformants (p < 0.05). Bars denote standard errors from three repeated experiments.
Figure 7. Pathogenicity detection of PgPG1 mutant strains of P. graminea. (A,B) Disease incidence of barley that had been inoculated with WT and mutant strains for 20 days at 18 °C. (C) Growth trends of barley seeds inoculated with fungal mycelium from WT and transformants for 20 days at 4 °C. Barleys were observed after sowing for 14 days. The CK is Alexis plants uninfected by P. graminea. (D) Activity evaluation of the secreted polygalacturonase of WT, PgPG1-RNAi-1, and PgPG1-OE-1. (E) Trypan blue staining to detect the degree of cell necrosis in WT, PgPG1-RNAi-1, and PgPG1-OE-1 leaves. The CK is Alexis leaves uninfected by P. graminea. (F) The content of SPAD in Alexis infected by WT, PgPG1-RNAi-1, and PgPG1-OE-1, respectively. Different letters indicate a significant difference between the WT and transformants (p < 0.05). Bars denote standard errors from three repeated experiments.
Ijms 26 02401 g007
Table 1. Physical and chemical properties of PG genes of P. graminea.
Table 1. Physical and chemical properties of PG genes of P. graminea.
GeneGene IDNumber of Amino Acids/aaMolecular Weight/kDIsoelectric PointGRAVY IndexInstability IndexAliphatic IndexSignal Peptide LengthSubcellular Location
PgPG1P.graminea_GLEAN_1000234339241.625.60−0.17431.8581.1018extracellular
PgPG2P.graminea_GLEAN_1000248337037.048.310.11421.8981.7319extracellular
PgPG3P.graminea_GLEAN_1000583044848.316.24−0.27637.1079.8219extracellular
PgPG4P.graminea_GLEAN_1000663670574.985.98−0.25237.0874.8919extracellular
Table 2. Conserved motifs of amino acids of PgPG genes family in P. graminea.
Table 2. Conserved motifs of amino acids of PgPG genes family in P. graminea.
Conserved MotifsE-ValueNumber of
Amino Acid
Amino Acid Sequence
Motif19.8 × 10−1329HNTDGFDVGSSSNIVIQNSNVLNQDDCVA
Motif22.2 × 10−727TNIHFKNLICNGGHGJSIGSVGGRSNN
Motif31.5 × 10−421LDGNGQAWWDGKGSNGGVVKP
Motif41.1 × 10−449DVTFEDITLSRISKYGIVIQQDYLNGGPTGSATNGVPITGLTJQNISGT
Motif53.1 × 10−446FFFAHNLISSSISDIYIQNPPVQVFSISNCDGLTIDHITIDNSAGD
Motif61.1 × 10−350TGAAAAIKAKAACSTIILBGIAVPAGTTLDLSGLKDGTTVTFQGKTTFGY
Motif72.8 × 10018KRPAEPDHPFHFKKWCDE
Motif82.1 × 10121VETVTFSNSSVSDATNGVRIK
Motif91.5 × 10126MMNDNVDNDVEFRFCGGDENLFPCNE
Motif105.4 × 10112PPRWKTCNDQWR
Table 3. Primers information used in the study.
Table 3. Primers information used in the study.
CodePrimerSequence (5′–3′)Restriction SitePurpose
1PgPG1SP-EcoR I-FCCGGAATTCATGCGTTCTAACGGGATTTTEcoR IClone Pgpg1 to pSUC2 for signal peptide functional validation
2PgPG1SP-Xho I-RCCGCTCGAGGGCCTGCCCTACGGCGGCAAXho I
3PgPG1-SL-BamH I-FCGGGATCCATGCGTTCTAACGGGATTTTBamH IClone Pgpg1 to EGFP for subcellular localization assay in N. benthamiana
4PgPG1-SL-Sma I-RTCCCCCGGGCGCTGCTAGCTTGGAAACTGSma I
5PgPG1-RNAi-Kpn I-Xho I-FGGGGTACCCCGCTCGAGGAGCAGCACCAACATCAAGAKpn I-Xho IClone RNAi segment to pSilent-1 for the construction of pSilent-1: Pgpg1
6PgPG1-RNAi-Bgl II-Hind III-RGAAGATCTCCCAAGCTTCCACCGCCAGTAATATCCACBgl II-Hind III
7PgPG1-OE-EcoR I-FGGAATTCATGCGTTCTAACGGGATTTTEcoR IClone Pgpg1 to pBARGPE1-Hyg-mCherryfor the construction of pBARGPE1-Hyg: Pgpg1
8PgPG1-OE-Xho I-RCCGCTCGAGCGCTGCTAGCTTGGAAACTGXho I
9Hyg B-FATGAAAAAGCCTGAACTCAC Generation of Pgpg1 mutants by the amplificationg segment of hygromycin resistance gene in Pyrenophora graminea
10Hyg B-RCTATTCCTTTGCCCTCGGA
11PgPG1-RNAi-RT-FTCAAGATCCGCGACAGCAT Expression level analysis of Pgpg1 genes in RNAi mutant of Pyrenophora graminea
12PgPG1-RNAi-RT-RTGGCTGCCGTTGGAGTACA
13PgPG1-OE-RT-FCTGGACATTTACCACATCACTCTGA Expression level analysis of Pgpg1 genes in OE mutants of Pyrenophora graminea
14PgPG1-OE-RT-RCGTCAAATCCGTCGCTGTTA
15Actin-FGCGGTTACACCTCTCTACCAC Expression level analysis of internal control gene Actin in Pyrenophora graminea
16Actin-RAGTCTGGATCTCCTGCTCAAAG
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Si, E.; Guo, M.; Liu, H.; Li, C.; Wang, J.; Yao, L.; Meng, Y.; Ma, X.; Li, B.; Yang, K.; et al. The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. Int. J. Mol. Sci. 2025, 26, 2401. https://doi.org/10.3390/ijms26062401

AMA Style

Si E, Guo M, Liu H, Li C, Wang J, Yao L, Meng Y, Ma X, Li B, Yang K, et al. The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. International Journal of Molecular Sciences. 2025; 26(6):2401. https://doi.org/10.3390/ijms26062401

Chicago/Turabian Style

Si, Erjing, Ming Guo, Haiying Liu, Chengdao Li, Juncheng Wang, Lirong Yao, Yaxiong Meng, Xiaole Ma, Baochun Li, Ke Yang, and et al. 2025. "The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare" International Journal of Molecular Sciences 26, no. 6: 2401. https://doi.org/10.3390/ijms26062401

APA Style

Si, E., Guo, M., Liu, H., Li, C., Wang, J., Yao, L., Meng, Y., Ma, X., Li, B., Yang, K., Shang, X., & Wang, H. (2025). The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. International Journal of Molecular Sciences, 26(6), 2401. https://doi.org/10.3390/ijms26062401

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop