The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare
Abstract
1. Introduction
2. Results
2.1. Identification of PgPG Proteins in P. graminea
2.2. Gene Structure and Conserved Motif Analysis of PgPG Proteins
2.3. Phylogenetic Analysis of the PgPG Protein Family
2.4. PgPG Gene Expression During Infection Stages
2.5. Signal Peptide Functionality, Capability of Inducion Cell Death, and Subcellular Location of PgPG1
2.6. Identification of PgPG1 Transformants
2.7. Role of PgPG1 in Vegetative Growth and Polygalacturonase Activity
2.8. Impact of PgPG1 on Pathogenicity
3. Discussion
4. Materials and Methods
4.1. Plant Materials, Strains, and Culture Conditions
4.2. Identification of PG Genes from the P. graminea Genome
4.3. Sequence Feature, Gene Structure, and Motif Analysis
4.4. Phylogenetic Tree Construction
4.5. RNA Extraction and Gene Expression Assay
4.6. Plasmid Construction
4.7. Transient Expression of PgPG1 in Nicotiana Benthamiana
4.8. Signal Peptide Functional Validation
4.9. Subcellular Localization
4.10. Protoplast Transformation
4.11. Selection and Identification of Mutants
4.12. Morphology Observation and Transformant Colony Diameter Measurement
4.13. Pathogenicity Testing of Mutants
4.14. Trypan Blue Staining
4.15. Determination of PG Activity
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Valè, G.; Tacconi, G.; Francia, E.; Dall’Aglio, E.; Govoni, C.; Pecchioni, N.; Arru, L.; Delogu, G.; Haegi, A.; Porta-Puglia, A.; et al. Advances in understanding barley Pyrenophora graminea interactions. In Proceedings of the 2nd International Workshop on Barley Leaf Blights, Aleppo, Syria, 7–11 April 2002. [Google Scholar]
- Porta-Puglia, A.; Delogu, G.; Vannacci, G. Pyrenophora graminea on Winter Barley Seed: Effect on Disease Incidence and Yield Losses. J. Phytopathol. 1986, 117, 26–33. [Google Scholar] [CrossRef]
- Si, E.J.; Meng, Y.X.; Ma, X.L.; Li, B.C.; Wang, J.C.; Yao, L.R.; Yang, K.; Yu Zhang, Y.; Shang, X.W.; Wang, H.J. Genome resource for barley leaf stripe pathogen Pyrenophora graminea. Plant Dis. 2020, 104, 320–322. [Google Scholar] [CrossRef]
- Ackah, M.; Boateng, N.A.S.; Foku, J.M.; Ngea, G.L.N.N.; Godana, E.A.; Zhang, H.Y.; Yang, Q.Y. Genome-wide analysis of the PG gene family in Penicillium expansum: Expression during the infection stage in pear fruits (Pyrus bretschneideri). Physiol. Mol. Plant Pathol. 2024, 131, 102270. [Google Scholar] [CrossRef]
- Liang, Q.Q.; Li, B.C.; Wang, J.C.; Ren, P.R.; Yao, L.R.; Meng, Y.X.; Shang, X.W.; Wang, H.J. PGPBS, a mitogen-activated protein kinase kinase, is required for vegetative differentiation, cell wall integrity, and pathogenicity of the barley leaf stripe fungus Pyrenophora graminea. Gene 2019, 696, 95–104. [Google Scholar] [CrossRef] [PubMed]
- Haegi, A.; Bonardi, V.; Dall’Aglio, E.; Glissant, D.; Tumino, G.; Collins, N.C.; Bulgarelli, D.; Infantino, A.; Stanca, M.; Mdelledonne, M.; et al. Histological and molecular analysis of Rdg2a barley resistance to leaf stripe. Mol. Plant Pathol. 2008, 9, 463–478. [Google Scholar] [CrossRef]
- Si, E.J.; Meng, Y.X.; Ma, X.L.; Li, B.C.; Wang, J.C.; Ren, P.R.; Yao, L.R.; Yang, K.; Zhang, Y.; Shang, X.W.; et al. Development and characterization of microsatellite markers based on whole-genome sequences and pathogenicity differentiation of Pyrenophora graminea, the causative agent of barley leaf stripe. Eur. J. Plant Pathol. 2019, 154, 227–241. [Google Scholar] [CrossRef]
- Xia, K.F.; Pan, X.Q.; Zeng, X.; Zhang, M.Y. Xoo-responsive transcriptome reveals the role of the circular RNA133 in disease resistance by regulating expression of OsARAB in rice. Phytopathol. Res. 2023, 5, 33. [Google Scholar] [CrossRef]
- Haeger, W.; Pauchet, Y.; Kirsch, R. Evolution of polygalacturonases and polygalacturonase-inhibiting proteins: A view beyond the classical perspective. Annu. Plant Rev. 2022, 5, 81–122. [Google Scholar]
- Xu, M.; Wang, Q.H.; Wang, G.H.; Zhang, X.; Liu, H.Q.; Jiang, C. Combatting Fusarium head blight: Advances in molecular interactions between Fusarium graminearum and wheat. Phytopathol. Res. 2022, 4, 37. [Google Scholar] [CrossRef]
- Hamann, T. Plant cell wall integrity maintenance as an essential component of biotic stress response mechanisms. Front. Plant Sci. 2012, 3, 77. [Google Scholar] [CrossRef]
- Duan, W.K.; Huang, Z.N.; Song, X.M.; Liu, T.K.; Liu, H.L.; Hou, X.L.; Li, Y. Comprehensive analysis of the polygalacturonase and pectin methylesterase genes in Brassica rapa shed light on their different evolutionary patterns. Sci. Rep. 2016, 6, 25107. [Google Scholar] [CrossRef]
- Shieh, S.Y.; Ikeda, M.; Taya, Y.; Prives, C. DNA damage-induced phosphorylation of p53 alleviates inhibition by MDM2. Cell 1997, 91, 325–334. [Google Scholar] [CrossRef] [PubMed]
- Di Pietro, A.; Roncero, M.I.G. Cloning, expression, and role in pathogenicity of pg1 encoding the major extracellular endopolygalacturonase of the vascular wilt pathogen Fusarium oxysporum. Mol. Plant-Microbe Interact. 1998, 11, 91–98. [Google Scholar] [CrossRef]
- Isshiki, A. Endopolygalacturonase is essential for citrus black rot caused by Alternaria citri but not brown spot caused by Alternaria alternata. Mol. Plant-Microbe Interact. 2001, 14, 749–757. [Google Scholar] [CrossRef]
- Oeser, B.; Heidrich, P.M.; Müller, U.; Tudzynski, P.; Tenberge, K.B. Polygalacturonase is a pathogenicity factor in the Claviceps purpurearye interaction. Fungal Genet. Biol. 2002, 36, 176–186. [Google Scholar] [CrossRef] [PubMed]
- Roper, M.C.; Greve, L.C.; Warren, J.G.; Labavitch, J.M.; Kirkpatrick, B.C. Xylella fastidiosa requires polygalacturonase for colonization and pathogenicity in Vitis vinifera grapevines. Mol. Plant-Microbe Interact. 2007, 20, 411–419. [Google Scholar] [CrossRef]
- Gao, S.; Choi, G.H.; Shain, L.; Nuss, D.L. Cloning and targeted disruption of enpg-1, encoding the major in vitro extracellular endopolygalacturonase of the chestnut blight fungus, Cryphonectria parasitica. Appl. Environ. Microb. 1996, 62, 1984–1990. [Google Scholar] [CrossRef] [PubMed]
- García-Maceira, F.I.; Di Pietro, A.; Huertas-González, M.D.; Ruiz-Roldán, M.C.; Roncero, M.I.G. Molecular characterization of an endopolygalacturonase from Fusarium oxysporum expressed during early stages of infection. Appl. Environ. Microb. 2001, 67, 2191–2196. [Google Scholar] [CrossRef]
- Mahmood, U.; Fan, Y.H.; Wei, S.Y.; Niu, Y.; Li, Y.H.; Huang, H.L.; Yuling Chen, Y.L.; Tang, Z.L.; Liu, L.Z.; Qu, C.M. Comprehensive analysis of polygalacturonase genes offers new insights into their origin and functional evolution in land plants. Genomics 2021, 113, 1096–1108. [Google Scholar] [CrossRef]
- Chakraborty, A.; Fernando, L.D.; Fang, W.X.; Widanage, M.C.D.; Wei, P.Z.; Jin, C.; Fontaine, T.; Latgé, J.P.; Wang, T. A molecular vision of fungal cell wall organization by functional genomics and solid-state NMR. Nat. Commun. 2021, 12, 6346. [Google Scholar] [CrossRef]
- Sprockett, D.D.; Piontkivska, H.; Blackwood, C.B. Evolutionary analysis of glycosyl hydrolase family 28 (GH28) suggests lineage-specific expansions in necrotrophic fungal pathogens. Gene 2011, 479, 29–36. [Google Scholar] [CrossRef]
- Wu, C.H.; Yan, H.Z.; Liu, L.F.; Liou, R.F. Functional characterization of a gene family encoding polygalacturonases in Phytophthora parasitica. Mol. Plant-Microbe Interact. 2008, 21, 480–489. [Google Scholar] [CrossRef]
- Pennerman, K.K.; Yin, G.; Glenn, A.E.; Bennett, J.W. Identifying candidate Aspergillus pathogenicity factors by annotation frequency. BMC Microbiol. 2020, 20, 1–11. [Google Scholar] [CrossRef]
- Have, A.; Mulder, W.; Visser, J.; Kan, J.A.L.V. The endopolygalacturonase gene Bcpg1 is required for full virulence of Botrytis cinerea. Mol. Plant-Microbe Interact. 1998, 11, 1009–1016. [Google Scholar] [CrossRef]
- Yang, C.; Liu, R.; Pang, J.H.; Ren, B.; Zhou, H.B.; Wang, G.; Wang, E.T.; Liu, J. Poaceae-specific cell wall-derived oligosaccharides activate plant immunity via OsCERK1 during Magnaporthe oryzae infection in rice. Nat. Commun. 2021, 12, 2178. [Google Scholar] [CrossRef]
- Zuppini, A.; Navazio, L.; Sella, L.; Castiglioni, C.; Favaron, F.; Mariani, P. An endopolygalacturonase from Sclerotinia sclerotiorum induces calcium-mediated signaling and programmed cell death in soybean cells. Mol. Plant-Microbe Interact. 2005, 18, 849–855. [Google Scholar] [CrossRef]
- Chen, X.M.; Pan, S.; Bai, H.M.; Fan, J.X.; Batool, W.; Shabbir, A.; Han, Y.J.; Zheng, H.K.; Lu, G.D.; Lin, L.L.; et al. A nonclassically secreted effector of Magnaporthe oryzae targets host nuclei and plays important roles in fungal growth and plant infection. Mol. Plant Pathol. 2023, 24, 1093–1106. [Google Scholar] [CrossRef]
- Maricchiolo, E.; Panfili, E.; Pompa, A.; Marchis, F.D.; Bellucci, M.; Pallotta, M.T. Unconventional pathways of protein secretion: Mammals vs. plants. Front. Cell Dev. Biol. 2022, 10, 895853. [Google Scholar] [CrossRef]
- Silva, C.J.; Adaskaveg, J.A.; Mesquida-Pesci, S.D.; Ortega-Salazar, I.B.; Pattathil, S.; Zhang, L.S.; Hahn, M.G.; Kan, J.A.L.V.; Cantu, D.; Powell, A.L.T.; et al. Botrytis cinerea infection accelerates ripening and cell wall disassembly to promote disease in tomato fruit. Plant Physiol. 2023, 191, 575–590. [Google Scholar] [CrossRef]
- Nie, J.J.; Yin, Z.Y.; Li, Z.P.; Wu, Y.X.; Huang, L.L. A small cysteine-rich protein from two kingdoms of microbes is recognized as a novel pathogen-associated molecular pattern. New Phytol. 2019, 222, 995–1011. [Google Scholar] [CrossRef]
- Feurtey, A.; Lorrain, C.; McDonald, M.C.; Milgate, A.; Solomon, P.S.; Warren, R.; Puccetti, G.; Scalliet, G.; Torriani, S.F.F.; Gout, L.; et al. A thousand-genome panel retraces the global spread and adaptation of a major fungal crop pathogen. Nat. Commun. 2023, 14, 1059. [Google Scholar] [CrossRef]
- Jaroszuk-Ściseł, J.; Kurek, E. Hydrolysis of fungal and plant cell walls by enzymatic complexes from cultures of Fusarium isolates with different aggressiveness to rye (Secale cereale). Arch. Microbiol. 2012, 194, 653–665. [Google Scholar] [CrossRef]
- D’Ovidio, R.; Mattei, B.; Roberti, S.; Bellincampi, D. Polygalacturonases, polygalacturonase-inhibiting proteins and pectic oligomers in plant-pathogen interactions. BBA-Proteins Proteom. 2004, 1696, 237–244. [Google Scholar] [CrossRef]
- Kars, I.; Krooshof, G.H.; Wagemakers, L.; Joosten, R.; Benen, J.A.E.; Kan, J.A.L.V. Necrotizing activity of five Botrytis cinerea endopolygalacturonases produced in Pichia pastoris. Plant J. 2010, 43, 213–225. [Google Scholar] [CrossRef]
- Mistry, J.; Finn, R.D.; Eddy, S.R.; Bateman, A.; Punta, M. Challenges in homology search: HMMER3 and convergent evolution of coiled-coil regions. Nucleic Acids Res. 2013, 41, e121. [Google Scholar] [CrossRef]
- Marchler-Bauer, A.; Bo, Y.; Han, L.; He, J.; Lanczycki, C.J.; Lu, S.; Chitsaz, F.; Derbyshire, M.K.; Geer, R.C.; Gonzales, N.R.; et al. CDD/SPARCLE: Functional classification of proteins via subfamily domain architectures. Nucleic Acids Res. 2017, 45, 200–203. [Google Scholar] [CrossRef]
- Gasteiger, E.; Hoogland, C.; Gattiker, A.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein identification and analysis tools in the ExPASy server. In The Proteomics Protocols Handbook; Springer Nature: Berlin, Germany, 2005; pp. 571–607. [Google Scholar]
- Teufel, F.; Almagro Armenteros, J.J.; Johansen, A.R.; Gíslason, M.H.; Pihl, S.I.; Tsirigos, K.D.; Winther, O.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 6.0 predicts all five types of signal peptides using protein language models. Nat. Biotechnol. 2022, 40, 1023–1025. [Google Scholar] [CrossRef]
- Chou, K.; Shen, H. Cell-PLoc: A package of Web servers for predicting subcellular localization of proteins in various organisms. Nat. Protoc. 2008, 3, 153–162. [Google Scholar] [CrossRef]
- Chen, C.; Wu, Y.; Li, J.; Wang, X.; Zeng, Z.; Xu, J.; Liu, Y.; Feng, F.; Chen, H.; He, Y.; et al. TBtools-II: A “one for all, all for one” bioinformatics platform for biological big-data mining. Mol. Plant 2023, 16, 1733–1742. [Google Scholar] [CrossRef]
- Aragona, M.; Porta-Puglia, A. Genetic transformation of the phytopathogenic fungus Pyrenophora graminea. Mycol. Res. 1993, 97, 1143–1147. [Google Scholar] [CrossRef]
Gene | Gene ID | Number of Amino Acids/aa | Molecular Weight/kD | Isoelectric Point | GRAVY Index | Instability Index | Aliphatic Index | Signal Peptide Length | Subcellular Location |
---|---|---|---|---|---|---|---|---|---|
PgPG1 | P.graminea_GLEAN_10002343 | 392 | 41.62 | 5.60 | −0.174 | 31.85 | 81.10 | 18 | extracellular |
PgPG2 | P.graminea_GLEAN_10002483 | 370 | 37.04 | 8.31 | 0.114 | 21.89 | 81.73 | 19 | extracellular |
PgPG3 | P.graminea_GLEAN_10005830 | 448 | 48.31 | 6.24 | −0.276 | 37.10 | 79.82 | 19 | extracellular |
PgPG4 | P.graminea_GLEAN_10006636 | 705 | 74.98 | 5.98 | −0.252 | 37.08 | 74.89 | 19 | extracellular |
Conserved Motifs | E-Value | Number of Amino Acid | Amino Acid Sequence |
---|---|---|---|
Motif1 | 9.8 × 10−13 | 29 | HNTDGFDVGSSSNIVIQNSNVLNQDDCVA |
Motif2 | 2.2 × 10−7 | 27 | TNIHFKNLICNGGHGJSIGSVGGRSNN |
Motif3 | 1.5 × 10−4 | 21 | LDGNGQAWWDGKGSNGGVVKP |
Motif4 | 1.1 × 10−4 | 49 | DVTFEDITLSRISKYGIVIQQDYLNGGPTGSATNGVPITGLTJQNISGT |
Motif5 | 3.1 × 10−4 | 46 | FFFAHNLISSSISDIYIQNPPVQVFSISNCDGLTIDHITIDNSAGD |
Motif6 | 1.1 × 10−3 | 50 | TGAAAAIKAKAACSTIILBGIAVPAGTTLDLSGLKDGTTVTFQGKTTFGY |
Motif7 | 2.8 × 100 | 18 | KRPAEPDHPFHFKKWCDE |
Motif8 | 2.1 × 101 | 21 | VETVTFSNSSVSDATNGVRIK |
Motif9 | 1.5 × 101 | 26 | MMNDNVDNDVEFRFCGGDENLFPCNE |
Motif10 | 5.4 × 101 | 12 | PPRWKTCNDQWR |
Code | Primer | Sequence (5′–3′) | Restriction Site | Purpose |
---|---|---|---|---|
1 | PgPG1SP-EcoR I-F | CCGGAATTCATGCGTTCTAACGGGATTTT | EcoR I | Clone Pgpg1 to pSUC2 for signal peptide functional validation |
2 | PgPG1SP-Xho I-R | CCGCTCGAGGGCCTGCCCTACGGCGGCAA | Xho I | |
3 | PgPG1-SL-BamH I-F | CGGGATCCATGCGTTCTAACGGGATTTT | BamH I | Clone Pgpg1 to EGFP for subcellular localization assay in N. benthamiana |
4 | PgPG1-SL-Sma I-R | TCCCCCGGGCGCTGCTAGCTTGGAAACTG | Sma I | |
5 | PgPG1-RNAi-Kpn I-Xho I-F | GGGGTACCCCGCTCGAGGAGCAGCACCAACATCAAGA | Kpn I-Xho I | Clone RNAi segment to pSilent-1 for the construction of pSilent-1: Pgpg1 |
6 | PgPG1-RNAi-Bgl II-Hind III-R | GAAGATCTCCCAAGCTTCCACCGCCAGTAATATCCAC | Bgl II-Hind III | |
7 | PgPG1-OE-EcoR I-F | GGAATTCATGCGTTCTAACGGGATTTT | EcoR I | Clone Pgpg1 to pBARGPE1-Hyg-mCherryfor the construction of pBARGPE1-Hyg: Pgpg1 |
8 | PgPG1-OE-Xho I-R | CCGCTCGAGCGCTGCTAGCTTGGAAACTG | Xho I | |
9 | Hyg B-F | ATGAAAAAGCCTGAACTCAC | Generation of Pgpg1 mutants by the amplificationg segment of hygromycin resistance gene in Pyrenophora graminea | |
10 | Hyg B-R | CTATTCCTTTGCCCTCGGA | ||
11 | PgPG1-RNAi-RT-F | TCAAGATCCGCGACAGCAT | Expression level analysis of Pgpg1 genes in RNAi mutant of Pyrenophora graminea | |
12 | PgPG1-RNAi-RT-R | TGGCTGCCGTTGGAGTACA | ||
13 | PgPG1-OE-RT-F | CTGGACATTTACCACATCACTCTGA | Expression level analysis of Pgpg1 genes in OE mutants of Pyrenophora graminea | |
14 | PgPG1-OE-RT-R | CGTCAAATCCGTCGCTGTTA | ||
15 | Actin-F | GCGGTTACACCTCTCTACCAC | Expression level analysis of internal control gene Actin in Pyrenophora graminea | |
16 | Actin-R | AGTCTGGATCTCCTGCTCAAAG |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Si, E.; Guo, M.; Liu, H.; Li, C.; Wang, J.; Yao, L.; Meng, Y.; Ma, X.; Li, B.; Yang, K.; et al. The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. Int. J. Mol. Sci. 2025, 26, 2401. https://doi.org/10.3390/ijms26062401
Si E, Guo M, Liu H, Li C, Wang J, Yao L, Meng Y, Ma X, Li B, Yang K, et al. The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. International Journal of Molecular Sciences. 2025; 26(6):2401. https://doi.org/10.3390/ijms26062401
Chicago/Turabian StyleSi, Erjing, Ming Guo, Haiying Liu, Chengdao Li, Juncheng Wang, Lirong Yao, Yaxiong Meng, Xiaole Ma, Baochun Li, Ke Yang, and et al. 2025. "The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare" International Journal of Molecular Sciences 26, no. 6: 2401. https://doi.org/10.3390/ijms26062401
APA StyleSi, E., Guo, M., Liu, H., Li, C., Wang, J., Yao, L., Meng, Y., Ma, X., Li, B., Yang, K., Shang, X., & Wang, H. (2025). The Essentials of PgPG1, a Polygalacturonase-Encoding Gene for the Invasion of Pyrenophora graminea to Hordeum vulgare. International Journal of Molecular Sciences, 26(6), 2401. https://doi.org/10.3390/ijms26062401