IDE Degrades Nociceptin/Orphanin FQ through an Insulin Regulated Mechanism
Abstract
1. Introduction
2. Results
3. Discussion
4. Materials and Methods
5. Conclusions
Author Contributions
Funding
Conflicts of Interest
References
- Kaul, K.; Tarr, J.M.; Ahmad, S.I.; Kohner, E.M.; Chibber, R. Introduction to diabetes mellitus. Adv. Exp. Med. Biol. 2012, 771, 1–11. [Google Scholar] [PubMed]
- Saidian, M.; Lakey, J.R.T.; Ponticorvo, A.; Rowland, R.; Baldado, M.; Williams, J.; Pronda, M.; Alexander, M.; Flores, A.; Shiri, L.; et al. Characterisation of impaired wound healing in a preclinical model of induced diabetes using wide-field imaging and conventional immunohistochemistry assays. Int. Wound J. 2019, 16, 144–152. [Google Scholar] [CrossRef] [PubMed]
- Kaur, P.; Sharma, A.K.; Nag, D.; Das, A.; Datta, S.; Ganguli, A.; Goel, V.; Rajput, S.; Chakrabarti, G.; Basu, B.; et al. Novel nano-insulin formulation modulates cytokine secretion and remodeling to accelerate diabetic wound healing. Nanomedicine 2019, 15, 47–57. [Google Scholar] [CrossRef] [PubMed]
- Masood, N.; Ahmed, R.; Tariq, M.; Ahmed, Z.; Masoud, M.S.; Ali, I.; Asghar, R.; Andleeb, A.; Hasan, A. Silver nanoparticle impregnated chitosan-PEG hydrogel enhances wound healing in diabetes induced rabbits. Int. J. Pharm. 2019, 559, 23–36. [Google Scholar] [CrossRef] [PubMed]
- Telli, O.; Cavlak, U. Measuring the pain threshold and tolerance using electrical stimulation in patients with Type II diabetes mellitus. J. Diabetes Complicat. 2006, 20, 308–316. [Google Scholar] [CrossRef] [PubMed]
- Kukidome, D.; Nishikawa, T.; Sato, M.; Igata, M.; Kawashima, J.; Shimoda, S.; Matsui, K.; Obayashi, K.; Ando, Y.; Araki, E. Measurement of small fibre pain threshold values for the early detection of diabetic polyneuropathy. Diabet. Med. 2016, 33, 62–69. [Google Scholar] [CrossRef] [PubMed]
- Takeshita, N.; Yamaguchi, I. Insulin attenuates formalin-induced nociceptive response in mice through a mechanism that is deranged by diabetes mellitus. J. Pharmacol. Exp. Ther. 1997, 281, 315–321. [Google Scholar]
- Mollereau, C.; Parmentier, M.; Mailleux, P.; Butour, J.L.; Moisand, C.; Chalon, P.; Caput, D.; Vassart, G.; Meunier, J.C. ORL1, a novel member of the opioid receptor family. Cloning, functional expression and localization. FEBS Lett. 1994, 341, 33–38. [Google Scholar] [CrossRef]
- Bunzow, J.R.; Saez, C.; Mortrud, M.; Bouvier, C.; Williams, J.T.; Low, M.; Grandy, D.K. Molecular cloning and tissue distribution of a putative member of the rat opioid receptor gene family that is not a mu, delta or kappa opioid receptor type. FEBS Lett. 1994, 347, 284–288. [Google Scholar] [CrossRef]
- Calo’, G.; Guerrini, R.; Rizzi, A.; Salvadori, S.; Regoli, D. Pharmacology of nociceptin and its receptor: a novel therapeutic target. Br. J. Pharmacol. 2000, 129, 1261–1283. [Google Scholar] [CrossRef]
- Calo’, G.; Rizzi, A.; Bigoni, R.; Guerrini, R.; Salvadori, S.; Regoli, D. Pharmacological profile of Nociceptin/Orphanin FQ receptors. Clin. Exp. Pharmacol. Physiol. 2002, 29, 223–228. [Google Scholar] [CrossRef]
- Meunier, J.C.; Mollereau, C.; Toll, L.; Suaudeau, C.; Moisand, C.; Alvinerie, P.; Butour, J.L.; Guillemot, J.C.; Ferrara, P.; Monsarrat, B. Isolation and structure of the endogenous agonist of opioid receptor-like ORL1 receptor. Nature 1995, 377, 532–535. [Google Scholar] [CrossRef] [PubMed]
- Suder, P.; Kotlinska, J.; Smoluch, M.T.; Sällberg, M.; Silberring, J. Metabolic fate of nociceptin/orphanin FQ in the rat spinal cord and biological activity of its released fragment. Peptides 1999, 20, 239–247. [Google Scholar] [CrossRef]
- Grasso, G.; Lanza, V.; Malgieri, G.; Fattorusso, R.; Pietropaolo, A.; Rizzarelli, E.; Milardi, D. The insulin degrading enzyme activates ubiquitin and promotes the formation of K48 and K63 diubiquitin. Chem. Commun. (Camb) 2015, 51, 15724–15727. [Google Scholar] [CrossRef] [PubMed]
- Sbardella, D.; Tundo, G.R.; Coletta, A.; Marcoux, J.; Koufogeorgou, E.I.; Ciaccio, C.; Santoro, A.M.; Milardi, D.; Grasso, G.; Cozza, P.; et al. The insulin-degrading enzyme is an allosteric modulator of the 20S proteasome and a potential competitor of the 19S. Cell Mol. Life Sci. 2018, 75, 3441–3456. [Google Scholar] [CrossRef] [PubMed]
- Bellia, F.; Lanza, V.; Ahmed, I.M.M.; Garcia-Vinuales, S.; Veiss, E.; Arizzi, M.; Calcagno, D.; Milardi, D.; Grasso, G. Site directed mutagenesis of insulin-degrading enzyme allows singling out the molecular basis of peptidase versus E1-like activity: the role of metal ions. Metallomics 2019, 11, 278–281. [Google Scholar] [CrossRef] [PubMed]
- Tundo, G.R.; Sbardella, D.; Ciaccio, C.; Grasso, G.; Gioia, M.; Coletta, A.; Polticelli, F.; Di Pierro, D.; Milardi, D.; Van Endert, P.; et al. Multiple functions of insulin-degrading enzyme: a metabolic crosslight? Crit. Rev. Biochem. Mol. Biol. 2017, 52, 554–582. [Google Scholar] [CrossRef]
- Grasso, G.; Pietropaolo, A.; Spoto, G.; Pappalardo, G.; Tundo, G.R.; Ciaccio, C.; Coletta, M.; Rizzarelli, E. Copper(I) and Copper(II) Inhibit Aβ Peptides Proteolysis by Insulin-Degrading Enzyme Differently: Implications for Metallostasis Alteration in Alzheimer’s Disease. Chem. Eur. J. 2011, 17, 2752–2762. [Google Scholar] [CrossRef]
- Grasso, G.; Salomone, F.; Tundo, G.R.; Pappalardo, G.; Ciaccio, C.; Spoto, G.; Pietropaolo, A.; Coletta, M.; Rizzarelli, E. Metal ions affect insulin-degrading enzyme activity. J. Inorg. Biochem. 2012, 117, 351–358. [Google Scholar] [CrossRef]
- Bellia, F.; Grasso, G. The role of copper(II) and zinc(II) in the degradation of human and murine IAPP by insulin-degrading enzyme. J. Mass. Spectrom. 2014, 49, 274–279. [Google Scholar] [CrossRef]
- Ciaccio, C.; Tundo, G.R.; Grasso, G.; Spoto, G.; Marasco, D.; Ruvo, M.; Gioia, M.; Rizzarelli, E.; Coletta, M. Somatostatin: a novel substrate and a modulator of insulin-degrading enzyme activity. J. Mol. Biol. 2009, 385, 1556–1567. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Gray, S.M.; Barrett, E.J. Insulin transport into the brain. Am. J. Physiol. Cell Physiol. 2018, 315, C125–C136. [Google Scholar] [CrossRef] [PubMed]
- Grasso, G.; Rizzarelli, E.; Spoto, G. AP/MALDI-MS complete characterization of the proteolytic fragments produced by the interaction of insulin degrading enzyme with bovine insulin. J. Mass. Spectrom. 2007, 42, 1590–1598. [Google Scholar] [CrossRef] [PubMed]
- Grasso, G.; Rizzarelli, E.; Spoto, G. The proteolytic activity of insulin-degrading enzyme: a mass spectrometry study. J. Mass. Spectrom. 2009, 44, 735–741. [Google Scholar] [CrossRef] [PubMed]
- Bellia, F.; Pietropaolo, A.; Grasso, G. Formation of insulin fragments by insulin-degrading enzyme: the role of zinc(II) and cystine bridges. J. Mass. Spectrom. 2013, 48, 135–140. [Google Scholar] [CrossRef] [PubMed]
- Rossi, G.C.; Leventhal, L.; Bolan, E.; Pasternak, G.W. Pharmacological characterization of orphanin FQ/nociceptin and its fragments. J. Pharmacol. Exp. Ther. 1997, 282, 858–865. [Google Scholar] [PubMed]
- Rossi, G.C.; Perlmutter, M.; Leventhal, L.; Talatti, A.; Pasternak, G.W. Orphanin FQ/nociceptin analgesia in the rat. Brain Res. 1998, 792, 327–330. [Google Scholar] [CrossRef]
- Sakurada, C.; Sakurada, S.; Katsuyama, S.; Sasaki, J.; Tan-No, K.; Sakurada, T. Involvement of tachykinin NK1 receptors in nociceptin-induced hyperalgesia in mice. Brain Res. 1999, 841, 85–92. [Google Scholar] [CrossRef]
- Bellia, F.; Lanza, V.; Garcia-Vinuales, S.; Ahmed, I.M.M.; Pietropaolo, A.; Iacobucci, C.; Malgieri, G.; D’Abrosca, G.; Fattorusso, R.; Nicoletti, V.G.; et al. Ubiquitin binds the amyloid β peptide and interferes with its clearance pathways. Chem. Sci. 2019, 10, 2732. [Google Scholar] [CrossRef] [PubMed]
- Silberring, J.; Nyberg, F. A novel bovine spinal cord endoprotease with high specificity for dynorphin B. J. Biol. Chem. 1989, 264, 11082–11086. [Google Scholar] [PubMed]
- Grasso, G.; Mielczarek, P.; Niedziolka, M.; Silberring, J. Metabolism of Cryptic Peptides Derived from Neuropeptide FF Precursors: The Involvement of Insulin-Degrading Enzyme. Int. J. Mol. Sci. 2014, 15, 16787–16799. [Google Scholar] [CrossRef] [PubMed]
- Madiraju, S.R.M.; Poitout, V. GPCRs and Insulin Secretion: 119 and Counting. Endocrinology 2007, 148, 2598–2600. [Google Scholar] [CrossRef] [PubMed]
Abbreviation | Amino acid sequence | Measured m/z | Calculated m/z | z | MW | Δm (ppm) | RT (min) |
---|---|---|---|---|---|---|---|
1-16 | FGGFTGARKSARKLAN | 420.9884 | 420.9878 | 4 | 1682.944 | 1.4 | 16.0 |
1-9 | FGGFTGARK | 470.7546 | 470.7536 | 2 | 942.5145 | 2.1 | 16.5 |
1-11 | FGGFTGARKSA | 366.8609 | 366.8612 | 3 | 1100.584 | −0.8 | 16.6 |
1-8 | FGGFTGAR | 406.7068 | 406.7061 | 2 | 814.4195 | 1.7 | 18.0 |
2-11 | GGFTGARKSA | 476.2534 | 476.2540 | 2 | 953.5152 | −1.3 | 16.6 |
1-12 | FGGFTGARKSAR | 418.8953 | 418.8949 | 3 | 1256.685 | 1.0 | 15.8 |
1-10 | FGGFTGARKS | 343.1827 | 343.1822 | 3 | 1029.547 | 1.5 | 16.4 |
Abbr. | Amino acid sequence | Meas. m/z | Calc. m/z | z | MW | Δm (ppm) | RT (min) |
---|---|---|---|---|---|---|---|
A1-21 B1-30 | GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT | 1162.3356 | 1162.3335 | 5 | 5810.690 | 1.8 | 25.0 |
A14-21 B17-24 | YQLENYCN LVCGERGF | 641.9489 | 641.9503 | 3 | 1926.858 | −2.2 | 19.8 |
A14-21 B14-30 | YQLENYCN ALYLVCGERGFFYTPKT | 752.8557 | 752.8544 | 4 | 3011.418 | 1.7 | 23.0 |
A1-13 B1-9 | GIVEQCCTSICSL FVNQHLCGS | 785.6805 | 785.6794 | 3 | 2358.045 | 1.4 | 21.7 |
A14-21 B17-25 | YQLENYCN LVCGERGFF | 690.9723 | 690.9731 | 3 | 2073.927 | −1.2 | 21.9 |
A14-21 B14-24 | YQLENYCN ALYLVCGERGF | 757.6795 | 757.6785 | 3 | 2274.043 | 1.3 | 22.4 |
A14-21 B14-25 | YQLENYCN ALYLVCGERGFF | 806.7005 | 806.7013 | 3 | 2421.111 | −1.0 | 23.4 |
A14-21 B10-30 | YQLENYCN HLVEALYLVCGERGFFYTPKT | 872.4189 | 872.4179 | 4 | 3489.672 | 1.1 | 24.1 |
© 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Zingale, G.A.; Bellia, F.; Ahmed, I.M.M.; Mielczarek, P.; Silberring, J.; Grasso, G. IDE Degrades Nociceptin/Orphanin FQ through an Insulin Regulated Mechanism. Int. J. Mol. Sci. 2019, 20, 4447. https://doi.org/10.3390/ijms20184447
Zingale GA, Bellia F, Ahmed IMM, Mielczarek P, Silberring J, Grasso G. IDE Degrades Nociceptin/Orphanin FQ through an Insulin Regulated Mechanism. International Journal of Molecular Sciences. 2019; 20(18):4447. https://doi.org/10.3390/ijms20184447
Chicago/Turabian StyleZingale, Gabriele Antonio, Francesco Bellia, Ikhlas Mohamed Mohamud Ahmed, Przemyslaw Mielczarek, Jerzy Silberring, and Giuseppe Grasso. 2019. "IDE Degrades Nociceptin/Orphanin FQ through an Insulin Regulated Mechanism" International Journal of Molecular Sciences 20, no. 18: 4447. https://doi.org/10.3390/ijms20184447
APA StyleZingale, G. A., Bellia, F., Ahmed, I. M. M., Mielczarek, P., Silberring, J., & Grasso, G. (2019). IDE Degrades Nociceptin/Orphanin FQ through an Insulin Regulated Mechanism. International Journal of Molecular Sciences, 20(18), 4447. https://doi.org/10.3390/ijms20184447