Next Article in Journal
Association between Hospital Prescribed Diets and Length of Stay, Re-Presentation, and Gastrointestinal Symptoms among Acute Uncomplicated Diverticulitis Patients: A Prospective Cohort Study
Previous Article in Journal
Improving Health through Sustainable and Healthy Urban Food System Policy in Nigeria
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Dietetics
Volume 3
Issue 1
10.3390/dietetics3010002
dietetics-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Profile Assessment of Bioactive Peptides in the Greek Traditional Cheese “Tsalafouti”

by
Ermioni Meleti
1,2,
Maria Alexandraki
2,
Antonia Samara
1,
Cecilia Loffi
3,
Tullia Tedeshi
3,
Gianni Galaverna
3,
Athanasios Manouras
4,
Michalis Koureas
5 and
Eleni Malissiova
2,*
1
PPS Biotechnology—Quality Assessment in Nutrition and the Environment, Biochemistry-Biotechnology Department, University of Thessaly, 41500 Larisa, Greece
2
Food of Animal Origin Laboratory, Animal Science Department, University of Thessaly, 41500 Larisa, Greece
3
Department of Food and Drug, University of Parma, 43121 Parma, Italy
4
Food Chemistry and Technology Laboratory, Nutrition and Dietetics Department, University of Thessaly, 42132 Trikala, Greece
5
Department of Hygiene and Epidemiology, Faculty of Medicine, University of Thessaly, 41500 Larisa, Greece
*
Author to whom correspondence should be addressed.
Dietetics 2024, 3(1), 16-29; https://doi.org/10.3390/dietetics3010002
Submission received: 27 November 2023 / Revised: 8 January 2024 / Accepted: 10 January 2024 / Published: 16 January 2024
Browse Figures
Versions Notes

Abstract

:
In the Greek regions of Agrafa and Tzoumerka, Tsalafouti, a traditional spreadable cheese made from goat’s and sheep’s milk is produced. This product has emerged in recent years as a result of the campaign to acquire Geographical Indication. This study aimed to assess the biopeptide profile of Tsalafouti cheese in order to highlight its nutritional value. Using HPLC-MS, bioactive peptides in Tsalafouti cheese samples were identified and classified according to their bioactivity. The biopeptides detected are known to present antibacterial, anti-diabetic, anti-hypertensive, anti-thrombotic, antioxidant, and immunomodulatory activities, while ACE enzyme and dipeptidyl-4 (DPP-IV) inhibitors were also identified. Based on these results, Tsalafouti cheese presents an interesting bioactive peptides profile that may act as special motivation for consumers to choose this specific cheese.

1. Introduction

Worldwide, the most popular fermented dairy product is cheese in all its variants. Cheese is one of the basic everyday food products, and in some cases is a product of high gastronomical and cultural value. In different regions of the world, people’s identity, history, culture, and way of life are reflected in their eating habits and the goods they produce. A set of factors such as soil, topography, climate, and flora directly contribute to the special characteristics of cheeses and express a valuable gastronomic heritage [1,2]. In Greece, different types of cheeses are traditionally produced, mostly with small ruminants’ milk. The vast majority of Greek cheeses are mainly made from sheep or goat’s milk (approximately 15 million small ruminants are reared in Greece) [3]. Different types of Greek cheeses have evolved into a very diverse range as a result of alterations in production methods over time. So far, 22 Greek cheeses have been granted a Protected Designation of Origin (PDO) indication, which helps in their protection and secures economic benefits for their producers [1,3]. Tsalafouti is a traditional Greek spreadable cheese made from ewe’s milk, or in some areas a mixture of ewe’s and goat’s milk, produced in the mountainous and semi-mountainous regions of Agrafa and Tzoumerka that are located in the Pindos mountain range in Greece. Its production relies heavily on the spontaneous milk fermentation by native microbiota, particularly lactic acid bacteria (LAB), and is historically manufactured using ewe’s milk throughout the summer (at the end of the lactation period) [4]. Tsalafouti is recently gaining more and more recognition from consumers, which makes research on the nutritional value of this traditional product greatly important. In our previous work, [5] we highlighted the cheese’s history, the cultural importance of the product, the cheesemaking technology, and the nutritional value of traditional Tsalafouti cheese. Based on the special attributes that Tsalafouti may hold, it is considered valuable to be further investigated in terms of its protein and peptides profile, fatty acids profile, and other possible important nutritional characteristics.
Fermented dairy products, and especially cheeses, are considered to be a food category rich in bioactive peptides [6,7]. The physiological activity of some peptides that positively affect human health have attracted the interest of researchers and food industries [8]. Biopeptides display a wide range of biological activity, including antimicrobial, antiviral, angiotensin-converting enzyme (ACE) inhibition, dipeptidyl peptidase IV (DPP-IV) inhibition, antihypertensive, opioid activities, immunomodulation, mineral binding, antioxidative functions, and cytomodulation [7,9]. Biopeptides are described as certain protein fragments that improve body functions or conditions and might have beneficial effects on health [10,11,12]. Although milk is regarded as a major source of biopeptides, with distinct nutritional and functional characteristics, biopeptides originate from an array of food proteins during gastrointestinal digestion and fermentation. Dairy products such as milk, cheese, and yoghurt have been widely studied in terms of their bioactivity due to the biopeptides that exist in these products [9,11,13,14,15,16]. According to Nielsen’s et al. [6] database research, most biopeptides are derived from these main milk proteins: 36% β-casein, 13% αs1-casein, 11% β-lactoglobulin, 10% κ-casein, 8% αs2-casein and 5% α-lactalbumin, while the secondary milk proteins lactoferrin constituted 15%, and less than 1% comes from other secondary proteins such as serum albumin.
However, most of the already known biological properties of peptides were demonstrated through in vitro digestion, which tends to hold poor translatability to physiological conditions in vivo [16]. This discrepancy is mainly due to the structural instability and the effective digestion of bioactive peptides in the gastrointestinal (GI) environment [16]. The functionality of bioactive peptides can be directly affected by various factors such as process conditions, protein sources, sequence and amino acid composition, molecular weight and charge distribution, pH, and certain chemical treatments [17].
The benefits that milk and cheese biopeptides offer to people’s health, as well as the increasing consumer demand for traditional products, played an important role in conducting this research. Additionally, the recent characterization of Tsalafouti cheese as a PDO product, can offer Tsalafouti the recognition it deserves from consumers. All of this may empower the added commercial value of Tsalafouti cheese, which is likely to be a great advantage for the producers, as well as the societies of the marginal regions where it is produced.
The aim of this study was to identify the profile of biopeptides in traditional Tsalafouti cheese and highlight this unique product as one of high nutritional value, which can benefit the consumer’s health through valuable bioactivity.

2. Materials and Methods

2.1. Sampling

Twelve samples were obtained from eight of the thirteen Tsalafouti manufacturers in Greece and were freeze-stored at −20 °C. Water-soluble extracts were prepared according to the method used by Gomez-Ruiz, Ramos, and Recio [18] with some modification. For the samples’ preparation, cheese was weighted (5 g) and centrifuged (4000 rpm, 25 min, at 20 °C). Following centrifugation, the supernatant was filtered through paper after the fat layer on top was removed and then filtered through a 0.45 µm syringe filter. It was then transferred into vials and stored under refrigeration until the analysis was conducted.

2.2. Biopeptide Separation

In order to analyze the water-soluble extracts, an Agilent 6130 single Quadrupole LC/MS spectrometer (Agilent Technologies, Inc., Santa Clara, CA, USA) was used, equipped with Agilent 1200 HPLC, consisting of an automatic sampler, a degasser, a binary pump, a column oven, and a DAD (Diode Array Detector) performed at 230 nm. The following were the ESI’s (Electrospray ionization) working conditions: the capillary voltage was 3200 V, the gas flow was 10 L/min, the temperature was 300 °C, and the nebulizer pressure was set at 50 Psi. Positive electrospray ionization was used for the analysis. Chromatographic separation was accomplished (Phase Analytical Technology, LLC, State College, PA, USA), using an ACMETM C18 column (4.6 mm × 250 mm, 5.0 μm). A total of 5 μL of the sample was injected into the HPLC system and the LC-MS system after the samples were filtered using a 0.45 μm membrane filter. The two eluent solutions used were A: TFA (Trifluoroacetic acid, HPLC grade, Chem-Lab NV) in ultrapure water (0.1% v/v) and B: 0.09% v/v TFA in Acetonitrile (Reag. Ph. Eur.) for UHPLC Supergradient, ACS, PanReac AppliChem ITW Reagents) and ultrapure water in a ratio of 90:10. For ultrapure water, Human Corporation’s New P. Nix Power I was used.
The total duration of the method was 60 min, and the gradient elution profile was as follows: 100% eluent A for 10 min, from 10th to 20th min 75% eluent A and 25% eluent B, for the next 10 min 50% A and 50% eluent B, and vice versa for the next 30 min up to 100% eluent B. With the aid of qualitative analysis software, mass data were automatically collected. A full scan ion mode was used to record the mass spectra (100–2000 m/z).

2.3. Biopeptide Identification

The resulting peptide sequences’ functional characteristics were identified using online databases like BIOPEP, milk Bioactive Peptide Database, EROP-Moscow, and BioDADPep, that are available online at: https://biochemia.uwm.edu.pl/biopep-uwm/ (accessed on 20 May 2022) [19], http://mbpdb.nws.oregonstate.edu (20 May 2022), http://erop.inbi.ras.ru (accessed on 20 May 2022), and http://omicsbase.com/BioDADPep/biodadpep-search/ (accessed on 20 May 2022), respectively.
The milk protein sequences that were used came from the UniProt Knowledgebase (UniProtKB) (https://www.uniprot.org (accessed on 20 May 2022)), including αs1-casein (UniProtKB—P04653, P18626), αs2-casein (UniProtKB—P04654, P33049), β-casein (UniProtKB—P11839, P33048), k-casein (UniProtKB—P02669, P02670), β-lactoglobulin (UniProtKB—P67976, P02756), and α-lactalbumin (UniProtKB—P09462, P00712). The mass of the mature proteins was obtained by subtracting the signal peptides from the total mass of the pre-proteins. The Expasy peptide mass calculator (https://web.expasy.org/peptide_mass/ (accessed on 20 May 2022)) was used to calculate the mass of the signal peptide.

2.4. Biopeptide Characterization pre and after In Silico Digestion

The possible bioactivity of the peptides identified was further determined, and in order to evaluate the end effect of the biopeptides following digestion by humans, simulated gastro-pancreatic digestion was used to assess the effect of in silico digestion on the biopeptides identified in Tsalafouti. The ExPASY Peptide Cutter application (http://web.expasy.org/peptide_cutter/ (accessed on 15 June 2022)) was used to simulate gastro-pancreatic digestion for the detected peptides. Specifically, the generated protein fragments were put through simulated digestion with pepsin, trypsin, and chymotrypsin under the assumption that 100% of cleavage probability occurred at each possible location. Again, based on the assumption that there is a 100% chance of cleavage at each probable site, we were able to compile a list of short peptides that are produced following protein digestion and are resistant to the major gastrointestinal proteases. Then, utilizing the BIOPEP (https://biochemia.uwm.edu.pl/biopep-uwm/ (accessed on 20 June 2022)) database, the lists of peptides were checked for the presence of any new or similar bioactive peptides.
Additionally, we used the PeptideRanker (http://distilldeep.ucd.ie/PeptideRanker/ (accessed on 20 December 2023)) [20], a server for the prediction of bioactive peptides based on a novel N-to-1 neural network. A list of small chain (2–5 amino acids) biopeptides was submitted to the PeptideRanker in order to evaluate the probability that these peptides will be bioactive. This evaluation focused on small-chain peptides because according to multiple bibliographic references, peptides resistant to in vitro GI digestion have a shorter chain length and a smaller molecular weight [16,21,22].

3. Results

By identifying the peptides in Tsalafouti cheese, describing their bioactivity, and projecting the outcome of these peptides after in silico digestion, this study evaluated the peptide profile of Tsalafouti cheese. In the Supplementary Materials section, the HPLC chromatograms of all twelve samples, where peaks relate to specific retention times of peptide fragments for the entire duration of the established method, are presented.
Peptides and their fragments were detected in the analyzed cheese samples. The identified peptides or peptide fragments were reviewed for their potential biological activity at MBPDB, BIOPEP-UWM, and BioDADPep applications. Also, the peptides found in cheese samples were checked for their bioactivity in literature sources. Table 1 presents the biopeptides identified in Tsalafouti cheese samples and correlates them to their known bioactivity.
In the twelve Tsalafouti cheese samples analyzed, a total of 39 different biopeptides were detected. Out of these 39 biopeptides, 12 were inhibitors of the ACE enzyme (ACE-inhibitory), 7 were inhibitors of dipeptidyl peptidase-4 (DPP-IV-inhibitory), 10 of them were related to antimicrobial/antibacterial activity, 4 to antidiabetic activity and 2 were antithrombotic, while 3 were related to multiple biological activities (ACE-inhibitory, Antidiabetic, Antioxidant, Opioid, etc.), and finally, 1 of them belonged to the category of immunomodulatory biopeptides. The largest percentages of biopeptides detected were inhibitors of the ACE enzyme (30.7%) and biopeptides with antimicrobial activity (25.5%), (Figure 1).
Also, the analysis results indicate that the vast majority of the biopeptides are casein-originated as 79% of the biopeptides found in Tsalafouti cheese come from caseins (28% β-CN, 23% κ-CN, 18% αs1-CN, 10% αs2-CN) and only a relatively small percentage of 21% originate from serum proteins like α-lactalbumin (5%) and β-lactoglobulin (16%) (Figure 2).
Nevertheless, in this study an in-silico digestion tool was used for the identification of the changes in existing biopeptides. The results showed that some bioactive sequences have not been affected/cut from the digestion process and some others showed new released biopeptides (Table 2).
Finally, after the simulated digestion of the bioactive peptides, the PeptideRanker tool [20] was used in order to rank the bioactivity of small-chain biopeptides, found pre or post the simulated digestion (Table 3). Small-chain peptides were ranked based on a N-to-1 neural network in the PeptideRanker (https://distilldeep.ucd.ie/PeptideRanker/ (accessed on 20 December 2023)) and a threshold of small-chain peptides higher than 0.5 can be deemed as bioactive.

4. Discussion

Based on the abovementioned results, Tsalafouti cheese contains peptides that may possess a variety of biological activities and offer benefits to human health in various ways. The biopeptides contained in Tsalafouti cheese reveal the inhibitory action of the ACE enzyme (ACE-inhibitory) and of dipeptidyl peptidase-4 (DPP-IV-inhibitory), while other biopeptides are related to antimicrobial/antibacterial, antidiabetic, immunomodulatory, and antithrombotic activity. However, there were peptides present in the cheese samples that displayed multiple biological activities (ACE-inhibitory, antidiabetic, antioxidant, opioid, etc.).
Several types of sheep or goat’s milk cheeses have been analyzed for their biopeptide content [3,14,27,50], however spreadable cheeses such as Tsalafouti, or similar cheeses such as Katiki and Galotiri (traditional Greek PDO cheeses), have not been studied before in relation to their biopeptide profile.
The existence of antimicrobial biopeptides in sheep and goat’s milk cheeses is also recorded by Tomazou et al. [50] for feta cheese, where they identified 63 and 64 antimicrobial peptides from sheep and goat’s milk, respectively, used for feta’s preparation, however there is no data available for the biopeptides’ fate after the digestion process.
From the results, it is also evident that the great majority of biopeptides originate from caseins (β-Casein, κ-Casein, αS1-Casein, αS2-Casein), while the percentage of biopeptides that originate from basic serum proteins (β-lactoglobulin, α-lactalbumin) is significantly smaller, as seen in Figure 2. This is constantly in line with the outcomes of the research by Nielsen et al. [9] mentioned earlier in the introduction. Furthermore, this confirms that sheep and goat’s milk were discovered to be abundant in bioactive peptides mainly derived from α-, β- and κ-caseins [13]. Additionally, investigating the relationship between proteolysis of cheeses made from raw and pasteurized sheep’s milk and bioactivity, Pisanu et al. [14] detected 187 biopeptides derived from αs1-casein, β-casein, and αs2-casein. Nine of the detected peptides exhibited strong antioxidant activity and were proteolysis products of β-casein, and more specifically originated from the f207–221 fragment (QEPVLGPVRGPFPIL). We also detected smaller fragments from the above fragment in Tsalafouti cheese samples.
It is noteworthy that the same biopeptides appeared in several of the cheese samples (Figure 3), which may result from the local breeds of animals, from the feeding of the animals, as well as the similar production methods followed for Tsalafouti cheese. There are peptides that appear in the majority of samples, such as NPWDQVKR, KDQDK, LKGYGGVSLPE, which show antidiabetic activity, antithrombotic activity and inhibitory activity against dipeptidyl peptidase 4, respectively.
The presence of biopeptides in food in general does not assure the consequential health effects, as the digestion process may alter the peptides’ sequence. In order to acquire a better awareness of the possible fate of Tsalafouti cheese’s biopeptides, ideally in vitro or in vivo gastrointestinal digestion would be an asset. In that sense, supplementary quantitative studies are required to validate that these biopeptides exist in ample quantities to have their biological effect after digestion.
More specifically, the following sequences TAQVTSTEV, SDIPNPIGSE, TGPIPN, ASAEPTVH, SDIPNPIGSENSEK, and TGPIPN have not been affected by the digestive enzymes. New bioactive peptides were released via simulated digestion as shown in Table 2. The bioactive peptides found in Tsalafouti were of various amino acid chain sizes, from dipeptides (LF) and tripeptides (PPK, LLF, YPY) after simulated digestion to much bigger chain peptides such as VDQHQKAMKPWTQPKTNAIPYVRYL. SCPs (short-chain peptides) have been demonstrated as health-promoting substances that can be directly absorbed by the human organism, therefore the abundance of endogenous SCPs in foods can reflect their nutritional value [51]. Short peptides show a more remarkable resemblance to polar metabolites than longer peptides for their low molecular weights and wide range of physicochemical properties (acid–base properties and polarity) [52]. Pepsin, pancreatic trypsin, elastase, chymotrypsin, carboxypeptidase, and brush border peptidases are among the digestive proteases and peptidases found in the digestive tract [53], which would inevitably result in the generation of massive amounts of small-chain peptides during macromolecular protein digestion, moreover, these SCPs with multiple bioactivities have a higher likelihood of surviving these digestive enzymatic actions and permeating intestinal epithelial cells [54]. Most peptides of more than three amino acids are extracellularly hydrolyzed by enzymes in the brush border membrane of the intestinal epithelium [22]. In their study, Du and Jia [54] identified that goat’s milk bioactive SCPs, after in vitro digestion, have a very high chance of exerting their biological activity in vivo due to their low molecular weight and fewer protease recognition and cleavage sites.
Di- and tripeptides, in contrast, can be absorbed intact and hydrolyzed later [22]. However, this is not always the rule, as the biopeptide KFAWPQ, found in the Tsalafouti sample, according to the review of Ahmed, Sun and Udenigwe [16], seems to be one of the stable peptides after in vitro gastrointestinal digestion. In addition, for the confirmation of the obtained results, in vitro and in vivo studies should be carried out.
Possible limitations of the present study might be the representativeness. Nevertheless, as 8 out of the 13 factories producing Tsalafouti cheese participated in this study, we believe that this result can act as a steppingstone for future research, giving some indications and trends of its bioactivity profile. A national registry of establishments producing specific types of cheeses would be helpful to map the current number of Tsalafouti cheese producers. Another point for consideration might be the method selected to evaluate the peptide profile of Tsalafouti cheese. Tomazou et al. [50] used 1-D nano LC-MS/MS to identify the proteome in feta cheese, while Pappa et al. [55], used 2-dimensional electrophoresis and MALDI/TOF-MS for the separation of proteins and peptides, and liquid chromatography for separation. The authors also used Edman degradation for amino acid sequence identification, where peptides were identified based on the most abundant amino acid released after each degradation cycle, and identified by MS. It would be interesting to cross-check the peptide profile in Tsalafouti and other cheeses, with different analytical approaches in order to identify possible assets that could be exploited to increase the accuracy of the final results.

5. Conclusions

In this attempt to characterize the bioactive profile of Tsalafouti cheese, it was found that Tsalafouti possesses biopeptides with antimicrobial/antibacterial activity, as well as antidiabetic, antithrombotic, and antihypertensive biopeptides. Moreover, in the sampled Tsalafouti, biopeptides with antioxidant and immunomodulatory activity were identified, as well as biopeptides that inhibit the angiotensin-converting enzyme I (ACE, angiotensin converting enzyme, EC 3.4.15.1) and dipeptidyl peptidase-4 (DPP-IV) inhibitors. Based on an in-silico digestion approach, their bioactivity seems to be maintained. The bioactivity of the peptides contained in Tsalafouti, and the quantitative determination of proteins and peptides, should be further evidenced in order to empower its nutritional value.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/dietetics3010002/s1, supplementary figures present the chromatograms of the analysis for the peptide identification in the Tsalafouti cheese’s samples.

Author Contributions

Conceptualization, E.M. (Eleni Malissiova); methodology, T.T., G.G. and C.L.; validation, M.A. and A.M.; formal analysis, E.M. (Ermioni Meleti) and A.S.; data curation, A.M., M.A., E.M. (Ermioni Meleti) and M.K.; writing—original draft preparation, E.M. (Ermioni Meleti), A.S., M.A., T.T. and C.L.; writing—review and editing, E.M. (Eleni Malissiova), G.G., T.T. and A.M.; visualization, E.M. (Ermioni Meleti) and M.A.; supervision, E.M. (Eleni Malissiova). All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data are contained within the article and Supplementary Materials.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Fontenele, M.A.; do SRBastos, M.; Dos Santos, K.M.; Bemquerer, M.P.; do Egito, A.S. Peptide profile of Coalho cheese: A contribution for Protected Designation of Origin (PDO). Food Chem. 2017, 219, 382–390. [Google Scholar] [CrossRef]
  2. Roberts, T.A.; Cordier, J.L.; Gram, L.; Tompkin, R.B.; Pitt, J.I.; Gorris, L.G.M.; Swanson, K.M.J. Cereals and cereal products. In Micro-Organisms in Foods 6: Microbial Ecology of Food Commodities; Springer: Boston, MA, USA, 2005; pp. 392–439. [Google Scholar]
  3. Michailidou, S.; Pavlou, E.; Pasentsis, K.; Rhoades, J.; Likotrafiti, E.; Argiriou, A. Microbial profiles of Greek PDO cheeses assessed with amplicon metabarcoding. Food Microbiol. 2021, 99, 103836. [Google Scholar] [CrossRef]
  4. Pappa, E.C.; Kondyli, E.; Vlachou, A.M.; Kakouri, A.; Malamou, E.; Samelis, J. Semi industrial production of Tsalafouti dairy product. AIMS Agric. Food 2022, 7, 444–460. [Google Scholar] [CrossRef]
  5. Malissiova, E.; Meleti, E.; Samara, A.; Alexandraki, M.; Manouras, A. The traditional Greek cheese Tsalafouti: History, technology, nutrition and gastronomy. J. Ethn. Food 2023, 10, 18. [Google Scholar] [CrossRef]
  6. Rizzello, C.G.; Losito, I.; Gobbetti, M.; Carbonara, T.; De Bari, M.D.; Zambonin, P. Antibacterial activities of peptides from the water-soluble extracts of Italian cheese varieties. J. Dairy Sci. 2005, 88, 2348–2360. [Google Scholar] [CrossRef]
  7. Kamau, S.M.; Cheison, S.C.; Chen, W.; Liu, X.M.; Lu, R.R. Alpha-lactalbumin: Its production technologies and bioactive peptides. Compr. Rev. Food Sci. Food Saf. 2010, 9, 197–212. [Google Scholar] [CrossRef]
  8. Tidona, F.; Criscione, A.; Guastella, A.M.; Zuccaro, A.; Bordonaro, S.; Marletta, D. Bioactive peptides in dairy products. Ital. J. Anim. Sci. 2009, 8, 315–340. [Google Scholar] [CrossRef]
  9. Nielsen, S.D.; Beverly, R.L.; Qu, Y.; Dallas, D.C. Milk bioactive peptide database: A comprehensive database of milk protein-derived bioactive peptides and novel visualization. Food Chem. 2017, 232, 673–682. [Google Scholar] [CrossRef]
  10. Chakrabarti, S.; Guha, S.; Majumder, K. Food-Derived Bioactive Peptides in Human Health: Challenges and Opportunities. Nutrients 2018, 10, 1738. [Google Scholar] [CrossRef]
  11. Haque, E.; Chand, R.; Kapila, S. Biofunctional properties of bioactive peptides of milk origin. Food Rev. Int. 2009, 25, 28–43. [Google Scholar] [CrossRef]
  12. Haque, E.; Chand, R. Antihypertensive and antimicrobial bioactive peptides from milk proteins. Eur. Food Res. Technol. 2008, 227, 7–15. [Google Scholar] [CrossRef]
  13. Atanasova, J.; Ivanova, I. Antibacterial peptides from goat and sheep milk proteins. Biotechnol. Biotechnol. Equip. 2010, 24, 1799–1803. [Google Scholar] [CrossRef]
  14. Pisanu, S.; Pagnozzi, D.; Pes, M.; Pirisi, A.; Roggio, T.; Uzzau, S.; Addis, M.F. Differences in the peptide profile of raw and pasteurised ovine milk cheese and implications for its bioactive potential. Int. Dairy J. 2015, 42, 26–33. [Google Scholar] [CrossRef]
  15. Recio, I.; Visser, S. Antibacterial and binding characteristics of bovine, ovine and caprine lactoferrins: A comparative study. Int. Dairy J. 2000, 10, 597–605. [Google Scholar] [CrossRef]
  16. Ahmed, T.; Sun, X.; Udenigwe, C.C. Role of structural properties of bioactive peptides in their stability during simulated gastrointestinal digestion: A systematic review. Trends Food Sci. Technol. 2022, 120, 265–273. [Google Scholar] [CrossRef]
  17. de Castro, R.J.S.; Sato, H.H. A response surface approach on optimization of hydrolysis parameters for the production of egg white protein hydrolysates with antioxidant activities. Biocatal. Agric. Biotechnol. 2015, 4, 55–62. [Google Scholar] [CrossRef]
  18. Gomez-Ruiz, J.A.; Ramos, M.; Recio, I. Angiotensin-converting enzyme inhibitory peptides in Manchego cheeses manufactured with different starter cultures. Int. Dairy J. 2002, 12, 697–706. [Google Scholar] [CrossRef]
  19. Minkiewicz, P.; Iwaniak, A.; Darewicz, M. BIOPEP-UWM database of bioactive peptides: Current opportunities. Int. J. Mol. Sci. 2019, 20, 5978. [Google Scholar] [CrossRef]
  20. Mooney, C.; Haslam, N.J.; Pollastri, G.; Shields, D.C. Towards the Improved Discovery and Design of Functional Peptides: Common Features of Diverse Classes Permit Generalized Prediction of Bioactivity. PLoS ONE 2012, 7, e45012. [Google Scholar] [CrossRef]
  21. Segura-Campos, M.; Chel-Guerrero, L.; Betancur-Ancona, D.; Hernandez-Escalante, V.M. Bioavailability of Bioactive Peptides. Food Rev. Int. 2011, 27, 213–226. [Google Scholar] [CrossRef]
  22. Karami, Z.; Akbari-Adergani, B. Bioactive food derived peptides: A review on correlation between structure of bioactive peptides and their functional properties. J. Food Sci. Technol. 2019, 56, 535–547. [Google Scholar] [CrossRef]
  23. Zhang, Y.; Chen, R.; Ma, H.; Chen, S. Isolation and identification of dipeptidyl peptidase IV-inhibitory peptides from trypsin/chymotrypsin-treated goat milk casein hydrolysates by 2D-TLC and LC–MS/MS. J. Agric. Food Chem. 2015, 63, 8819–8828. [Google Scholar] [CrossRef] [PubMed]
  24. Gong, H.; Gao, J.; Wang, Y.; Luo, Q.; Guo, K.; Ren, F.; Mao, X. Identification of novel peptides from goat milk casein that ameliorate high-glucose-induced insulin resistance in HepG2 cells. J. Dairy Sci. 2020, 103, 4907–4918. [Google Scholar] [CrossRef] [PubMed]
  25. Wang, Z.-L.; Zhang, S.-S.; Wang, W.; Feng, F.-Q.; Shan, W.-G. A Novel Angiotensin I Converting Enzyme Inhibitory Peptide from the Milk Casein: Virtual Screening and Docking Studies. Agric. Sci. China 2011, 10, 463–467. [Google Scholar] [CrossRef]
  26. Qian, Z.-Y.; Jollès, P.; Migliore-Samour, D.; Fiat, A.-M. Isolation and characterization of sheep lactoferrin, an inhibitor of platelet aggregation and comparison with human lactoferrin. Biochim. Et Biophys. Acta (BBA)—Gen. Subj. 1995, 1243, 25–32. [Google Scholar] [CrossRef]
  27. Gómez-Ruiz, J.; Ramos, M.; Recio, I. Identification and formation of angiotensin-converting enzyme-inhibitory peptides in Manchego cheese by high-performance liquid chromatography–tandem mass spectrometry. J. Chromatogr. A 2004, 1054, 269–277. [Google Scholar] [CrossRef]
  28. Quirós, A.; Hernández-Ledesma, B.; Ramos, M.; Amigo, L.; Recio, I. Angiotensin-Converting Enzyme Inhibitory Activity of Peptides Derived from Caprine Kefir. J. Dairy Sci. 2005, 88, 3480–3487. [Google Scholar] [CrossRef]
  29. Lacroix, I.M.; Meng, G.; Cheung, I.W.; Li-Chan, E.C. Do whey protein derived peptides have dual dipeptidyl-peptidase IV and angiotensin I-converting enzyme inhibitory activities? J. Funct. Foods 2016, 21, 87–96. [Google Scholar] [CrossRef]
  30. Hayes, M.; Stanton, C.; Fitzgerald, G.F.; Ross, R.P. Putting microbes to work: Dairy fermentation, cell factories and bioactive peptides. Part II: Bioactive peptide functions. Biotechnol. J. 2007, 2, 435–449. [Google Scholar] [CrossRef]
  31. Lopez-Exposito, I.; Gomez-Ruiz, J.A.; Amigo, L.; Recio, I. Identification of antibacterial peptides from ovine alpha s2-casein. Int. Dairy J. 2006, 16, 1072–1080. [Google Scholar] [CrossRef]
  32. Miguel, M.; Gómez-Ruiz, J.Á.; Recio, I.; Aleixandre, A. Changes in arterial blood pressure after single oral administration of milk-casein-derived peptides in spontaneously hypertensive rats. Mol. Nutr. Food Res. 2010, 54, 1422–1427. [Google Scholar] [CrossRef] [PubMed]
  33. Nongonierma, A.B.; Mooney, C.; Shields, D.C.; FitzGerald, R.J. In silico approaches to predict the potential of milk protein-derived peptides as dipeptidyl peptidase IV (DPP-IV) inhibitors. Peptides 2014, 57, 43–51. [Google Scholar] [CrossRef]
  34. Nongonierma, A.B.; Mazzocchi, C.; Paolella, S.; FitzGerald, R.J. Release of dipeptidyl peptidase IV (DPP-IV) inhibitory peptides from milk protein isolate (MPI) during enzymatic hydrolysis. Food Res. Int. 2017, 94, 79–89. [Google Scholar] [CrossRef] [PubMed]
  35. Almaas, H.; Eriksen, E.; Sekse, C.; Comi, I.; Flengsrud, R.; Holm, H.; Jensen, E.; Jacobsen, M.; Langsrud, T.; Vegarud, G.E. Antibacterial peptides derived from caprine whey proteins, by digestion with human gastrointestinal juice. Br. J. Nutr. 2011, 106, 896–905. [Google Scholar] [CrossRef]
  36. Geerlings, A.; Villar, I.C.; Zarco, F.H.; Sánchez, M.; Vera, R.; Gomez, A.Z.; Boza, J.; Duarte, J. Identification and characterization of novel angiotensin-converting enzyme inhibitors obtained from goat milk. J. Dairy Sci. 2006, 89, 3326–3335. [Google Scholar] [CrossRef]
  37. Nongonierma, A.B.; Mooney, C.; Shields, D.C.; FitzGerald, R.J. Inhibition of dipeptidyl peptidase IV and xanthine oxidase by amino acids and dipeptides. Food Chem. 2013, 141, 644–653. [Google Scholar] [CrossRef] [PubMed]
  38. Hernández-Ledesma, B.; Recio, I.; Ramos, M.; Amigo, L. Preparation of ovine and caprine β-lactoglobulin hydrolysates with ACE-inhibitory activity. Identification of active peptides from caprine β-lactoglobulin hydrolysed with thermolysin. Int. Dairy J. 2002, 12, 805–812. [Google Scholar] [CrossRef]
  39. Chobert, J.M.; El-Zahar, K.; Sitohy, M.; Dalgalarrondo, M.; Métro, F.; Choiset, Y.; Haertlé, T. Angiotensin I-converting-enzyme (ACE)-inhibitory activity of tryptic peptides of ovine β-lactoglobulin and of milk yoghurts obtained by using different starters. Le Lait 2005, 85, 141–152. [Google Scholar] [CrossRef]
  40. Silveira, S.T.; Martínez-Maqueda, D.; Recio, I.; Hernández-Ledesma, B. Dipeptidyl peptidase-IV inhibitory peptides generated by tryptic hydrolysis of a whey protein concentrate rich in β-lactoglobulin. Food Chem. 2013, 141, 1072–1077. [Google Scholar] [CrossRef] [PubMed]
  41. Tavares, T.; Contreras, M.d.M.; Amorim, M.; Pintado, M.; Recio, I.; Malcata, F.X. Novel whey-derived peptides with inhibitory effect against angiotensin-converting enzyme: In vitro effect and stability to gastrointestinal enzymes. Peptides 2011, 32, 1013–1019. [Google Scholar] [CrossRef] [PubMed]
  42. Maruyama, S.; Ohmori, T.; Nakagami, T. Prolylendopeptidase Inhibitory Activity of a Glial Fibrillary Acidic Protein Fragment and Other Proline-rich Peptides. Biosci. Biotechnol. Biochem. 1996, 60, 358–359. [Google Scholar] [CrossRef]
  43. Lan, V.T.T.; Ito, K.; Ohno, M.; Motoyama, T.; Ito, S.; Kawarasaki, Y. Analyzing a dipeptide library to identify human dipeptidyl peptidase IV inhibitor. Food Chem. 2015, 175, 66–73. [Google Scholar] [CrossRef] [PubMed]
  44. Amigo, L.; Martínez-Maqueda, D.; Hernández-Ledesma, B. In Silico and In Vitro Analysis of Multifunctionality of Animal Food-Derived Peptides. Foods 2020, 9, 991. [Google Scholar] [CrossRef]
  45. Pihlanto-Leppälä, A.; Koskinen, P.; Piilola, K.; Tupasela, T.; Korhonen, H. Angiotensin I-converting enzyme inhibitory properties of whey protein digests: Concentration and characterization of active peptides. J. Dairy Res. 2000, 67, 53–64. [Google Scholar] [CrossRef] [PubMed]
  46. Donkor, O.; Henriksson, A.; Singh, T.; Vasiljevic, T.; Shah, N. ACE-inhibitory activity of probiotic yoghurt. Int. Dairy J. 2007, 17, 1321–1331. [Google Scholar] [CrossRef]
  47. Mullally, M.M.; Meisel, H.; FitzGerald, R.J. Identification of a novel angiotensin-I-converting enzyme inhibitory peptide corresponding to a tryptic fragment of bovine β-lactoglobulin. FEBS Lett. 1997, 402, 99–101. [Google Scholar] [CrossRef] [PubMed]
  48. van Platerink, C.J.; Janssen, H.-G.M.; Haverkamp, J. Application of at-line two-dimensional liquid chromatography–mass spectrometry for identification of small hydrophilic angiotensin I-inhibiting peptides in milk hydrolysates. Anal. Bioanal. Chem. 2008, 391, 299–307. [Google Scholar] [CrossRef] [PubMed]
  49. Meisel, H. Overview on Milk Protein-derived Peptides. Int. Dairy J. 1998, 8, 363–373. [Google Scholar] [CrossRef]
  50. Tomazou, M.; Oulas, A.; Anagnostopoulos, A.K.; Tsangaris, G.T.; Spyrou, G.M. In Silico Identification of Antimicrobial Peptides in the Proteomes of Goat and Sheep Milk and Feta Cheese. Proteomes 2019, 7, 32. [Google Scholar] [CrossRef] [PubMed]
  51. Li, M.; Fan, W.; Xu, Y. Comprehensive Identification of Short and Medium-Sized Peptides from Pixian Broad Bean Paste Protein Hydrolysates Using UPLC-Q–TOF–MS and UHPLC-Q Exactive HF-X. J. Agric. Food Chem. 2022, 70, 8288–8299. [Google Scholar] [CrossRef] [PubMed]
  52. Cerrato, A.; Aita, S.E.; Capriotti, A.L.; Cavaliere, C.; Montone, A.M.I.; Montone, C.M.; Laganà, A. Investigating the Short Peptidome Profile of Italian Dry-Cured Ham at Different Processing Times by High-Resolution Mass Spectrometry and Chemometrics. Int. J. Mol. Sci. 2022, 23, 3193. [Google Scholar] [CrossRef] [PubMed]
  53. Mora, L.; Toldrá, F. Advanced enzymatic hydrolysis of food proteins for the production of bioactive peptides. Curr. Opin. Food Sci. 2023, 49, 100973. [Google Scholar] [CrossRef]
  54. Du, A.; Jia, W. New insights into the bioaccessibility and metabolic fates of short-chain bioactive peptides in goat milk using the INFOGEST static digestion model and an improved data acquisition strategy. Food Res. Int. 2023, 169, 112948. [Google Scholar] [CrossRef] [PubMed]
  55. Pappa, E.; Robertson, J.; Rigby, N.; Mellon, F.; Kandarakis, I.; Mills, E. Application of proteomic techniques to protein and peptide profiling of Teleme cheese made from different types of milk. Int. Dairy J. 2008, 18, 605–614. [Google Scholar] [CrossRef]
Dietetics 03 00002 g001
Figure 1. Percentage of biopeptides according to the type of bioactivity.
Figure 1. Percentage of biopeptides according to the type of bioactivity.
Dietetics 03 00002 g001
Dietetics 03 00002 g002
Figure 2. Percentage of biopeptides according to their protein origin.
Figure 2. Percentage of biopeptides according to their protein origin.
Dietetics 03 00002 g002
Dietetics 03 00002 g003
Figure 3. Frequency of occurrence of biopeptides in Tsalafouti cheese samples.
Figure 3. Frequency of occurrence of biopeptides in Tsalafouti cheese samples.
Dietetics 03 00002 g003
Table 1. Bioactive peptides found in the samples of Tsalafouti cheese.
Table 1. Bioactive peptides found in the samples of Tsalafouti cheese.
Peptide SequenceProteinFragmentPeptide/Fragment Mass (Da)Type of MilkBioactivityReference
SAMPLE 1
MHQPPQPLβ-CN159–166947.106/341.300 (QPP)SheepDPP-IV inhibitory[23]
SPTVMFPPQSVLβ-CN165–1781302.536/430.450 (PQSV)SheepDPP-IV inhibitory[23]
QEPVLGPVRGPFPβ-CN207–2191392.601/475.500 (VRGPF)SheepAntidiabetic[24]
KVLILAβ-CN2–7656.700SheepACE inhibitory[25]
TAQVTSTEVκ-CN184–192934.981/707.700 (TAQVTST)SheepAntithrombotic[26]
SDIPNPIGSEαs1-CN195–2041028.066/502.500 (PIGSE)Sheep/GoatAntidiabetic[23]
VPSERYαs1-CN101–106750.900SheepACE inhibitory[27]
VRYLαs2-CN220–223550.800SheepACE-inhibitory[27]
KFAWPQαs2-CN189–194776.900SheepACE-inhibitory[28]
LKGYGGVSLPEa-La34–441119.265/232.200 (GGV)Sheep/GoatDPP-IV inhibitory[29]
SAMPLE 2
QTPVVVPPFβ-CN94–102983.200SheepImmunomodulatory[30]
NAGPFTPTαs2-CN131–138803.800SheepAntibacterial[31]
YAKPVAκ-CN82–87647.600SheepACE-inhibitory[32]
LKKISQαs2-CN180–185716.600Sheep/GoatAntimicrobial[31]
NPWDQVKRαs2-CN123–1301042.144/659.350 (NPWDQ)GoatAntidiabetic[24]
LKGYGGVSLPEa-La34–441119.265/658.100 (GGVSLPE)Sheep/GoatDPP-IV inhibitory[29]
IPIQYκ-CN47–51633.600GoatDPP-IV inhibitory[33]
GPFPILVβ-CN216–222741.911/342.400 (PIL)GoatDPP-IV inhibitory[23]
SAMPLE 3
TGPIPNβ-CN78–83597.652/383.200 (GPIP)SheepACE-inhibitory[15]
GPFPILVβ-CN216–222741.911/342.400
(PIL)		SheepDPP-IV inhibitory[23]
SPTVMFPPQSVLβ-CN167–1781302.536/430.400 (PQSV)SheepDPP-IV inhibitory[23]
MHQPPQPLβ-CN159–166947.106/454.350 (PQPL)SheepDPP-IV inhibitory[23]
VPSERYαs1-CN101–106750.750SheepACE inhibitory[27]
VDQHQKAMKPWTQ-PKTNAIPYVRYLαs2-CN184–2083013.491/628.500 (PWTQP)SheepAntibacterial[31]
VLVLDTDYKB-Lg110–1181065.213/659.600 (VLVLDT)SheepDPP-IV inhibitory/ACE inhibitory[34]
SAMPLE 4
PPKKDQDKTEVPAκ-CN130–1421452.608/341.300 (PPK)GoatAntimicrobial[35]
ASAEPTVHκ-CN147–154810.844/474.250 (ASAEP)GoatAntimicrobial[35]
PTVHSTPTTEκ-CN151–1601069.118/
635.400 (STPTTE)		GoatAntimicrobial[35]
ENLLRFαs1-CN33–38790.900/662.600 (NLLRF)GoatACE-inhibitory[28]
NPWDQVKRαs2-CN123–1301042.144/830.800 (WDQVKR)GoatAntidiabetic[24]
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
SDIPNPIGSENSEKαs1-CN195–2081486.536/668.600 (DIPNPI)GoatAntibacterial[30]
SAMPLE 5
SPTVMFPPQSVLβ-CN167–1781302.536/304.200 (STP)SheepDPP-IV inhibitory[23]
YQEPVLGPβ-CN206–2131302.536/739.600 (QEPVLGP)GoatAntioxidant/Antidiabetic[24]
SDIPNPIGSEαs1-CN195–2041028.066/668.700 (DIPNP)GoatAntidiabetic[24]
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
DAQSAPLRB-Lg51–58858.000GoatAntimicrobial[35]
TGPIPNβ-CN78–83597.652/383.200 (GPIP)SheepACE-inhibitory[36]
NPWDQVKRαs2-CN123–1301042.144/659.600 (NPWDQ)GoatAntidiabetic[24]
YPYYκ-CN79–82605.500SheepDPP-IV inhibitory/ACE-inhibitory/Opioid[33,37]
YLAHKa-La104–108630.600GoatACE-inhibitory[15]
LKPTPEGDB-Lg46–53969.085/314.350 (PTP)GoatACE-inhibitory[38]
SAMPLE 6
MHQPPQPLβ-CN159–166947.106/341.300 (QPP)SheepDPP-IV inhibitory[23]
ASAEPTVHκ-CN147–154810.844/473.400 (ASAEP)GoatAntimicrobial[35]
SDIPNPIGSENSEKαs1-CN195–2081028.066/502.450 (PIGSE)GoatAntibacterial[30]
SPTVMFPPQSVLβ-CN167–1781302.536/778.400 (SPTVMFP)SheepDPP-IV inhibitory[23]
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
NPWDQVKRαs2-CN123–130659.500/
(NPWDQ) 402.400 (VKR)		GoatAntidiabetic[24]
LKGYGGVSLPEa-La34–441119.265/1.046.300
(GGVSLPEWVC)		Sheep/GoatDPP-IV inhibitory[29]
YLAHKa-La104–108630.600GoatACE-inhibitory[15]
LKPTPEGDB-Lg46–53855.926/628.600 (KPTPEG)GoatACE-inhibitory[38]
ALPMHIRB-Lg142–148837.037/360.350 (LPM)SheepACE-inhibitory[39]
SAMPLE 7
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
VPSERYαs1-CN101–106749.804/863.000
(VPSERYL)		SheepACE inhibitory[27]
SPTVMFPPQSVLβ-CN167–1781302.536/341.300 (PPQ) 360.350 (FPP)SheepDPP-IV inhibitory[23]
NPWDQVKRαs2-CN123–1271042.144/659.550 (NPWDQ)SheepAntidiabetic[24]
IPAVFB-Lg96–100545.662/286.350 (PAV)SheepDPP-IV inhibitory[40]
TGPIPNβ-CN78–83597.652/286.350 (GPI)SheepACE-inhibitory[36]
SAMPLE 8
SLPQβ-CN84–87443.484/558.600 (NSLPQ)Sheep/GoatACE-inhibitory[36]
MHQPPQPLβ-CN159–166947.106/284.350 (HQ)Sheep/GoatDPP-IV inhibitory[23]
SPTVMFPPQSVLβ-CN167–1781302.536/360.400 (FPP)Sheep/GoatDPP-IV inhibitory[23]
NPWDQVKRαs2-CN123–1301302.536/230.300 (NP)GoatAntidiabetic[24]
INNQFLPYPYκ-CN72–811268.415/360.400 (INN)GoatDPP-IV inhibitory[23]
ALNEINQFαs2-CN96–104948.026/878.000 (LNEINQF)GoatAntimicrobial[15]
TAQVTSTEVκ-CN184–192934.981/418.500 (TAQV)Sheep/GoatAntithrombotic[26]
LKPTPEGDB-Lg64–72855.926/314.400 (PTP)Sheep/GoatDPP-IV inhibitory[29]
SAMPLE 9
KFAWPQαs2-CN174–179775.887/550.500 (KFAW)GoatACE-inhibitory[28]
YPFTGPIPNβ-CN60–681005.12/286.400 (GPI)GoatAntimicrobial[16]
SLSSSEESITHβ-CN30–401176.184/477.300 (EESI)GoatAntidiabetic[24]
SDIPNPIGSEαs1-CN195–2041028.066/286.400 (PIG)GoatAntidiabetic[24]
NPWDQVKRαs2-CN123–1301042.144/402.400 (VKR)GoatAntidiabetic[24]
MHQPPQPLβ-CN159–166947.106/454.400 (PQPL)SheepDPP-IV inhibitory[23]
ALPMHIRB-Lg142–148837.037/384.200 (LPM)SheepACE-inhibitory[39]
LKGYGGVSLPEa-La34–441119.265/536.600 (LKGYG)Sheep/GoatDPP-IV inhibitory[29]
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
SAMPLE 10
MHQPPQPLβ-CN159–166947.106/
381.200 (HQP)		SheepDPP-IV inhibitory[23]
SDIPNPIGSEαs1-CN195–2041028.066/1544.500
(APSFSDIPNPIGSEN)		GoatAntidiabetic[24]
NPWDQVKRαs2-CN123–1301042.144/1854.200
(IVLNPWDQVKRNAGPF)		GoatAntidiabetic[24]
GPFPILVβ-CN216–222741.911/342.400 (PIL)GoatDPP-IV inhibitory[23]
LKGYGGVSLPEa-La34–441119.265/431.300 (GGVSL)Sheep/GoatDPP-IV inhibitory[29]
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
YQEPVLGPβ-CN206–213901.997/649.600 (LYQEP)GoatAntioxidant/Antidiabetic[24]
SAMPLE 11
KDQDKκ-CN133–137633.600SheepAntithrombotic[26]
NPWDQVKRαs2-CN123–1301042.144/545.400 (PWDQ) 402.400 (VKR)GoatAntidiabetic[24]
ASAEPTVHκ-CN147–154810.844/376.200 (ASAE)GoatAntimicrobial[35]
PTVHSTPTTEκ-CN151–1601069.118/541.600 (HSTPT)GoatAntimicrobial[35]
LKGYGGVSLPEa-La34–441119.265/231.300 (GGV)Sheep/GoatDPP-IV inhibitory[29]
ENLLRFαs1-CN33–38791.00GoatACE-inhibitory[28]
YAKPVAκ-CN82–87647.600SheepACE-inhibitory[32]
LKKISQαs2-CN180–185715.874/ 446.500 (KIS)Sheep/GoatAntimicrobial[31]
YLAHKa-La104–108630.727/468.450 (LAHK)GoatACE-inhibitory[15]
SAMPLE 12
SDIPNPIGSEαs1-CN195–2041028.066/555.700 (DIPNP)GoatAntidiabetic[24]
KFAWPQαs2-CN189–194775.887/429.550 (WPQ)SheepACE-inhibitory[28]
KDQDKκ-CN133–137633.600/261.800 (KD)SheepAntithrombotic[26]
LKGYGGVSLPEa-La34–441119.265/261.800 (GVS)Sheep/GoatDPP-IV inhibitory[29]
YLAHKa-La104–108630.700GoatACE-inhibitory[15]
LLFB-Lg103–105391.494/555.700 (YLLF)GoatACE-inhibitory[38]
YAKPVAκ-CN82–87647.600SheepACE-inhibitory[32]
ASAEPTVHκ-CN147–154810.844/218.100 (AE)GoatAntimicrobial[35]
Table 2. Released bioactive peptides found in the samples of Tsalafouti cheese after a simulated digestion.
Table 2. Released bioactive peptides found in the samples of Tsalafouti cheese after a simulated digestion.
Biopeptides after Digestion
Original PeptidePeptide after DigestionProteinType of MilkBioactivityReference
LKGYGGVSLPEKGYGGVSLa-LaSheep/GoatACE inhibitor[40]
IPIQYIPIκ-CNGoatDPP IV inhibitor[41]
IPIQYQYκ-CNGoatDPP IV inhibitor[42]
GPFPILVLVβ-CNGoatDPP IV inhibitor[43]
TGPIPNTGPIPNβ-CNSheepACE inhibitor[15]
SPTVMFPPQSVLVLβ-CNSheepDPP IV inhibitor[43]
VPSERYRYαs1-CNSheepAntioxidative[44]
VDQHQKAMKPWTQPKTNAIPYVRYLRYLαs2-CNSheepAntioxidative[44]
VDQHQKAMKPWTQPKTNAIPYVRYLPYVRYLαs2-CNSheepAntioxidative[31]
VLVLDTDYKVLDTDYKB-LgSheepACE inhibitor[45]
PPKKDQDKTEVPAPPKκ-CNGoatAntithrombotic[30]
ASAEPTVHASAEPTVHκ-CNGoatAntimicrobial[35]
SDIPNPIGSENSEKSDIPNPIGSENSEKαs1-CNGoatAntibacterial[30]
YQEPVLGPYQEPVLβ-CNGoatACE inhibitor[46]
YPYYYPYκ-CNSheepDPP IV inhibitor[33]
YPYYYYκ-CNSheepDPP IV inhibitor[43]
ALPMHIRALPMHB-LgSheepACE inhibitor[47]
SLPQPQβ-CNSheep/GoatACE inhibitor[48]
LLFLFB-LgGoatACE inhibitor[49]
Table 3. Bioinformatics analysis for SCPs (short-chain peptides) in Tsalafouti.
Table 3. Bioinformatics analysis for SCPs (short-chain peptides) in Tsalafouti.
Short Chain PeptidesConfirmed BioactivityPeptide Ranker c
VRYLACE-inhibitory b0.3127
IPIQYDPP-IV Inhibitory b0.3607
KDQDKAntithrombotic a0.0764
YPYYACE-inhibitory b, DPP-IV Inhibitory a,b, Opioid b0.7586
YLAHKACE-inhibitory a0.1832
IPAVFACE-inhibitory b, DPP-IV Inhibitory a,b0.6821
SLPQACE-inhibitory b0.3658
LLFACE-inhibitory b0.9389
Short chainPeptides after simulated digestionConfirmed BioactivityPeptide Ranker c
PPKAntithrombotic a0.6062
YPYDPP-IV Inhibitory a,b0.7358
LFACE-inhibitory b, Immunomodulatory b, Anti-inflammatory b0.9869
a The bioactivity for corresponding SCP was retrieved in BIOPEP-UWM (https://biochemia.uwm.edu.pl/ (accessed on 20 December 2023)) [19]. b The bioactivity for corresponding SCP was retrieved from the Milk Bioactive Peptide Database (MBPDB, https://mbpdb.nws.oregonstate.edu/ (accessed on 20 December 2023)) [9]. c The probability of SCPs as bioactive peptides was calculated in the PeptideRanker (https://distilldeep.ucd.ie/PeptideRanker/ (accessed on 20 December 2023)) [9].
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Meleti, E.; Alexandraki, M.; Samara, A.; Loffi, C.; Tedeshi, T.; Galaverna, G.; Manouras, A.; Koureas, M.; Malissiova, E. Profile Assessment of Bioactive Peptides in the Greek Traditional Cheese “Tsalafouti”. Dietetics 2024, 3, 16-29. https://doi.org/10.3390/dietetics3010002

AMA Style

Meleti E, Alexandraki M, Samara A, Loffi C, Tedeshi T, Galaverna G, Manouras A, Koureas M, Malissiova E. Profile Assessment of Bioactive Peptides in the Greek Traditional Cheese “Tsalafouti”. Dietetics. 2024; 3(1):16-29. https://doi.org/10.3390/dietetics3010002

Chicago/Turabian Style

Meleti, Ermioni, Maria Alexandraki, Antonia Samara, Cecilia Loffi, Tullia Tedeshi, Gianni Galaverna, Athanasios Manouras, Michalis Koureas, and Eleni Malissiova. 2024. "Profile Assessment of Bioactive Peptides in the Greek Traditional Cheese “Tsalafouti”" Dietetics 3, no. 1: 16-29. https://doi.org/10.3390/dietetics3010002

APA Style

Meleti, E., Alexandraki, M., Samara, A., Loffi, C., Tedeshi, T., Galaverna, G., Manouras, A., Koureas, M., & Malissiova, E. (2024). Profile Assessment of Bioactive Peptides in the Greek Traditional Cheese “Tsalafouti”. Dietetics, 3(1), 16-29. https://doi.org/10.3390/dietetics3010002

Article Metrics

Back to TopTop