Antimicrobial Potential of Scorpion-Venom-Derived Peptides
Abstract
:1. Introduction
2. Composition of Scorpion Venoms
3. Antimicrobial Potential of Scorpion Venom Peptides
3.1. Antibacterial Peptides Derived from Scorpion Venoms
Scorpion Species | Peptides | Amino Acid Sequence and Length | * Hydrophobicity (kcal × mol−1) | * Molecular Weight (Da) | * pI | * Net Charge | Antimicrobial Activity | References |
---|---|---|---|---|---|---|---|---|
M. martensii | BmKn2 | FIGAIANLLSKIF (13) | 4.88 | 1405.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [48] |
M. martensii | Kn2-7 | FIGAIAKLLKKIF (13) | 9.17 | 1460.9 | 10.86 | +3 | Gram-positive and Gram-negative bacteria | [49] |
O. Madagascariensis | IsCT1 | ILGKIWEGIKSLF (13) | 10.23 | 1502.8 | 9.74 | +1 | Gram-positive and Gram-negative bacteria | [58] |
O. Madagascariensis | IsCT2 | IFGAIWNGIKSLF (13) | 4.69 | 1464.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [58] |
V. subcristatus | VsCT1 | FLKGIIDTVSNWL (13) | 8.05 | 1504.8 | 6.71 | 0 | Gram-positive and Gram-negative bacteria | [59] |
V. subcristatus | VsCT2 | FLKGIIDTVSKLF (13) | 10.38 | 1479.8 | 9.74 | +1 | Gram-positive and Gram-negative bacteria | [59] |
V. mexicanus | VmCT1 | FLGALWNVAKSVF (13) | 5.23 | 1450.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [60] |
V. mexicanus | VmCT2 | FLSTLWNAAKSIF (13) | 4.59 | 1496.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [60] |
U. yaschenkoi | UyCT3 | ILSAIWSGIKSLF (13) | 4.07 | 1433.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. yaschenkoi | UyCT5 | IWSAIWSGIKGLL (13) | 4.38 | 1442.8 | 10.14 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. yaschenkoi | Uy17 | ILSAIWSGIKGLL (13) | 5.22 | 1369.8 | 10.14 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. yaschenkoi | Uy192 | FLSTIWNGIKGLL (13) | 4.77 | 1460.8 | 10.14 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. manicatus | Um4 | FFSALLSGIKSLF (13) | 3.73 | 1428.8 | 9.93 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. manicatus | Um5 | IFKAIWSGIKSLF (13) | 5.95 | 1508.9 | 10.59 | +2 | Gram-positive and Gram-negative bacteria | [61] |
U. yaschenkoi | UyCT1 | GFWGKLWEGVKNAI (14) | 13.21 | 1603.8 | 9.94 | +1 | Gram-positive and Gram-negative bacteria | [61] |
U. manicatus | Um3 | GFWGKLWEGVKSAI (14) | 12.82 | 1576.6 | 9.94 | +1 | Gram-positive and Gram-negative bacteria | [61] |
T. stigmurus | StigA6 | FFSLIPKLVKGLISAFK (17) | 7.43 | 1907.1 | 10.86 | +3 | Gram-positive and Gram-negative bacteria | [51] |
T. stigmurus | StigA16 | FFKLIPKLVKGLISAFK (17) | 9.77 | 1948.2 | 11.03 | +4 | Gram-positive and Gram-negative bacteria | [51] |
T. stigmurus | StigA25 | FFSLIPSLVKKLIKAFK (17) | 9.08 | 1978.2 | 11.03 | +4 | Gram-positive and Gram-negative bacteria | [52] |
T. stigmurus | StigA31 | FFKLIPKLVKKLIKAFK (17) | 13.76 | 2060.3 | 11.25 | +6 | Gram-positive and Gram-negative bacteria | [52] |
L. mucronatus | Mucroporin | LFGLIPSLIGGLVSAFK (17) | 4.59 | 1731.0 | 9.8 | +1 | Gram-positive and Gram-negative bacteria | [62] |
L. mucronatus | mucroporin-M1 | LFRLIKSLIKRLVSAFK (17) | 10.22 | 2031.3 | 12.51 | +5 | Gram-positive and Gram-negative bacteria | [62] |
U. yaschenkoi | Uy234 | FPFLLSLIPSAISAIKRL (18) | 3.39 | 1985.2 | 11.55 | +2 | Gram-positive and Gram-negative bacteria | [61] |
A. amoreuxi | AamAP1 | FLFSLIPHAIGGLISAFK (18) | 5.15 | 1930.1 | 9.80 | +1 | Gram-positive and Gram-negative bacteria | [63] |
A. amoreuxi | AamAP2 | FPFSLIPHAIGGLISAIK (18) | 7.13 | 1880.1 | 9.80 | +1 | Gram-positive and Gram-negative bacteria | [63] |
U. manicatus | Um2 | ISQSDAILSAIWSGIKSLF (19) | 8.78 | 2035.1 | 6.55 | 0 | Gram-positive and Gram-negative bacteria | [61] |
V. punctatus | VpAmp1.0 | LPFFLLSLIPSAISAIKKI (19) | 3.26 | 2070.3 | 10.65 | +2 | Gram-positive and Gram-negative bacteria | [64] |
V. punctatus | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK (25) | 16.02 | 2622.4 | 11.03 | +4 | Gram-positive and Gram-negative bacteria | [64] |
C. suffuses | Css54 | FFGSLLSLGSKLLPSVFKLFQRKKE (25) | 14.79 | 2868.6 | 11.02 | +4 | Gram-positive and Gram-negative bacteria | [65] |
H. spinifer | HsAp | SGTSEKERESGRLLGVVKRLIVCFRSPFP (29) | 27.76 | 3246.7 | 10.83 | +3 | Gram-positive and Gram-negative bacteria | [66] |
P. imperator | Pantinin-2 | IFGAIWKGISSLL (13) | 4.76 | 1403.8 | 10.14 | +1 | Gram-positive bacteria | [53] |
P. imperator | Pantinin-3 | FLSTIWNGIKSLL (13) | 4.08 | 1490.8 | 10.14 | +1 | Gram-positive bacteria | [53] |
P. imperator | Pantinin-1 | GILGKLWEGFKSIV (14) | 12.04 | 1545.9 | 9.93 | +1 | Gram-positive bacteria | [53] |
H. petersii | Hp1470 | IFKAIWSGINRLF (13) | 5.35 | 1563.9 | 11.53 | +2 | Gram-positive bacteria | [67] |
S. tibetanus | StCT2 | GFWGKLWEGVKSAI (14) | 12.82 | 1576.8 | 9.94 | +1 | Gram-positive bacteria | [54] |
T. stigmurus | Stigmurin | FFSLIPSLVGGLISAFK (17) | 3.44 | 1795.0 | 9.80 | +1 | Gram-positive bacteria | [50] |
I. maculates | Imcroporin | FFSLLPSLIGGLVSAIK (17) | 3.90 | 1761.0 | 9.80 | +1 | Gram-positive bacteria | [68] |
T. serrulatus | TsAP-2 | FLGMIPGLIGGLISAFK (17) | 5.20 | 1732.9 | 9.80 | +1 | Gram-positive bacteria | [55] |
M. martensii | Marcin-18 | FFGHLFKLATKIIPSLFR (18) | 7.31 | 2134.2 | 11.68 | +3 | Gram-positive bacteria | [57] |
U. yaschenkoi | Uy234 | FPFLLSLIPSAISAIKRL (18) | 3.39 | 1985.2 | 11.55 | +2 | Gram-positive bacteria | [69] |
O. glabrifrons | Opisin | FWSWLMKAATKLLPSMLGS (19) | 5.19 | 2166.1 | 10.58 | +2 | Gram-positive bacteria | [70] |
A. aeneas | AaeAP1 | FLFSLIPSVIAGLVSAIRN (19) | 2.78 | 2016.2 | 10.60 | +1 | Gram-positive bacteria | [56] |
A. aeneas | AaeAP2 | FLFSLIPSAIAGLVSAIRN (19) | 3.74 | 1988.1 | 10.60 | +1 | Gram-positive bacteria | [56] |
C. tricostatus | Ctriporin | FLWGLIPGAISAVTSLIKK (19) | 6.74 | 2013.2 | 10.57 | +2 | Gram-positive bacteria | [71] |
P. imperator | Pandinin-2 | FWGALAKGALKLIPSLFSSFSKKD (24) | 15.18 | 2610.4 | 10.62 | +3 | Gram-positive bacteria | [72] |
H. spinifer | Heterin-2 | FWGALAKGALKLIPSLVSSFTKKD (24) | 16.22 | 2576.4 | 10.62 | +3 | Gram-positive bacteria | [73] |
H. petersii | Hp1404 | GILGKLWEGVKSIF (14) | 12.04 | 1545.9 | 9.74 | +1 | Gram-negative bacteria | [47] |
3.2. Antifungal Peptides Derived from Scorpion Venoms
3.3. Antiparasitic Peptides Derived from Scorpion Venoms
Scorpion Species | Peptides | Amino Acid Sequence and Length | * Hydrophobicity (kcal × mol−1) | * Molecular Weight (Da) | * pI | * Net Charge | Antimicrobial Activity | References |
---|---|---|---|---|---|---|---|---|
V. mexicanus | VmCT1 | FLGALWNVAKSVF (13) | 5.23 | 1450.8 | 9.93 | +1 | T. cruzi | [102] |
T. stigmurus | StigA6 | FFSLIPKLVKGLISAFK (17) | 7.43 | 1907.1 | 10.86 | +3 | T. cruzi | [51] |
T. stigmurus | StigA16 | FFKLIPKLVKGLISAFK (17) | 9.77 | 1948.2 | 11.03 | +4 | T. cruzi | [51] |
T. stigmurus | StigA25 | FFSLIPSLVKKLIKAFK (17) | 9.08 | 1978.2 | 11.03 | +4 | T. cruzi | [52] |
T. stigmurus | StigA31 | FFKLIPKLVKKLIKAFK (17) | 13.76 | 2060.3 | 11.25 | +6 | T. cruzi | [52] |
M. eupeus | Meucin-24 | GRGREFMSNLKEKLSGVKEKMKNS (24) | 36.93 | 2752.4 | 10.72 | +4 | P. falciparum | [101] |
M. eupeus | Meucin-25 | VKLIQIRIWIQYVTVLQMFSMKTKQ (25) | 7.94 | 3093.7 | 10.92 | +4 | P. falciparum | [101] |
Scorpion Species | Peptides | Peptide Length (S–S Bridge) | Sequence | Classification | Antimicrobial Activity | References |
---|---|---|---|---|---|---|
H. gertschi | Hge36 | 48 (3) | VHKMAKNQFGCFANVDVKGDCKRHCKAEDKEGICHGTKCKCGVPISYL | KTx | T. crassiceps | [103] |
P. imperator | Scorpine | 75 (3) | GWINEEKIQKKIDERMGNTVLGGMAKAIVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY | KTx | P. berghei | [82] |
4. Discussion
4.1. Trends in Various Targets and Mechanisms of Antimicrobial Peptides
4.2. Trends in Modifying the Stability and Bioavailability of Antimicrobial Peptides
4.3. Trends in Structure Modification and Grafting of Antimicrobial Peptides
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
Abbreviations
AMPs | antimicrobial peptides |
AMR | antimicrobial resistance |
DBPs | disulfide-bridged peptides |
CaTx | calcium channel toxins |
ClTx | chloride channel bound toxins |
HIV | human immunodeficiency virus |
IC50 | 50% inhibitory concentration |
LPS | lipopolysaccharides |
LTA | lipoteichoic acid |
MIC | minimum inhibitory concentration |
MRSA | methicillin-resistant Staphylococcus aureus |
KTx | potassium channel toxins |
NaTx | sodium channel toxins |
NDBPs | non-disulfide-bridged peptides |
TRPTx | TRP channel toxins |
µM | micromolar |
References
- Diard, M.; Hardt, W.D. Evolution of bacterial virulence. FEMS Microbiol. Rev. 2017, 41, 679–697. [Google Scholar] [CrossRef] [PubMed]
- Lopes Fischer, N.; Naseer, N.; Shin, S.; Brodsky, I.E. Effector-triggered immunity and pathogen sensing in metazoans. Nat. Microbiol. 2020, 5, 14–26. [Google Scholar] [CrossRef] [PubMed]
- Luo, X.; Deng, H.; Ding, L.; Ye, X.; Sun, F.; Qin, C.; Chen, Z. Cationicity enhancement on the hydrophilic face of ctriporin significantly reduces its hemolytic activity and improves the antimicrobial activity against antibiotic-resistant ESKAPE pathogens. Toxins 2024, 16, 156. [Google Scholar] [CrossRef] [PubMed]
- Qiongxian, Y.; Jun, D.; Zhenfeng, Z.; Tongyou, L.; Zhicong, T.; Zhenyou, T. The therapeutic potential of indole hybrids, dimers, and trimers against drug-resistant ESKAPE pathogens. Arch. Pharm. 2024, 357, e2400295. [Google Scholar] [CrossRef] [PubMed]
- Brinkac, L.; Voorhies, A.; Gomez, A.; Nelson, K.E. The threat of antimicrobial resistance on the human microbiome. Microb. Ecol. 2017, 74, 1001–1008. [Google Scholar] [CrossRef] [PubMed]
- Huemer, M.; Mairpady Shambat, S.; Brugger, S.D.; Zinkernagel, A.S. Antibiotic resistance and persistence-Implications for human health and treatment perspectives. EMBO Rep. 2020, 21, e51034. [Google Scholar] [CrossRef]
- Gu, Y.; Shen, S.; Han, B.; Tian, X.; Yang, F.; Zhang, K. Family livestock waste: An ignored pollutant resource of antibiotic resistance genes. Ecotoxicol. Environ. Saf. 2020, 197, 110567. [Google Scholar] [CrossRef]
- Panayi, T.; Diavoli, S.; Nicolaidou, V.; Papaneophytou, C.; Petrou, C.; Sarigiannis, Y. Short-chained linear scorpion peptides: A pool for novel antimicrobials. Antibiotics 2024, 13, 422. [Google Scholar] [CrossRef]
- Larsson, D.G.J.; Flach, C.F. Antibiotic resistance in the environment. Nat. Rev. Microbiol. 2022, 20, 257–269. [Google Scholar] [CrossRef]
- Lubanga, A.F.; Bwanali, A.N.; Kambiri, F.; Harawa, G.; Mudenda, S.; Mpinganjira, S.L.; Singano, N.; Makole, T.; Kapatsa, T.; Kamayani, M.; et al. Tackling antimicrobial resistance in sub-Saharan Africa: Challenges and opportunities for implementing the new people-centered WHO guidelines. Expert Rev. Anti-Infect. Ther. 2024, 22, 379–386. [Google Scholar] [CrossRef]
- Mancuso, G.; Midiri, A.; Gerace, E.; Biondo, C. Bacterial antibiotic resistance: The most critical pathogens. Pathogens 2021, 10, 1310. [Google Scholar] [CrossRef] [PubMed]
- Pandey, R.P.; Mukherjee, R.; Chang, C.M. Antimicrobial resistance surveillance system mapping in different countries. Drug Target Insights 2022, 16, 36–48. [Google Scholar] [CrossRef] [PubMed]
- Matthiessen, L.E.; Hald, T.; Vigre, H. System mapping of antimicrobial resistance to combat a rising global health crisis. Front. Public Health 2022, 10, 816943. [Google Scholar] [CrossRef] [PubMed]
- Lakhundi, S.; Zhang, K. Methicillin-resistant Staphylococcus aureus: Molecular characterization, evolution, and epidemiology. Clin. Microbiol. Rev. 2018, 31, e00020-18. [Google Scholar] [CrossRef] [PubMed]
- Sapugahawatte, D.N.; Li, C.; Yeoh, Y.K.; Dharmaratne, P.; Zhu, C.; Ip, M. Swine methicillin-resistant Staphylococcus aureus carrying toxic-shock syndrome toxin gene in Hong Kong, China. Emerg. Microbes Infect. 2020, 9, 1534–1536. [Google Scholar] [CrossRef]
- Bai, S.; Wen, X.; Li, B.; Hu, R.; Yang, J.; Yu, Q.; Zeng, X.; Feng, H.; Zhu, F.; Cai, Z.; et al. Extracellular vesicles from alveolar macrophages harboring phagocytosed methicillin-resistant Staphylococcus aureus induce necroptosis. Cell Rep. 2024, 43, 114453. [Google Scholar] [CrossRef]
- Lourenco, W.R. The evolution and distribution of noxious species of scorpions (Arachnida: Scorpiones). J. Venom. Anim. Toxins Incl. Trop. Dis. 2018, 24, 1. [Google Scholar] [CrossRef]
- Santibanez-Lopez, C.E.; Francke, O.F.; Ureta, C.; Possani, L.D. Scorpions from Mexico: From species diversity to venom complexity. Toxins 2015, 8, 2. [Google Scholar] [CrossRef]
- Cid-Uribe, J.I.; Veytia-Bucheli, J.I.; Romero-Gutierrez, T.; Ortiz, E.; Possani, L.D. Scorpion venomics: A 2019 overview. Expert Rev. Proteom. 2020, 17, 67–83. [Google Scholar] [CrossRef]
- Sachkova, M.Y.; Landau, M.; Surm, J.M.; Macrander, J.; Singer, S.A.; Reitzel, A.M.; Moran, Y. Toxin-like neuropeptides in the sea anemone Nematostella unravel recruitment from the nervous system to venom. Proc. Natl. Acad. Sci. USA 2020, 117, 27481–27492. [Google Scholar] [CrossRef]
- Santibanez-Lopez, C.E.; Aharon, S.; Ballesteros, J.A.; Gainett, G.; Baker, C.M.; Gonzalez-Santillan, E.; Harvey, M.S.; Hassan, M.K.; Abu Almaaty, A.H.; Aldeyarbi, S.M.; et al. Phylogenomics of scorpions reveal contemporaneous diversification of scorpion mammalian predators and mammal-active sodium channel toxins. Syst. Biol. 2022, 71, 1281–1289. [Google Scholar] [CrossRef] [PubMed]
- Forde, A.; Jacobsen, A.; Dugon, M.M.; Healy, K. Scorpion species with smaller body sizes and narrower chelae have the highest venom potency. Toxins 2022, 14, 219. [Google Scholar] [CrossRef] [PubMed]
- Quintero-Hernandez, V.; Jimenez-Vargas, J.M.; Gurrola, G.B.; Valdivia, H.H.; Possani, L.D. Scorpion venom components that affect ion-channels function. Toxicon 2013, 76, 328–342. [Google Scholar] [CrossRef] [PubMed]
- Duenas-Cuellar, R.A.; Santana, C.J.C.; Magalhaes, A.C.M.; Pires, O.R., Jr.; Fontes, W.; Castro, M.S. Scorpion toxins and ion channels: Potential applications in cancer therapy. Toxins 2020, 12, 326. [Google Scholar] [CrossRef] [PubMed]
- Xu, X.; Duan, Z.; Di, Z.; He, Y.; Li, J.; Li, Z.; Xie, C.; Zeng, X.; Cao, Z.; Wu, Y.; et al. Proteomic analysis of the venom from the scorpion Mesobuthus martensii. J. Proteom. 2014, 106, 162–180. [Google Scholar] [CrossRef]
- Cao, Z.; Yu, Y.; Wu, Y.; Hao, P.; Di, Z.; He, Y.; Chen, Z.; Yang, W.; Shen, Z.; He, X.; et al. The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat. Commun. 2013, 4, 2602–2612. [Google Scholar] [CrossRef]
- Li, Z.; Hu, P.; Wu, W.; Wang, Y. Peptides with therapeutic potential in the venom of the scorpion Buthus martensii Karsch. Peptides 2019, 115, 43–50. [Google Scholar] [CrossRef]
- Ortiz, E.; Gurrola, G.B.; Schwartz, E.F.; Possani, L.D. Scorpion venom components as potential candidates for drug development. Toxicon 2015, 93, 125–135. [Google Scholar] [CrossRef]
- Ahmadi, S.; Knerr, J.M.; Argemi, L.; Bordon, K.C.F.; Pucca, M.B.; Cerni, F.A.; Arantes, E.C.; Caliskan, F.; Laustsen, A.H. Scorpion venom: Detriments and benefits. Biomedicines 2020, 8, 118. [Google Scholar] [CrossRef]
- Peter Muiruri, K.; Zhong, J.; Yao, B.; Lai, R.; Luo, L. Bioactive peptides from scorpion venoms: Therapeutic scaffolds and pharmacological tools. Chin. J. Nat. Med. 2023, 21, 19–35. [Google Scholar] [CrossRef]
- Xia, Z.; He, D.; Wu, Y.; Kwok, H.F.; Cao, Z. Scorpion venom peptides: Molecular diversity, structural characteristics, and therapeutic use from channelopathies to viral infections and cancers. Pharmacol. Res. 2023, 197, 106978. [Google Scholar] [CrossRef] [PubMed]
- Lu, W.; Cheng, X.; Chen, J.; Wang, M.; Chen, Y.; Liu, J.; Sang, M.; Zhao, N.; Yan, H.; Cheng, X.; et al. A Buthus martensii Karsch scorpion sting targets Nav1.7 in mice and mimics a phenotype of human chronic pain. Pain 2022, 163, e202–e214. [Google Scholar] [CrossRef] [PubMed]
- Qin, C.; Yang, X.; Zuo, Z.; Yang, L.; Yang, F.; Cao, Z.; Chen, Z.; Wu, Y. BmK86-P1, a new degradation peptide with desirable thermostability and Kv1.2 channel-specific activity from traditional Chinese scorpion medicinal material. Toxins 2021, 13, 610. [Google Scholar] [CrossRef]
- Lin King, J.V.; Emrick, J.J.; Kelly, M.J.S.; Herzig, V.; King, G.F.; Medzihradszky, K.F.; Julius, D. A cell-penetrating scorpion toxin enables mode-specific modulation of TRPA1 and pain. Cell 2019, 178, 1362–1374.e16. [Google Scholar] [CrossRef] [PubMed]
- Oliveira-Mendes, B.B.R.; Horta, C.C.R.; do Carmo, A.O.; Biscoto, G.L.; Sales-Medina, D.F.; Leal, H.G.; Brandao-Dias, P.F.P.; Miranda, S.E.M.; Aguiar, C.J.; Cardoso, V.N.; et al. CPP-Ts: A new intracellular calcium channel modulator and a promising tool for drug delivery in cancer cells. Sci. Rep. 2018, 8, 14739. [Google Scholar] [CrossRef]
- Ortiz, E.; Possani, L.D. Scorpion toxins to unravel the conundrum of ion channel structure and functioning. Toxicon 2018, 150, 17–27. [Google Scholar] [CrossRef]
- Bai, F.; Song, Y.; Cao, Y.; Ban, M.; Zhang, Z.; Sun, Y.; Feng, Y.; Li, C. Scorpion neurotoxin Syb-prII-1 exerts analgesic effect through Nav1.8 channel and MAPKs pathway. Int. J. Mol. Sci. 2022, 23, 7065. [Google Scholar] [CrossRef]
- Zeng, X.C.; Corzo, G.; Hahin, R. Scorpion venom peptides without disulfide bridges. IUBMB Life 2005, 57, 13–21. [Google Scholar] [CrossRef]
- Almaaytah, A.; Albalas, Q. Scorpion venom peptides with no disulfide bridges: A review. Peptides 2014, 51, 35–45. [Google Scholar] [CrossRef]
- Uzair, B.; Bint, E.I.S.; Khan, B.A.; Azad, B.; Mahmood, T.; Rehman, M.U.; Braga, V.A. Scorpion venom peptides as a potential source for human drug candidates. Protein Pept. Lett. 2018, 25, 702–708. [Google Scholar] [CrossRef]
- Rincon-Cortes, C.A.; Bayona-Rojas, M.A.; Reyes-Montano, E.A.; Vega-Castro, N.A. Antimicrobial activity developed by scorpion venoms and its peptide component. Toxins 2022, 14, 740. [Google Scholar] [CrossRef] [PubMed]
- Harrison, P.L.; Abdel-Rahman, M.A.; Miller, K.; Strong, P.N. Antimicrobial peptides from scorpion venoms. Toxicon 2014, 88, 115–137. [Google Scholar] [CrossRef] [PubMed]
- Primon-Barros, M.; Jose Macedo, A. Animal venom peptides: Potential for new antimicrobial agents. Curr. Top. Med. Chem. 2017, 17, 1119–1156. [Google Scholar] [CrossRef] [PubMed]
- Daniele-Silva, A.; Rodrigues, S.C.S.; Dos Santos, E.C.G.; Queiroz Neto, M.F.; Rocha, H.A.O.; Silva-Junior, A.A.D.; Resende, J.M.; Araujo, R.M.; Fernandes-Pedrosa, M.F. NMR three-dimensional structure of the cationic peptide Stigmurin from Tityus stigmurus scorpion venom: In vitro antioxidant and in vivo antibacterial and healing activity. Peptides 2021, 137, 170478. [Google Scholar] [CrossRef] [PubMed]
- Christaki, E.; Marcou, M.; Tofarides, A. Antimicrobial resistance in bacteria: Mechanisms, evolution, and persistence. J. Mol. Evol. 2020, 88, 26–40. [Google Scholar] [CrossRef]
- Assoni, L.; Milani, B.; Carvalho, M.R.; Nepomuceno, L.N.; Waz, N.T.; Guerra, M.E.S.; Converso, T.R.; Darrieux, M. Resistance mechanisms to antimicrobial peptides in Gram-positive bacteria. Front. Microbiol. 2020, 11, 593215. [Google Scholar] [CrossRef]
- Li, Z.; Xu, X.; Meng, L.; Zhang, Q.; Cao, L.; Li, W.; Wu, Y.; Cao, Z. Hp1404, a new antimicrobial peptide from the scorpion Heterometrus petersii. PLoS ONE 2014, 9, e97539. [Google Scholar] [CrossRef]
- Zeng, X.C.; Wang, S.X.; Zhu, Y.; Zhu, S.Y.; Li, W.X. Identification and functional characterization of novel scorpion venom peptides with no disulfide bridge from Buthus martensii Karsch. Peptides 2004, 25, 143–150. [Google Scholar] [CrossRef]
- Cao, L.; Dai, C.; Li, Z.; Fan, Z.; Song, Y.; Wu, Y.; Cao, Z.; Li, W. Antibacterial activity and mechanism of a scorpion venom peptide derivative in vitro and in vivo. PLoS ONE 2012, 7, e40135. [Google Scholar] [CrossRef]
- de Melo, E.T.; Estrela, A.B.; Santos, E.C.; Machado, P.R.; Farias, K.J.; Torres, T.M.; Carvalho, E.; Lima, J.P.; Silva-Junior, A.A.; Barbosa, E.G.; et al. Structural characterization of a novel peptide with antimicrobial activity from the venom gland of the scorpion Tityus stigmurus: Stigmurin. Peptides 2015, 68, 3–10. [Google Scholar] [CrossRef]
- Parente, A.M.S.; Daniele-Silva, A.; Furtado, A.A.; Melo, M.A.; Lacerda, A.F.; Queiroz, M.; Moreno, C.; Santos, E.; Rocha, H.A.O.; Barbosa, E.G.; et al. Analogs of the scorpion venom peptide Stigmurin: Structural assessment, toxicity, and increased antimicrobial activity. Toxins 2018, 10, 161. [Google Scholar] [CrossRef] [PubMed]
- Amorim-Carmo, B.; Daniele-Silva, A.; Parente, A.M.S.; Furtado, A.A.; Carvalho, E.; Oliveira, J.W.F.; Santos, E.C.G.; Silva, M.S.; Silva, S.R.B.; Silva-Junior, A.A.; et al. Potent and broad-spectrum antimicrobial activity of analogs from the scorpion peptide Stigmurin. Int. J. Mol. Sci. 2019, 20, 623. [Google Scholar] [CrossRef] [PubMed]
- Zeng, X.C.; Zhou, L.; Shi, W.; Luo, X.; Zhang, L.; Nie, Y.; Wang, J.; Wu, S.; Cao, B.; Cao, H. Three new antimicrobial peptides from the scorpion Pandinus imperator. Peptides 2013, 45, 28–34. [Google Scholar] [CrossRef] [PubMed]
- Cao, L.; Li, Z.; Zhang, R.; Wu, Y.; Li, W.; Cao, Z. StCT2, a new antibacterial peptide characterized from the venom of the scorpion Scorpiops tibetanus. Peptides 2012, 36, 213–220. [Google Scholar] [CrossRef] [PubMed]
- Guo, X.; Ma, C.; Du, Q.; Wei, R.; Wang, L.; Zhou, M.; Chen, T.; Shaw, C. Two peptides, TsAP-1 and TsAP-2, from the venom of the Brazilian yellow scorpion, Tityus serrulatus: Evaluation of their antimicrobial and anticancer activities. Biochimie 2013, 95, 1784–1794. [Google Scholar] [CrossRef]
- Du, Q.; Hou, X.; Wang, L.; Zhang, Y.; Xi, X.; Wang, H.; Zhou, M.; Duan, J.; Wei, M.; Chen, T.; et al. AaeAP1 and AaeAP2: Novel antimicrobial peptides from the venom of the scorpion, Androctonus aeneas: Structural characterisation, molecular cloning of biosynthetic precursor-encoding cDNAs and engineering of analogues with enhanced antimicrobial and anticancer activities. Toxins 2015, 7, 219–237. [Google Scholar] [CrossRef]
- Liu, G.; Yang, F.; Li, F.; Li, Z.; Lang, Y.; Shen, B.; Wu, Y.; Li, W.; Harrison, P.L.; Strong, P.N.; et al. Therapeutic potential of a scorpion venom-derived antimicrobial peptide and its homologs against antibiotic-resistant Gram-positive bacteria. Front. Microbiol. 2018, 9, 1159–1173. [Google Scholar] [CrossRef]
- de la Salud Bea, R.; Petraglia, A.F.; Ascuitto, M.R.; Buck, Q.M. Antibacterial activity and toxicity of analogs of scorpion venom IsCT peptides. Antibiotics 2017, 6, 13. [Google Scholar] [CrossRef]
- Ramirez-Carreto, S.; Quintero-Hernandez, V.; Jimenez-Vargas, J.M.; Corzo, G.; Possani, L.D.; Becerril, B.; Ortiz, E. Gene cloning and functional characterization of four novel antimicrobial-like peptides from scorpions of the family Vaejovidae. Peptides 2012, 34, 290–295. [Google Scholar] [CrossRef]
- Pedron, C.N.; Torres, M.T.; Lima, J.; Silva, P.I.; Silva, F.D.; Oliveira, V.X. Novel designed VmCT1 analogs with increased antimicrobial activity. Eur. J. Med. Chem. 2017, 126, 456–463. [Google Scholar] [CrossRef]
- Luna-Ramirez, K.; Tonk, M.; Rahnamaeian, M.; Vilcinskas, A. Bioactivity of natural and engineered antimicrobial peptides from venom of the scorpions Urodacus yaschenkoi and U. manicatus. Toxins 2017, 9, 22. [Google Scholar] [CrossRef] [PubMed]
- Dai, C.; Ma, Y.; Zhao, Z.; Zhao, R.; Wang, Q.; Wu, Y.; Cao, Z.; Li, W. Mucroporin, the first cationic host defense peptide from the venom of Lychas mucronatus. Antimicrob. Agents Chemother. 2008, 52, 3967–3972. [Google Scholar] [CrossRef] [PubMed]
- Almaaytah, A.; Zhou, M.; Wang, L.; Chen, T.; Walker, B.; Shaw, C. Antimicrobial/cytolytic peptides from the venom of the North African scorpion, Androctonus amoreuxi: Biochemical and functional characterization of natural peptides and a single site-substituted analog. Peptides 2012, 35, 291–299. [Google Scholar] [CrossRef] [PubMed]
- Ramirez-Carreto, S.; Jimenez-Vargas, J.M.; Rivas-Santiago, B.; Corzo, G.; Possani, L.D.; Becerril, B.; Ortiz, E. Peptides from the scorpion Vaejovis punctatus with broad antimicrobial activity. Peptides 2015, 73, 51–59. [Google Scholar] [CrossRef] [PubMed]
- Park, J.; Oh, J.H.; Kang, H.K.; Choi, M.C.; Seo, C.H.; Park, Y. Scorpion-venom-derived antimicrobial peptide Css54 exerts potent antimicrobial activity by disrupting bacterial membrane of zoonotic bacteria. Antibiotics 2020, 9, 831. [Google Scholar] [CrossRef]
- Nie, Y.; Zeng, X.C.; Yang, Y.; Luo, F.; Luo, X.; Wu, S.; Zhang, L.; Zhou, J. A novel class of antimicrobial peptides from the scorpion Heterometrus spinifer. Peptides 2012, 38, 389–394. [Google Scholar] [CrossRef]
- Li, S.; Liu, G.; Kang, J.; Li, Z.; Cao, Z. The inhibitory activity of a new scorpion venom-derived antimicrobial peptide Hp1470 against Gram-positive bacteria. Toxicon 2023, 231, 107189. [Google Scholar] [CrossRef]
- Zhao, Z.; Ma, Y.; Dai, C.; Zhao, R.; Li, S.; Wu, Y.; Cao, Z.; Li, W. Imcroporin, a new cationic antimicrobial peptide from the venom of the scorpion Isometrus maculates. Antimicrob. Agents Chemother. 2009, 53, 3472–3477. [Google Scholar] [CrossRef]
- Cesa-Luna, C.; Munoz-Rojas, J.; Saab-Rincon, G.; Baez, A.; Morales-Garcia, Y.E.; Juarez-Gonzalez, V.R.; Quintero-Hernandez, V. Structural characterization of scorpion peptides and their bactericidal activity against clinical isolates of multidrug-resistant bacteria. PLoS ONE 2019, 14, e0222438. [Google Scholar] [CrossRef]
- Bao, A.; Zhong, J.; Zeng, X.C.; Nie, Y.; Zhang, L.; Peng, Z.F. A novel cysteine-free venom peptide with strong antimicrobial activity against antibiotics-resistant pathogens from the scorpion Opistophthalmus glabrifrons. J. Pept. Sci. 2015, 21, 758–764. [Google Scholar] [CrossRef]
- Fan, Z.; Cao, L.; He, Y.; Hu, J.; Di, Z.; Wu, Y.; Li, W.; Cao, Z. Ctriporin, a new anti-methicillin-resistant Staphylococcus aureus peptide from the venom of the scorpion Chaerilus tricostatus. Antimicrob. Agents Chemother. 2011, 55, 5220–5229. [Google Scholar] [CrossRef] [PubMed]
- Corzo, G.; Escoubas, P.; Villegas, E.; Barnham, K.J.; He, W.; Norton, R.S.; Nakajima, T. Characterization of unique amphipathic antimicrobial peptides from venom of the scorpion Pandinus imperator. Biochem. J. 2001, 359, 35–45. [Google Scholar] [CrossRef] [PubMed]
- Wu, S.; Nie, Y.; Zeng, X.C.; Cao, H.; Zhang, L.; Zhou, L.; Yang, Y.; Luo, X.; Liu, Y. Genomic and functional characterization of three new venom peptides from the scorpion Heterometrus spinifer. Peptides 2014, 53, 30–41. [Google Scholar] [CrossRef] [PubMed]
- Gao, B.; Dalziel, J.; Tanzi, S.; Zhu, S. Meucin-49, a multifunctional scorpion venom peptide with bactericidal synergy with neurotoxins. Amino Acids 2018, 50, 1025–1043. [Google Scholar] [CrossRef]
- Torres-Larios, A.; Gurrola, G.B.; Zamudio, F.Z.; Possani, L.D. Hadrurin, a new antimicrobial peptide from the venom of the scorpion Hadrurus aztecus. Eur. J. Biochem. 2000, 267, 5023–5031. [Google Scholar] [CrossRef]
- Hernandez-Aponte, C.A.; Silva-Sanchez, J.; Quintero-Hernandez, V.; Rodriguez-Romero, A.; Balderas, C.; Possani, L.D.; Gurrola, G.B. Vejovine, a new antibiotic from the scorpion venom of Vaejovis mexicanus. Toxicon 2011, 57, 84–92. [Google Scholar] [CrossRef]
- Zeng, X.C.; Wang, S.; Nie, Y.; Zhang, L.; Luo, X. Characterization of BmKbpp, a multifunctional peptide from the Chinese scorpion Mesobuthus martensii Karsch: Gaining insight into a new mechanism for the functional diversification of scorpion venom peptides. Peptides 2012, 33, 44–51. [Google Scholar] [CrossRef]
- Harrison, P.L.; Abdel-Rahman, M.A.; Strong, P.N.; Tawfik, M.M.; Miller, K. Characterisation of three alpha-helical antimicrobial peptides from the venom of Scorpio maurus palmatus. Toxicon 2016, 117, 30–36. [Google Scholar] [CrossRef]
- Remijsen, Q.; Verdonck, F.; Willems, J. Parabutoporin, a cationic amphipathic peptide from scorpion venom: Much more than an antibiotic. Toxicon 2010, 55, 180–185. [Google Scholar] [CrossRef]
- Moerman, L.; Bosteels, S.; Noppe, W.; Willems, J.; Clynen, E.; Schoofs, L.; Thevissen, K.; Tytgat, J.; Van Eldere, J.; Van Der Walt, J.; et al. Antibacterial and antifungal properties of alpha-helical, cationic peptides in the venom of scorpions from southern Africa. Eur. J. Biochem. 2002, 269, 4799–4810. [Google Scholar] [CrossRef]
- Juichi, H.; Ando, R.; Ishido, T.; Miyashita, M.; Nakagawa, Y.; Miyagawa, H. Chemical synthesis of a two-domain scorpion toxin LaIT2 and its single-domain analogs to elucidate structural factors important for insecticidal and antimicrobial activities. J. Pept. Sci. 2018, 24, e3133. [Google Scholar] [CrossRef] [PubMed]
- Conde, R.; Zamudio, F.Z.; Rodriguez, M.H.; Possani, L.D. Scorpine, an anti-malaria and anti-bacterial agent purified from scorpion venom. FEBS Lett. 2000, 471, 165–168. [Google Scholar] [CrossRef] [PubMed]
- Rawson, K.M.; Lacey, M.M.; Strong, P.N.; Miller, K. Improving the therapeutic index of Smp24, a venom-derived antimicrobial peptide: Increased activity against Gram-negative bacteria. Int. J. Mol. Sci. 2022, 23, 7979. [Google Scholar] [CrossRef] [PubMed]
- Meng, L.; Xie, Z.; Zhang, Q.; Li, Y.; Yang, F.; Chen, Z.; Li, W.; Cao, Z.; Wu, Y. Scorpion potassium channel-blocking defensin highlights a functional link with neurotoxin. J. Biol. Chem. 2016, 291, 7097–7106. [Google Scholar] [CrossRef] [PubMed]
- Juichi, H.; Miyashita, M.; Nakagawa, Y.; Miyagawa, H. Isolation and characterization of the insecticidal, two-domain toxin LaIT3 from the Liocheles australasiae scorpion venom. Biosci. Biotechnol. Biochem. 2019, 83, 2183–2189. [Google Scholar] [CrossRef] [PubMed]
- Diaz, P.; D’Suze, G.; Salazar, V.; Sevcik, C.; Shannon, J.D.; Sherman, N.E.; Fox, J.W. Antibacterial activity of six novel peptides from Tityus discrepans scorpion venom. A fluorescent probe study of microbial membrane Na+ permeability changes. Toxicon 2009, 54, 802–817. [Google Scholar] [CrossRef]
- Arendrup, M.C.; Patterson, T.F. Multidrug-resistant Candida: Epidemiology, molecular mechanisms, and treatment. J. Infect. Dis. 2017, 216 (Suppl. S3), S445–S451. [Google Scholar] [CrossRef]
- Zottich, U.; de Oliveira, I.S.; Fereira, I.G.; Cerni, F.A.; Karla de Castro Figueiredo, B.; Arantes, E.C.; Gomes, V.M.; Dias, G.B.; Pucca, M.B. Antifungal activity of Rhopalurus crassicauda venom against Candida spp. Toxicon X 2022, 14, 100120. [Google Scholar] [CrossRef]
- Loh, J.T.; Lam, K.P. Fungal infections: Immune defense, immunotherapies and vaccines. Adv. Drug Deliv. Rev. 2023, 196, 114775. [Google Scholar] [CrossRef]
- Pfaller, M.A.; Diekema, D.J. Epidemiology of invasive mycoses in North America. Crit. Rev. Microbiol. 2010, 36, 1–53. [Google Scholar] [CrossRef]
- Sun, F.J.; Li, M.; Gu, L.; Wang, M.L.; Yang, M.H. Recent progress on anti-Candida natural products. Chin. J. Nat. Med. 2021, 19, 561–579. [Google Scholar] [CrossRef]
- de Jesus Oliveira, T.; Oliveira, U.C.; da Silva Junior, P.I. Serrulin: A glycine-rich bioactive peptide from the hemolymph of the yellow Tityus serrulatus scorpion. Toxins 2019, 11, 517. [Google Scholar] [CrossRef] [PubMed]
- Machado, R.J.; Estrela, A.B.; Nascimento, A.K.; Melo, M.M.; Torres-Rego, M.; Lima, E.O.; Rocha, H.A.; Carvalho, E.; Silva-Junior, A.A.; Fernandes-Pedrosa, M.F. Characterization of TistH, a multifunctional peptide from the scorpion Tityus stigmurus: Structure, cytotoxicity and antimicrobial activity. Toxicon 2016, 119, 362–370. [Google Scholar] [CrossRef] [PubMed]
- Guilhelmelli, F.; Vilela, N.; Smidt, K.S.; de Oliveira, M.A.; da Cunha Morales Alvares, A.; Rigonatto, M.C.; da Silva Costa, P.H.; Tavares, A.H.; de Freitas, S.M.; Nicola, A.M.; et al. Activity of scorpion venom-derived antifungal peptides against planktonic cells of Candida spp. and Cryptococcus neoformans and Candida albicans biofilms. Front. Microbiol. 2016, 7, 1844–1858. [Google Scholar] [CrossRef] [PubMed]
- Song, C.; Wen, R.; Zhou, J.; Zeng, X.; Kou, Z.; Zhang, J.; Wang, T.; Chang, P.; Lv, Y.; Wu, R. Antibacterial and antifungal properties of a novel antimicrobial peptide GK-19 and its application in skin and soft tissue infections induced by MRSA or Candida albicans. Pharmaceutics 2022, 14, 1937. [Google Scholar] [CrossRef] [PubMed]
- Park, J.; Kim, H.; Kang, D.D.; Park, Y. Exploring the therapeutic potential of scorpion-derived Css54 peptide against Candida albicans. J. Microbiol. 2024, 62, 101–112. [Google Scholar] [CrossRef]
- Santussi, W.M.; Bordon, K.C.F.; Rodrigues Alves, A.P.N.; Cologna, C.T.; Said, S.; Arantes, E.C. Antifungal activity against filamentous fungi of Ts1, a multifunctional toxin from Tityus serrulatus scorpion venom. Front. Microbiol. 2017, 8, 984–999. [Google Scholar] [CrossRef]
- Cordeiro, F.A.; Amorim, F.G.; Boldrini-Franca, J.; Pinheiro-Junior, E.L.; Cardoso, I.A.; Zoccal, K.F.; Peigneur, S.; Faccioli, L.H.; Tytgat, J.; Arantes, E.C. Heterologous expression of Ts8, a neurotoxin from Tityus serrulatus venom, evidences its antifungal activity. Toxicon 2022, 218, 47–56. [Google Scholar] [CrossRef]
- Simner, P.J. Medical parasitology taxonomy update: January 2012 to December 2015. J. Clin. Microbiol. 2017, 55, 43–47. [Google Scholar] [CrossRef]
- Man, E.; Price, H.P.; Hoskins, C. Current and future strategies against cutaneous parasites. Pharm. Res. 2022, 39, 631–651. [Google Scholar] [CrossRef]
- Gao, B.; Xu, J.; Rodriguez Mdel, C.; Lanz-Mendoza, H.; Hernandez-Rivas, R.; Du, W.; Zhu, S. Characterization of two linear cationic antimalarial peptides in the scorpion Mesobuthus eupeus. Biochimie 2010, 92, 350–359. [Google Scholar] [CrossRef] [PubMed]
- Pedron, C.N.; Freire, K.A.; Torres, M.T.; Lima, D.B.; Monteiro, M.L.; Menezes, R.; Martins, A.M.C.; Oliveira, V.X. Arg-substituted VmCT1 analogs reveals promising candidate for the development of new antichagasic agent. Parasitology 2020, 147, 1810–1818. [Google Scholar] [CrossRef] [PubMed]
- Flores-Solis, D.; Toledano, Y.; Rodriguez-Lima, O.; Cano-Sanchez, P.; Ramirez-Cordero, B.E.; Landa, A.; Rodriguez de la Vega, R.C.; Del Rio-Portilla, F. Solution structure and antiparasitic activity of scorpine-like peptides from Hoffmannihadrurus gertschi. FEBS Lett. 2016, 590, 2286–2296. [Google Scholar] [CrossRef] [PubMed]
- Amorim-Carmo, B.; Parente, A.M.S.; Souza, E.S.; Silva-Junior, A.A.; Araujo, R.M.; Fernandes-Pedrosa, M.F. Antimicrobial peptide analogs from scorpions: Modifications and structure-activity. Front. Mol. Biosci. 2022, 9, 887763. [Google Scholar] [CrossRef] [PubMed]
- Teerapo, K.; Roytrakul, S.; Sistayanarain, A.; Kunthalert, D. A scorpion venom peptide derivative BmKn–22 with potent antibiofilm activity against Pseudomonas aeruginosa. PLoS ONE 2019, 14, e0218479. [Google Scholar] [CrossRef] [PubMed]
- Tawfik, M.M.; Bertelsen, M.; Abdel-Rahman, M.A.; Strong, P.N.; Miller, K. Scorpion venom antimicrobial peptides induce siderophore biosynthesis and oxidative stress responses in Escherichia coli. mSphere 2021, 6, e00267-21. [Google Scholar] [CrossRef] [PubMed]
- Yacoub, T.; Rima, M.; Karam, M.; Fajloun, J. Antimicrobials from venomous animals: An overview. Molecules 2020, 25, 2402. [Google Scholar] [CrossRef] [PubMed]
- Lang, Y.; Pi, X.; Di, Z.; Zhang, Q.; Wang, H.; Shen, B.; Li, F.; Liu, G.; Yu, Y.; Li, X.; et al. Molecular characterization and expression analysis of CSalphabeta defensin genes from the scorpion Mesobuthus martensii. Biosci. Rep. 2017, 37, BSR20171282. [Google Scholar] [CrossRef] [PubMed]
- Fong-Coronado, P.A.; Ramirez, V.; Quintero-Hernandez, V.; Balleza, D. A critical review of short antimicrobial peptides from scorpion venoms, their physicochemical attributes, and potential for the development of new drugs. J. Membr. Biol. 2024, 257, 165–205. [Google Scholar] [CrossRef]
- Han, S.; Yi, H.; Yin, S.J.; Chen, Z.Y.; Liu, H.; Cao, Z.J.; Wu, Y.L.; Li, W.X. Structural basis of a potent peptide inhibitor designed for Kv1.3 channel, a therapeutic target of autoimmune disease. J. Biol. Chem. 2008, 283, 19058–19065. [Google Scholar] [CrossRef]
- Ye, F.; Hu, Y.; Yu, W.; Xie, Z.; Hu, J.; Cao, Z.; Li, W.; Wu, Y. The scorpion toxin analogue BmKTX-D33H as a potential Kv1.3 channel-selective immunomodulator for autoimmune diseases. Toxins 2016, 8, 115. [Google Scholar] [CrossRef] [PubMed]
Scorpion Species | Peptides | Amino Acid Sequence and Length | * Hydrophobicity (kcal × mol−1) | * Molecular Weight (Da) | * pI | * Net Charge | Antimicrobial Activity | References |
---|---|---|---|---|---|---|---|---|
H. spinifer | Heterin-1 | GVWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS (43) | 38.71 | 4739.5 | 10.41 | +5 | Gram-positive and Gram-negative bacteria | [73] |
S. maurus palmatus | Smp43 | GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS (43) | 35.61 | 4651.5 | 10.43 | +4 | Gram-positive and Gram-negative bacteria | [78] |
P. schlechteri | parabutoporin | FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ (45) | 53.76 | 4991.8 | 10.51 | +7 | Gram-positive and Gram-negative bacteria | [79] |
M. eupeus | Meucin-49 | FKFGSFIKRMWRSKLAKKLRAKGKELLRDYANRVLSPEEEAAAPAPVPA (49) | 46.91 | 5570.1 | 10.96 | +7 | Gram-positive and Gram-negative bacteria | [74] |
H. aztecus | Hadrurin | GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA (41) | 31.56 | 4433.5 | 10.87 | +5 | Gram-negative bacteria | [75] |
P. imperator | Pandinin-1 | GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT (44) | 36.03 | 4796.6 | 10.28 | +4 | Gram-positive bacteria | [72] |
O. carinatus | Opistoporin 1 | GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS (44) | 41.05 | 4833.6 | 10.34 | +4 | Gram-negative bacteria | [80] |
V. mexicanus | Vejovine | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS (47) | 33.23 | 4869.5 | 10.73 | +4 | Gram-negative bacteria | [76] |
M. martensii | BmKbpp | FRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANKVLNGPEEEAAAPAE (47) | 51.91 | 5317.9 | 10.59 | +7 | Gram-negative bacteria | [77] |
Scorpion Species | Peptides | Peptide Length (S–S Bridge) | Sequence | Classification | Antimicrobial Activity | References |
---|---|---|---|---|---|---|
P. imperator | Scorpine | 75 (3) | GWINEEKIQKKIDERMGNTVLGGMAKAIVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY | KTx | Gram-positive and Gram-negative bacteria | [82] |
M. martensii | BmKDfsin4 | 37 (3) | GFGCPFNQGQCHKHCQSIRRRGGYCDGFLKTRCVCYR | KTx | Gram-negative bacteria | [84] |
L. australasiae | LaIT2 | 59 (3) | AKKPFVQRVKNAASKAYNKLKGLAMQSQYGCPIISNMCEDHCRRKKMEGQCDLLDCVCS | KTx | Gram-negative bacteria | [81] |
L. australasiae | LaIT3 | 84 (3) | GGILREKYFHKAADALTSNIPIPVVKDVLKSAANQMIRKIGKVQQACAFNKDLAGWCEKSCQEAEGKKGYCHGTKCKCGKPIDY | KTx | Gram-negative bacteria | [85] |
T. discrepans | Bactridines 1 | 61 (4) | KDGYIIEHRGCKYSCFFGTNSWCNTECTLKKGSSGYCAWPACWCYGLPDNVKIFDSNNLKC | NaTx | Gram-positive and Gram-negative bacteria | [86] |
T. discrepans | Bactridines 2 | 64 (4) | KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWNRATNRCGR | NaTx | Gram-positive and Gram-negative bacteria | [86] |
Scorpion Species | Peptides | Amino Acid Sequence and Length | * Hydrophobicity (kcal × mol−1) | * Molecular Weight (Da) | * pI | * Net Charge | Antimicrobial Activity | References |
---|---|---|---|---|---|---|---|---|
T. stigmurus | Stigmurin | FFSLIPSLVGGLISAFK (17) | 3.44 | 1795.0 | 9.80 | +1 | C. albicans, C. krusei, and C. glabrata | [50] |
T. stigmurus | StigA6 | FFSLIPKLVKGLISAFK (17) | 7.43 | 1907.1 | 10.86 | +3 | C. albicans, C. krusei, and C. glabrata | [51] |
T. stigmurus | StigA16 | FFKLIPKLVKGLISAFK (17) | 9.77 | 1948.2 | 11.03 | +4 | C. albicans, C. krusei, and C. glabrata | [51] |
T. stigmurus | StigA25 | FFSLIPSLVKKLIKAFK (17) | 9.08 | 1978.2 | 11.03 | +4 | C. albicans, C. krusei, and C. glabrata | [52] |
T. stigmurus | StigA31 | FFKLIPKLVKKLIKAFK (17) | 13.76 | 2060.3 | 11.25 | +6 | C. albicans, C. krusei, and C. glabrata | [52] |
T. obscurus | ToAP1 | FIGMIPGLIGGLISAFK (17) | 5.33 | 1732.9 | 9.80 | +1 | Candida spp. and C. neoformans | [94] |
T. obscurus | ToAP3 | FIGMIPGLIGGLISAIK (17) | 5.92 | 1699.0 | 9.80 | +1 | Candida spp. and C. neoformans | [94] |
A. amoreuxi | GK-19 | GFLFKLIPKAIKKLISKFK (19) | 14.71 | 2218.4 | 11.25 | +6 | C. albicans, C. krusei, and C. glabrata | [95] |
T. stigmurus | TistH | ADMDFTGIAESIIKKIKETNAKPPA (25) | 32.02 | 2687.4 | 7.07 | 0 | C. albicans, C. tropicalis, and A. flavus | [93] |
T. obscurus | ToAP2 | FFGTLFKLGSKLIPGVMKLFSKKKER (26) | 20.81 | 2998.7 | 11.22 | +6 | Candida spp. and C. neoformans | [94] |
O. cayaporum | Con10 | FWSFLVKAASKILPSLIGGGDDNKSSS (27) | 19.82 | 2823.5 | 9.59 | +1 | Candida spp. and C. neoformans | [94] |
P. imperator | Pantinin-2 | IFGAIWKGISSLL (13) | 4.76 | 1403.8 | 10.14 | +1 | C. tropicalis | [53] |
P. imperator | Pantinin-3 | FLSTIWNGIKSLL (13) | 4.08 | 1490.8 | 10.14 | +1 | C. tropicalis | [53] |
P. imperator | Pantinin-1 | GILGKLWEGFKSIV (14) | 12.04 | 1545.9 | 9.93 | +1 | C. tropicalis | [53] |
T. serrulatus | TsAP-2 | FLGMIPGLIGGLISAFK (17) | 5.20 | 1732.9 | 9.80 | +1 | C. albicans | [55] |
A. amoreuxi | AamAP1 | FLFSLIPHAIGGLISAFK (18) | 5.15 | 1930.1 | 9.80 | +1 | C. albicans | [63] |
A. amoreuxi | AamAP2 | FPFSLIPHAIGGLISAIK (18) | 7.13 | 1880.1 | 9.80 | +1 | C. albicans | [63] |
A. aeneas | AaeAP1 | FLFSLIPSVIAGLVSAIRN (19) | 2.78 | 2016.2 | 10.60 | +1 | C. albicans | [56] |
A. aeneas | AaeAP2 | FLFSLIPSAIAGLVSAIRN (19) | 3.74 | 1988.1 | 10.60 | +1 | C. albicans | [56] |
P. imperator | Pandinin-2 | FWGALAKGALKLIPSLFSSFSKKD (24) | 15.18 | 2610.4 | 10.62 | +3 | C. albicans | [72] |
C. suffuses | Css54 | FFGSLLSLGSKLLPSVFKLFQRKKE (25) | 14.79 | 2868.6 | 11.02 | +4 | C. albicans | [96] |
T. serrulatus | Serrulin | GFGGGRGGFGGGRGGFGGGGIGGGGFGGGYGGGKIKG (37) | 37.23 | 3046.5 | 11.57 | +4 | A. niger and C. albicans | [92] |
O. carinatus | Opistoporin 1 | GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS (44) | 41.05 | 4833.6 | 10.34 | +4 | N. crassa, B. cinerea, F. culmorum, and S. cervisiae | [80] |
P. schlechteri | parabutoporin | FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ (45) | 53.76 | 4991.8 | 10.51 | +7 | N. crassa, B. cinerea, F. culmorum, and S. cervisiae | [80] |
Scorpion Species | Peptides | Peptide Length (S–S Bridge) | Sequence | Classification | Antimicrobial Activity | References |
---|---|---|---|---|---|---|
T. serrulatus | Ts8 | 60 (3) | KLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNDHCNDIERKDGECHGFKCKCAKD | KTx | P. pastoris | [98] |
T. serrulatus | Ts1 | 61 (4) | KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC | NaTx | A. nidulans | [97] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Xia, Z.; Xie, L.; Li, B.; Lv, X.; Zhang, H.; Cao, Z. Antimicrobial Potential of Scorpion-Venom-Derived Peptides. Molecules 2024, 29, 5080. https://doi.org/10.3390/molecules29215080
Xia Z, Xie L, Li B, Lv X, Zhang H, Cao Z. Antimicrobial Potential of Scorpion-Venom-Derived Peptides. Molecules. 2024; 29(21):5080. https://doi.org/10.3390/molecules29215080
Chicago/Turabian StyleXia, Zhiqiang, Lixia Xie, Bing Li, Xiangyun Lv, Hongzhou Zhang, and Zhijian Cao. 2024. "Antimicrobial Potential of Scorpion-Venom-Derived Peptides" Molecules 29, no. 21: 5080. https://doi.org/10.3390/molecules29215080
APA StyleXia, Z., Xie, L., Li, B., Lv, X., Zhang, H., & Cao, Z. (2024). Antimicrobial Potential of Scorpion-Venom-Derived Peptides. Molecules, 29(21), 5080. https://doi.org/10.3390/molecules29215080