Lectins from Edible Mushrooms
Abstract
:1. Introduction
2. Isolation of Lectins from Edible Mushrooms
Mushroom Species | Structural Properties | Sugar Specificity | Biological Properties | References | ||
---|---|---|---|---|---|---|
Agaricus arvensis | 30.4-kDa, Homodimeric | Inulin | Antiproliferative effects against HepG2 and MCF7 tumor cells. | Zhao [31] | ||
Agaricus bisporus (ABL) | --- | Galβ1,3GalNAc (TF antigen) and Sialyl Galβ1,3GalNAc | Antiproliferative effects on a range of cell types, can be useful for modulating wound healing in subconjunctival space after glaucoma surgery. Inhibits cell proliferation of some ocular and cancer cell lines | Yu [32]; Batterbury [33]; Cheung [34] | ||
Agaricus blazei | --- | BSM, asialo-BSM, fetuin, asialofetuin, GalNAc | --- | Kawagishi [35] | ||
Agrocybe aegerita (AAL) | 15.8-kDa (AAL) Homodimeric and a member of the galectin family | Lactose BSM, glycophorin A, κ-casein, hog gastric mucin, β-galactosides, N-acetylglucosamine. | Tumor-suppressing function via apoptosis-inducing activity in cancer cells | Yang [8]; Yang [28]; Yang [36]; Sun [37]; Zhao [38]; Ren [39] | ||
Agrocybe aegerita (AAL2) (another novel lectin) | 43-kDa, Monomeric | Non-reducing GlcNAc residues | Induces cell apoptosis in vitro. | Jiang [40] | ||
Agrocybe cylindracea | 31.5-kDa, Heterodimeric (15.3-kDa and 16.1-kDa subunits) | Trisaccharides containing NeuAc-α2,3Galβ-(sialic acid), inulin and lactose. Also binds to simple β-galactosides, and their derivatives | Potent mitogenic activity toward mouse splenocytes | Wang [27]; Yagi [41]; Hu [42] | ||
Aleuria aurantia | 72-kDa, Homodimeric Non-glycosylated, composed of two identical 312-amino acid subunits | l-Fucose and fucosyl oligosaccharides | Able to agglutinate all types of human blood erythrocytes when treated with alpha (1 leads to 2)-fucosidase. | Olausson [43]; Kochibe [44] | ||
Armillaria luteo-virens | 29.4-kDa, Dimeric, fairly thermostable | Inulin | Potent mitogenic activity toward splenocytes and antiproliferative activity toward tumor cells | Feng [9] | ||
Auricularia polytricha | 23-kDa, Monomeric | Raffinose, galactose, ovomucoid and β-anomers of galactoside (lactose, p-nitrophenyl-β-d-galactoside) | Able to agglutinate only trypsinized human erythrocytes. | Yagi [45] | ||
Boletopsis leucomelas | 15-kDa, Monomeric | N-acetyl-d-glucosamine | Apoptosis-inducing activity just like mistletoe lectins | Koyama [46] | ||
Boletus edulis (BEL) | Homodimeric, 16.3-kDa subunits | d-Lactose, melibiose- and xylose-cospecific | Stimulating effect on mitogenic response of mouse splenocytes and able to inhibit HIV-1 reverse transcriptase enzyme in vitro. Antineoplastic or antitumor properties. | Zheng [47]; Bovi [48]; Bovi [49] | ||
Boletus subtomentosus | --- | d-Lactose | --- | Singh [14] | ||
Clavaria purpurea (CpL) | 16-kDa, Monomeric | α-galactosyl sugar chains and raffinose | Potential interest for detection and characterization of glycoconjugates containing Galα1-4Gal and other α-galactosyl sugars on the cell surfaces. | Lyimo [50] | ||
Clitocybe nebularis (CNL) | 15.9-kDa | N,N-diacetyllactosediamine (GalNAcb1–4GlcNAc) | Induces maturation and activation of dendritic cells via the toll-like receptor 4 pathway. Also has immunomodulatory properties on leukaemic T-cell lines. Insecticidal and anti-nutritional properties. | Svajger [51]; Pohleven [52]; Pohleven [53] | ||
Coprinopsis cinerea (CGL3) | --- | Oligomers of β1-4 linked N-acetyl-glucosamines (chitooligosaccharides) and GalNAcβ1-4GlcNAc (LacdiNAc) | Since fungal cell walls contain chitin, CGL3 might interfere with fungal growth. | Walti [54] | ||
Coprinus atramentarius | --- | d-Lactose | --- | Singh [14] | ||
Cordyceps militaris (CML) | Monomeric, 31-kDa, CML comprised of 27% α-helix, 12% β-sheets, 29% β-turns, and 32% random coils | Inhibited by sialoglycoproteins | CML exhibits mitogenic activity against mouse splenocytes | Jung [7] | ||
Flammulina velutipes | 12-kDa | β-d-Galactosyl residues, fetuin, human transferrin, human glycophorin, lactoferrin | Inhibits proliferation of leukemia L1210 cells | Yatohgo [55]; Ng [56] | ||
Fomes fomentarius | --- | α-d-Galactosyl residues, GalNAc, raffinose | --- | Singh [14] | ||
Ganoderma capense | 18-kDa fairly heat stable | d(+)-galactose and d(+)-galactosamine | Potent mitogenic activity toward mouse splenocytes, and antiproliferative activity toward leukemia (L1210 and M1) cells and hepatoma (HepG2) cells | Ngai [57] | ||
Ganoderma lucidum (GLL-M and GLL-F) | GLL-M:18-kDa, GLL-F:12-kDa | M-glycoproteins (asialomucin and -fetuin). F- glucosamine and galactosamine along with glycoproteins (asialomucin, fetuin) | With health-promoting and therapeutic effects | Kawagishi [29] | ||
Ganoderma lucidum (another novel lectin from fruiting bodies) | 114-kDa, hexameric lectin, lysine and tryptophan seem to be involved in sugar binding property of lectin | Glycoproteins with N-as well as O-linked glycans | --- | Thakur [10,12] | ||
Grifola frondosa (GFL) | 68-kDa, Homodimeric, high content of acidic and hydroxyl amino acids and low content of methionine and histidine | Terminal N-acetylgalactosamine-specific lectin, porcine stomach mucin, linear d-rhamnan | Cytotoxic against HeLa cells | Stepanova [30]; Kawagishi [58] | ||
Gymnopilus spectabilis | 52.1-kDa and 64.4-kDa subunits Glycoprotein | Glycoproteins: fetuin, lactoferrin, and recombinant erythropoietin | Inhibits in vitro the growth of Staphylococcus aureus and Aspergillus niger. | Alborés [59] | ||
Hericium erinaceum | 54-kDa, Heterodimeric with 15-kDa and 16-kDa subunits | Sialic acids, especially N-glycolylneuraminic acid | Used in Chinese medicine. | Kawagishi [60] | ||
Hygrophorus russula (HRL) | 18.5-kDa Subunits (Homotetrameric) | α1-6 mannobiose isomaltose, Glcα1-6Glc | Shows mitogenic activity against spleen lymph cells (F344 rat) and strong binding of to HIV-1 gp120. | Suzuki [61] | ||
Kuehneromyces mutabilis | --- | Asialo-PSM, asialofetuin, fetuin, α1 acid glycoprotein, ovomucoid | --- | Singh [14] | ||
Laccaria amethystine (two lectins LALa and LALb) | LALa-17.5-kDa, Monomeric LALb-16-kDa, Monomeric | LALa–Lactose LALb—l-Fucose | --- | Guillot [62] | ||
Laccaria amethystine (LAG) | 17-kDa, Monomeric | Lactose and N-acetyllactosamine. | --- | Lyimo [63] | ||
Laccaria bicolor | --- | O-methylated mannose (and fucose) | Role in fungal defense against bacteria and nematodes | Wohlschlager [64] | ||
Laccaria laccata | --- | l-Fucose | --- | Singh [14] | ||
Lactarius deliciosus (LDL) | Dimeric, 37-kDa subunits | Specific for d-Gal β 1-3D-GalNAc residues (TF antigen) | Might play a role in the mechanism of recognition between a tree and its symbiont (fungus) | Guillot [65] | ||
Lactarius deterrimus (related) | 37-kDa, Homodimeric Non-glycoprotein | Specific for [β]-d-galactosyl(1-3)-d-N-acetyl galactosamine residues (TF antigen) | Might play a role in recognition and specificity during the early stages of formation of mycorrhizae | Giollant [66] | ||
Lactarius flavidulus | 29.8-kDa, Dimeric | lactose, p-nitrophenyl α-d-glucopyranoside, p-nitrophenyl β-d-glucopyranoside and inositol, and by the polysaccharide inulin | Suppresses the proliferation of hepatoma (HepG2) and leukemic (L1210) cells. Inhibits the activity of HIV-1RT enzyme. | Wu [67] | ||
Lactarius lignyotus | --- | Asialofetuin, asialo-PSM and other desialyzed glycoproteins | --- | Singh [14] | ||
Lactarius rufus | 98-kDa (containing six subunits) | α-Phenyl-N-acetyl-d-glucosaminopyranoside, 4-nitrophenyl-β-d-Glucosamine, asialo-BSM, Human and bovine thyroglobulin | The lectin agglutinates human etrythrocytes without any marked group specificity. | Panchak [68] | ||
Lactarius salmonicolor | --- | d-Gal- β1,3-d-GalNAc (TF antigen) | --- | Singh [14] | ||
Lactarius vellereus | --- | GalNAc | --- | Singh [14] | ||
Laetiporus sulfureus | 35-kDa, Hexameric Non-glycoprotein | Lactose N-acetyllactosamine | Hemolytic property by pore forming towards blood cells. Homologous to bacterial toxins. | Konska [69]; Mancheño [70]; Tateno [71] | ||
Lentinus edodes | 43-kDa, Monomeric | Mannose, d-Melibiose, Galactosyl and glucosyl residues, N-acetylgalactosamine and N-acetylglucosamine | Mitogenic towards murine splenic lymphocytes. | Wang [72]; Moon [73] | ||
Lyophyllum decastes | 10-kDa, Homodimeric | Galα1,4Gal; α-Galactosyl residues at the nonreducing terminal | The lectin shares carbohydrate binding preference with verocytoxin of bacteria Shigella dysenteriae and E. coli 0157:H7 | Goldstein [74] | ||
Lyophyllum shimeiji | 30-kDa | Not inhibited by simple sugars and glycoproteins. | --- | Ng [75] | ||
Macrolepiota procera | 16-kDa Monomeric | N-acetyllactosamine and other β-galactosides | Has toxic effects towards the nematode indicating a protecting role against predators and parasites | Žurga [76] | ||
Marasmius oreades | Consists of an intact (33-kDa) and truncated (23-kDa) subunit in addition to a small polypeptide (10-kDa) | Galα1,3Galβ1,4GlcNAc trisaccharide sequence; Blood group B trisaccharide (Galα1,3Gal2,1αFuc) | Human blood group B-specific lectin. Has proteolytic activity and inhibits protein and DNA synthesis in NIH/3T3 cells. May induce BAX-mediated apoptosis. | Winter [77]; Cordara [78]; Cordara [79] | ||
Marasmius oreades (MOL) (another novel lectin) | 13-kDa | Mannose and thyroglobulin | --- | Shimokawa [80] | ||
Mycoleptodonoides aitchisonii | 64-kDa subunit, Homotetrameric | Asialo-BSM, BSM | --- | Kawagishi [81] | ||
Panus conchatus | --- | d-Galactose | --- | Singh [14] | ||
Paxillus involutus | --- | Asialo-PSM, Asialofetuin, Fetuin, α1 acid glycoprotein | --- | Singh [14] | ||
Pholiota adiposa | 32-kDa, Homodimeric | Inulin | Antiproliferative activity toward hepatoma Hep G2 cells and breast cancer MCF7 cells. It also exhibits HIV-1 reverse transcriptase inhibitory activity. | Zhang [82] | ||
Pholiota aurivella | --- | Fetuin and Asialofetuin | --- | Singh [14] | ||
Pholiota squarrosa (PhoSL) | 4.5-kDa | l-Fucose α1-6-fucosylated N-glycans. | Able to differentiate between primary and metastatic colon cancer tissues in the expression of α1-6 fucosylation. | Singh [14]; Kobayashi [83] | ||
Pleurocybella porrigens | 56-kDa, Homotetrameric | GalNAc and O-linked glycans | --- | Suzuki [84] | ||
Pleurotus citrinopileatus | 32.4-kDa subunits, Homodimeric | Maltose, O-nitrophenyl-β-d-galactopyranoside, O/P-nitrophenyl-β-d-glucuronide and inulin | Potent antitumor, mitogenic and HIV-1 reverse transcriptase inhibitory activities | Li [20] | ||
Pleurotus ferulae | 35-kDa, Homodimeric | d-glucose, lactose, d-galactose, and galactosamine | Highly potent hemagglutinating and proliferative activities toward mouse splenocytes | Xu [85] | ||
Pleurotus ostreatus. | 40- and 41-kDa subunits, Heterodimeric | Melibiose, lactose, d-galactose, a-methyl-d-galactopyranoside, N-acetylneuraminic acid, raffinose, and inulin. Melibiose is the most potent inhibitory sugar | Potent antitumor activity in sarcoma S-180 bearing and hepatoma H-22 bearing mice. Enhances immunogenicity of some vaccines in transgenic mice. Possesses anti-inflammatory activities | Wang [26]; Gao [86]; Jedinak [87] | ||
Pleurotus tuber-regium | 32-kDa | N-acetylglucosamine-binding | Exhibits hemagglutinating activity toward trypsinized rabbit erythrocytes but not toward untrypsinized rabbit erythrocytes. | Wang [88] | ||
Polyporus adusta | 12-kDa subunits, Homodimeric | Turanose is the most potent inhibitory sugar | Antiproliferative activity toward tumor cell lines and mitogenic activity toward splenocytes | Wang [89] | ||
Polyporus squamosus | 28-kDa subunits, Homodimeric | NeuNAcα2,6βgalactosyl residues | Can be a valuable tool for glycobiological studies in biomedical and cancer research | Mo [90] | ||
Psathyrella velutina | 40-kDa, Monomeric having a regular seven-bladed β -propeller fold | N-acetylglucosamine and N-acetylneuraminic acid specific | Used in detection of glycosylation abnormality in rheumatoid IgG | Cioci [91]; Kochibe [92] | ||
Russula delica | 60-kDa, Homodimeric | Inulin and O-nitrophenyl-beta-d-galactopyranoside | Potent inhibitor for proliferation of HepG2 hepatoma and MCF 7 breast cancer cells, also inhibits HIV-1 reverse transcriptase activity. | Zhao [93] | ||
Russula lepida (RLL) | 16-kDa subunits, Homodimeric | Inulin and O-nitrophenyl-b-d-galacto-pyranoside | Antiproliferative activity towards hepatoma Hep G2 cells and human breast cancer MCF-7 cells | Zhang [11] | ||
Russula nigricans | --- | Asialofetuin, asialo-PSM, Fetuin, Ovomucoid, α1 Acid glycoprotein | --- | Singh [14] | ||
Schizophyllum commune | 64-kDa, Homodimeric | Lactose-specific | Potent mitogenic activity toward mouse splenocytes, antiproliferative activity toward tumor cell lines, and inhibitory activity toward HIV-1 reverse transcriptase | Han [94] | ||
Stropharia rugosoannulata (SRL) | 38-kDa, Homodimeric | Inulin | Exhibits anti-proliferative activity toward both hepatoma Hep G2, cells and leukemia L1210 cells, along with anti HIV-1 reverse transcriptase activity. | Zhang [95] | ||
Tricholoma mongolicum TML-1 and TML-2 * | 37-kDa, Homodimeric, non-glycoprotein in nature | Lactose | Exhibits antiproliferative activities against mouse monocyte-macrophage PU5-1.8 cells and mouse mastocytoma P815 cells in vitro. Stimulates production of nitrite ions by macrophages in normal and tumor-bearing mice. | Wang [23]; Wang [24] | ||
Volvariella volvacea (VVL) | 32-kDa, Homodimeric, Non- glycoprotein | Inhibited not by simple sugars but by thyroglobulin | Potent stimulatory activity towards murine splenic lymphocytes showing immuno-modulatory activity. Also found to enhance transcriptional expression of interleukin-2 and interferon-γ | She [25] | ||
Xerocomus chrysenteron | 15-kDa | Asialofetuin, asialo-PSM and other desialyzed glycoproteins GalNAc and Gal TF antigen | It possesses a high insecticidal activity against the dipteran Drosophila melanogaster and the hemipteran, Acyrthosiphon pisum. | Trigueros [96] | ||
Xerocomus spadiceus | 32.2-kDa (16-kDa subunits), Dimeric | Inulin-specific | Capable of eliciting an approximately four-fold stimulation of mitogenic response in murine splenocytes | Liu [97] | ||
Xylaria hypoxylon | 28.8-kDa, Homodimeric | Inulin- and xylose- specific | Potent hemagglutinating activity, antiproliferative activity towards tumor cell lines, and anti-mitogenic activity on mouse splenocytes | Liu [98] |
3. Structural Properties and Sugar Specificities of Edible Mushroom Lectins
Mushroom Species | N-Terminal Sequences | Reference |
---|---|---|
Agaricus arvensis | TYAVLNFVYG | Zhao [100] |
Agaricus bisporus | MGGSGTSGSL | Zhang [82]; Crenshaw [101] |
Agrocybe aegerita | QGVNIYNI | Yang [32]; Zhao [38] |
Agrocybe cylindracea (15.3-kDa subunit) | AVNFYNVLAGAENDLVADVE | Wang [27] |
Agrocybe cylindracea (16.1-kDa subunit) | RVTNVANGFVAGDQKAMVRV | Wang [27] |
Coprinopsis cinerea | IPLEGTFGDR | Walti [50] |
Flammulina velutipes | TSLTFQLAYL | Zhang [82]; Ko [102] |
Ganoderma capense | VNDYEAWYGADD | Ngai [57] |
Ganoderma lucidum | QFIYNGKFNWLNYALNETIT | Thakur [10,12] |
Grifola frondosa | NWPAEMMIDLKHPIVEMR | Kawagishi [58] |
Hericium erinaceum | AFGQLSFANLAAADF | Li [103] |
Laccaria bicolor | SHLYGDGVAL | Martin [104] |
Lyophyllum shimeiji | PVVFELKFPNNNPESLLALAACARNKAH | Ng [75] |
Marasmius oreades | YILDGEYLVL | Kruger [105] |
Paxillus involutus | CTCAVFLNNTTVKS | Wang [106] |
Pholiota adiposa | DILMGTYGML | Zhang [82] |
Pholiota aurivella | YSVTTPNSVKGGTNQG | Zhang [11]; Kawagishi [107] |
Pleurotus citrinopileatus | QYSQMAQVME | Li [20] |
Pleurotus cornucopiae | SDSTWTFAML | Oguri [108] |
Pleurotus ostreatus (40-kDa subunit) | ATAKIKATPAQPQQFQPAALNAAK | Wang [26] |
Pleurotus ostreatus (41-kDa subunit) | ACATAKCTTATPQQPGCAPAALNAAK | Wang [26] |
Pleurotus tuber-regium | DRXAGYVLYXXVPY | Wang [88] |
Russula lepida | VWYIVAIKTDVPRTT | Zhang [11] |
Stropharia rugosoannulata | IKSGVYRIVSWQGALGPEAR | Zhang [95] |
Volvariellavolvacea | PSNGNQYLIAQAYNLQKVNFDYTPQWQRGN | She [25] |
Xerocomus spadiceus | CSKGGVGRGYGIG | Liu [97] |
4. Functional Properties of Lectins from Edible Mushrooms
5. N-Terminal Sequences of Lectins from Edible Mushrooms
Lectins/FIP | Complete Amino Acid Sequences | References |
---|---|---|
Aleuria aurantia lectin | 1-PTEFLYTSKIAAISWAATGGRQQRVYFQDLNGKIREAQRGGDNPWTGGSSQNVIGEAKLFSPLAAVTWKSAQGIQIRVYCVNKDNILSEFVYDGSKWITGQLGSVGVKVGSNSKLAALQWGGSESAPPNIRVYYQKSNGSGSSIHEYVWSGKWTAGASFGSDVPGDGIGATAIGPGRIRIYYQATINKIREHQQDSNSWYVGGFSASASAGVSIAAISWGSTPNIRVYWQKGREELYEAAYGGSWNTPGQIKDASRPTPSLPDTFIAANSSGNIDISVFFQASGVSLQQWQWISGKGWSIGAVVPTGTPAGW-312 | Fukumori [100] |
FIP-fve | 1-MSATSLTFQLAYLVKKIDFDYTPNWGRGTPSSYIDNLTFPKVLTDKKYSYRVVVNGSDLGVESNFAVTPSGGQTINFLQYNKGYGVADTKTIQVFVVIPDTGNSEEYIIAEWKKT-115 | Bastiaan-Net [115] |
FIP- gts | 1-SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN-110 | Lin [114] |
Hygrophorus russula lectin (HRL) | 1-TIGTAKPILAQTAIVGGPSVPFDDAREVASWPAKLEIAQDFPITGITVRHGQIINNLTIIYRTVNGNSATVSHGGDSGGIVDKVALNENEIITSVQGRAGQHRSYNRPYLDSISFTILDTKTLVTRTTNIFGNGDGTNQGDPFQVAQPYAFAGATYTDGQTGVAGLSFFKVITNA-175 | Suzuki [61] |
LZ-8 | 1-MSDTALIPRLAWDVKKLSFDYPTNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN-111 | Bastiaan-Net [115] |
LZ-9 | 1-MSDTALIPRLAWEIKKLAFDYPTNWGRGNPSSYIDTVTFPQVLTGKEYTYRVAVSGKDLGVRPSYAVESDGSQKVNFLEYNAGYGIADKNTIQVYVIDPDTGNDFIIAQWN-111 | Bastiaan-Net [115] |
6. Conclusions
Acknowledgments
Author Contributions
Conflicts of Interest
References
- Ajith, T.A.; Janardhanan, K.K. Indian medicinal mushrooms as a source of antioxidant and antitumor agents. J. Clin. Biochem. Nutr. 2007, 40, 157–162. [Google Scholar] [CrossRef] [PubMed]
- Ng, T.B. A review of research on the protein-bound polysaccharide (polysaccharopeptide, PSP) from the mushroom Coriolus versicolor (Basidiomycetes: Polyporaceae). Gen. Pharmacol. 1998, 30, 1–4. [Google Scholar] [CrossRef] [PubMed]
- Xu, X.; Yan, H.; Chen, J.; Zhang, X. Bioactive proteins from mushrooms. Biotechnol. Adv. 2011, 29, 667–674. [Google Scholar] [CrossRef] [PubMed]
- Chang, S.T.; Miles, P.G. Mushrooms: Cultivation, Nutritional Value, Medicinal Effect, and Environmental Impact; CRC Press: London, UK, 1989; pp. 4–6. [Google Scholar]
- Mattila, P.; Suonpää, K.; Piironen, V. Functional properties of edible mushrooms. Nutrition 2000, 16, 694–696. [Google Scholar] [CrossRef] [PubMed]
- Guillamón, E.; García-Lafuente, A.; Lozano, M.; D’Arrigo, M.; Rostagno, M.A.; Villares, A.; Martínez, J.A. Edible mushrooms: Role in the prevention of cardiovascular diseases. Fitoterapia 2010, 81, 715–723. [Google Scholar] [CrossRef] [PubMed]
- Jung, E.C.; Kim, K.D.; Bae, C.H.; Kim, J.C.; Kim, D.K.; Kim, H.H. A mushroom lectin from ascomycete Cordyceps militaris. Biochim. Biophys. Acta 2007, 1770, 833–838. [Google Scholar] [CrossRef] [PubMed]
- Yang, N.; Liang, Y.; Xiang, Y.; Zhang, Y.; Sun, H.; Wang, D.C. Crystallization and preliminary crystallographic studies of an antitumour lectin from the edible mushroom Agrocybe aegerita. Protein Pept. Lett. 2005, 12, 705–707. [Google Scholar] [CrossRef] [PubMed]
- Feng, K.; Liu, Q.H.; Ng, T.B.; Liu, H.Z.; Li, J.Q.; Chen, G.; Sheng, H.Y.; Xie, Z.L.; Wang, H.X. Isolation and characterization of a novel lectin from the mushroom Armillaria luteo-virens. Biochem. Biophys. Res. Commun. 2006, 345, 1573–1578. [Google Scholar] [CrossRef] [PubMed]
- Thakur, A.; Rana, M.; Lakhanpal, T.N.; Ahmad, A.; Khan, M.I. Purification and characterization of lectin from fruiting body of Ganoderma lucidum: Lectin from Ganoderma lucidum. Biochim. Biophys. Acta 2007, 1770, 1404–1412. [Google Scholar] [CrossRef] [PubMed]
- Zhang, G.; Sun, J.; Wang, H.; Ng, T.B. First isolation and characterization of a novel lectin with potent antitumor activity from a Russula mushroom. Phytomedicine 2010, 17, 775–781. [Google Scholar] [CrossRef] [PubMed]
- Thakur, A.; Pal, L.; Ahmad, A.; Khan, M.I. Complex Carbohydrate Specificity of Lectin from Fruiting Body of Ganoderma lucidum. A Surface Plasmon Resonance Study. IUBMB Life 2007, 59, 758–764. [Google Scholar] [CrossRef] [PubMed]
- Ng, T.B. Peptides and proteins from fungi. Peptides 2004, 25, 1055–1073. [Google Scholar] [CrossRef] [PubMed]
- Singh, R.S.; Bhari, R.; Kaur, H.P. Mushroom lectins: Current status and future perspectives. Crit. Rev. Biotechnol. 2010, 30, 99–126. [Google Scholar] [CrossRef] [PubMed]
- Kobayashi, Y.; Kobayashi, K.; Umehara, K.; Dohra, H.; Murata, T.; Usui, T.; Kawagishi, H. Purification, characterization, and sugar binding specificity of an N-Glycolylneuraminic acid-specific lectin from the mushroom Chlorophyllum molybdites. J. Biol. Chem. 2004, 279, 53048–53055. [Google Scholar] [CrossRef] [PubMed]
- Santhiya, M.; Jan, M. Screening of wild mushroom amanita species for occurrence of lectins and their partial purification by RP-HPLC. Middle East J. Sci. Res. 2013, 14, 456–460. [Google Scholar]
- Zhao, J.K.; Wang, H.X.; Ng, T.B. Purification and characterization of a novel lectin from the toxic wild mushroom Inocybe umbrinella. Toxicon 2009, 53, 360–366. [Google Scholar] [CrossRef] [PubMed]
- Epis, S.; Matinato, C.; Gentili, G.; Varotto, F.; Bandi, C.; Sassera, D. Molecular detection of poisonous mushrooms in different matrices. Mycologia 2010, 102, 747–754. [Google Scholar] [CrossRef] [PubMed]
- Boa, E. Wild Edible Fungi, a Global Overview of Their Use and Importance to People; Food and Agriculture Organization of the United Nations: Rome, Italy, 2004. [Google Scholar]
- Li, Y.R.; Liu, Q.H.; Wang, H.X.; Ng, T.B. A novel lectin with potent antitumor, mitogenic and HIV-1 reverse transcriptase inhibitory activities from the edible mushroom Pleurotus citrinopileatus. Biochim. Biophys. Acta 2008, 1780, 51–57. [Google Scholar] [CrossRef] [PubMed]
- Pemberton, R.T. Agglutinins (lectins) from some British higher fungi. Mycol. Res. 1994, 98, 277–290. [Google Scholar] [CrossRef]
- Zhang, Y.; Liu, Z.; Ng, T.B.; Chen, Z.; Qiao, W.; Liu, F. Purification and characterization of a novel antitumor protein with antioxidant and deoxyribonuclease activity from edible mushroom Pholiota nameko. Biochime 2014, 99, 28–37. [Google Scholar] [CrossRef]
- Wang, H.X.; Ng, T.B.; Liu, W.K.; Ooi, V.E.; Chang, S.T. Isolation and characterization of two distinct lectins with antiproliferative activity from the cultured mycelium of the edible mushroom Tricholoma mongolicum. Int. J. Pept. Protein Res. 1995, 46, 508–513. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.X.; Ng, T.B.; Ooi, V.E.; Liu, W.K.; Chang, S.T. Actions of lectins from the mushroom Tricholoma mongolicum on macrophages, splenocytes and life-span in sarcoma-bearing mice. Anticancer Res. 1997, 17, 419–424. [Google Scholar] [PubMed]
- She, Q.B.; Ng, T.B.; Liu, W.K. A novel lectin with potent immunomodulatory activity isolated from both fruiting bodies and cultured mycelia of the edible mushroom Volvariella volvacea. Biochem. Biophys. Res. Commun. 1998, 247, 106–111. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Gao, J.; Ng, T.B. A new lectin with highly potent antihepatoma and antisarcoma activities from the Oyster mushroom Pleurotus ostreatus. Biochem. Biophys. Res. Commun. 2000, 275, 810–816. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Ng, T.B.; Liu, Q. Isolation of a new heterodimeric lectin with mitogenic activity from fruiting bodies of the mushroom Agrocybe cylindracea. Life Sci. 2002, 70, 877–885. [Google Scholar] [CrossRef] [PubMed]
- Yang, N.; Tong, X.; Xiang, Y.; Zhang, Y.; Sun, H.; Wang, D.C. Crystallization and preliminary crystallographic studies of the recombinant antitumour lectin from the edible mushroom Agrocybe aegerita. Biochim. Biophys. Acta 2005, 1751, 209–212. [Google Scholar] [CrossRef] [PubMed]
- Kawagishi, H.; Mitsunaga, S.; Yamawaki, M.; Ido, M.; Shimada, A.; Kinoshita, T.; Murata, T.; Usui, T.; Kimura, A.; Chiba, S. A lectin from mycelia of the fungus Ganoderma lucidum. Phytochemistry 1997, 44, 7–10. [Google Scholar] [CrossRef] [PubMed]
- Stepanova, L.V.; Nikitina, V.E.; Boĭko, A.S. Isolation and characterization of lectin from the surface of Grifola frondosa (Fr.) S.F.Gray mycelium. Mikrobiologiia 2007, 76, 488–493. [Google Scholar] [PubMed]
- Zhao, J.K.; Zhao, Y.C.; Li, S.H.; Wang, H.X.; Ng, T.B. Isolation and characterization of a novel thermostable lectin from the wild edible mushroom Agaricus arvensis. J. Basic Microbiol. 2011, 51, 304–311. [Google Scholar] [CrossRef] [PubMed]
- Yu, L.; Fernig, D.G.; Smith, J.A.; Milton, J.D.; Rhodes, J.M. Reversible inhibition of proliferation of epithelial cell lines by Agaricus bisporus (edible mushroom) lectin. Cancer Res. 1993, 53, 4627–4632. [Google Scholar] [PubMed]
- Batterbury, M.; Tebbs, C.A.; Rhodes, J.M.; Grierson, I. Agaricus bisporus (edible mushroom lectin) inhibits ocular fibroblast proliferation and collagen lattice contraction. Exp. Eye Res. 2002, 74, 361–370. [Google Scholar] [CrossRef] [PubMed]
- Cheung, Y.H.; Sheridan, C.M.; Lo, A.C.; Lai, W.W. Lectin from Agaricus bisporus inhibited S phase cell population and Akt phosphorylation in human RPE cells. Investig. Ophthalmol. Vis. Sci. 2012, 53, 7469–7475. [Google Scholar] [CrossRef]
- Kawagishi, H.; Nomura, A.; Yumen, T.; Mizuno, T.; Hagiwara, T.; Nakamura, T. Isolation and properties of a lectin from the fruiting bodies of Agaricus blazei. Carbohydr. Res. 1988, 183, 150–154. [Google Scholar] [CrossRef] [PubMed]
- Yang, N.; Li, D.F.; Feng, L.; Xiang, Y.; Liu, W.; Sun, H.; Wang, D.C. Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita. J. Mol. Biol. 2009, 387, 694–705. [Google Scholar] [CrossRef] [PubMed]
- Sun, H.; Zhao, C.G.; Tong, X.; Qi, Y.P. A lectin with mycelia differentiation and antiphytovirus activities from the edible mushroom Agrocybe aegerita. J. Biochem. Mol. Biol. 2003, 36, 214–222. [Google Scholar] [CrossRef] [PubMed]
- Zhao, C.; Sun, H.; Tong, X.; Qi, Y. An antitumour lectin from the edible mushroom Agrocybe aegerita. Biochem. J. 2003, 374, 321–327. [Google Scholar] [CrossRef] [PubMed]
- Ren, X.; Jiang, S.; Li, D.; Sun, H.; Wang, D. Crystallization and preliminary crystallographic studies of AAL-2, a novel lectin from Agrocybe aegerita that binds nonreducing terminal N-acetylglucosamine. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2013, 69, 650–652. [Google Scholar] [CrossRef] [PubMed]
- Jiang, S.; Chen, Y.; Wang, M.; Yin, Y.; Pan, Y.; Gu, B.; Yu, G.; Li, Y.; Wong, B.H.; Liang, Y.; et al. A novel lectin from Agrocybe aegerita shows high binding selectivity for terminal N-acetylglucosamine. Biochem. J. 2012, 443, 369–378. [Google Scholar] [CrossRef] [PubMed]
- Yagi, F.; Miyamoto, M.; Abe, T.; Minami, Y.; Tadera, K.; Goldstein, I.J. Purification and carbohydrate-binding specificity of Agrocybe cylindracea lectin. Glycoconj. J. 1997, 14, 281–288. [Google Scholar] [CrossRef] [PubMed]
- Hu, D.; Tateno, H.; Sato, T.; Narimatsu, H.; Hirabayashi, J. Tailoring GalNAcα1–3Galβ-specific lectins from a multi-specific fungal galectin: Dramatic change of carbohydrate specificity by a single amino-acid substitution. Biochem. J. 2013, 453, 261–270. [Google Scholar] [CrossRef] [PubMed]
- Olausson, J.; Tibell, L.; Jonsson, B.H.; Påhlsson, P. Detection of a high affinity binding site in recombinant Aleuria aurantia lectin. Glycoconj. J. 2008, 25, 753–762. [Google Scholar] [CrossRef] [PubMed]
- Kochibe, N.; Furukawa, K. Purification and properties of a novel fucosespecific hemagglutinin of Aleuria aurantia. Biochemistry 1980, 19, 2841–2846. [Google Scholar] [CrossRef] [PubMed]
- Yagi, F.; Tadera, K. Purification and characterization of lectin from Auricularia polytricha. Agric. Biol. Chem. 1988, 52, 2077–2079. [Google Scholar] [CrossRef]
- Koyama, Y.; Katsuno, Y.; Miyoshi, N.; Hayakawa, S.; Mita, T.; Muto, H.; Isemura, S.; Aoyagi, Y.; Isemura, M. Apoptosis induction by lectin isolated from the mushroom Boletopsis leucomelas in U937 cells. Biosci. Biotechnol. Biochem. 2002, 66, 784–789. [Google Scholar] [CrossRef]
- Zheng, S.; Li, C.; Ng, T.B.; Wang, H.X. A lectin with mitogenic activity from the edible wild mushroom Boletus edulis. Process Biochem. 2007, 42, 1620–1624. [Google Scholar] [CrossRef]
- Bovi, M.; Carrizo, M.E.; Capaldi, S.; Perduca, M.; Chiarelli, L.R.; Galliano, M.; Monaco, H.L. Structure of a lectin with antitumoral properties in king bolete (Boletus edulis) mushrooms. Glycobiology 2011, 21, 1000–1009. [Google Scholar] [CrossRef] [PubMed]
- Bovi, M.; Cenci, L.; Perduca, M.; Capaldi, S.; Carrizo, M.E.; Civiero, L.; Chiarelli, L.R.; Galliano, M.; Monaco, H.L. BEL β-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms. Glycobiology 2013, 23, 578–592. [Google Scholar] [CrossRef] [PubMed]
- Lyimo, B.; Funakuma, N.; Minami, Y.; Yagi, F. Characterization of a new α-galactosyl-binding lectin from the mushroom Clavaria purpurea. Biosci. Biotechnol. Biochem. 2012, 76, 336–342. [Google Scholar] [CrossRef] [PubMed]
- Svajger, U.; Pohleven, J.; Kos, J.; Strukelj, B.; Jeras, M. CNL, a ricin B-like lectin from mushroom Clitocybe nebularis, induces maturation and activation of dendritic cells via the toll-like receptor 4 pathway. Immunology 2011, 134, 409–418. [Google Scholar] [CrossRef] [PubMed]
- Pohleven, J.; Brzin, J.; Vrabec, L.; Leonardi, A.; Cokl, A.; Strukelj, B.; Kos, J.; Sabotič, J. Basidiomycete Clitocybe nebularis is rich in lectins with insecticidal activities. Appl. Microbiol. Biotechnol. 2011, 91, 1141–1148. [Google Scholar] [CrossRef] [PubMed]
- Pohleven, J.; Renko, M.; Magister, Š.; Smith, D.F.; Künzler, M.; Štrukelj, B.; Turk, D.; Kos, J.; Sabotič, J. Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAcβ1–4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis. J. Biol. Chem. 2012, 287, 10602–10612. [Google Scholar] [CrossRef] [PubMed]
- Walti, M.A.; Walser, P.J.; Thore, S.; Grunler, A.; Bednar, M.; Kunzler, M.; Aebi, M. Structural basis for chitotetraose coordination by CGL3, a novel galectin-related protein from Coprinopsis cinerea. J. Mol. Biol. 2008, 379, 146–159. [Google Scholar] [CrossRef] [PubMed]
- Yatohgo, T.; Nakata, M.; Tsumuraya, Y.; Hashimoto, Y.; Yamamoto, S. Purification and properties of a lectin from the fruitbodies of Flammulina velutipes. Agric. Biol. Chem. 1988, 52, 1485–1493. [Google Scholar] [CrossRef]
- Ng, T.B.; Ngai, P.H.; Xia, L. An agglutinin with mitogenic and antiproliferative activities from the mushroom Flammulina velutipes. Mycologia 2006, 98, 167–171. [Google Scholar] [CrossRef] [PubMed]
- Ngai, P.H.; Ng, T.B. A mushroom (Ganoderma capense) lectin with spectacular thermostability, potent mitogenic activity on splenocytes, and antiproliferative activity toward tumor cells. Biochem. Biophys. Res. Commun. 2004, 314, 988–993. [Google Scholar] [CrossRef] [PubMed]
- Kawagishi, H.; Nomura, A.; Mizuno, T.; Kimura, A.; Chiba, S. Isolation and characterization of a lectin from Grifola frondosa fruiting bodies. Biochim. Biophys. Acta 1990, 1034, 247–252. [Google Scholar] [CrossRef] [PubMed]
- Alborés, S.; Mora, P.; Bustamante, M.J.; Cerdeiras, M.P.; Franco Fraguas, L. Purification and applications of a lectin from the mushroom Gymnopilus spectabilis. Appl. Biochem. Biotechnol. 2014, 172, 2081–2090. [Google Scholar] [CrossRef] [PubMed]
- Kawagishi, H.; Mori, H.; Unoa, A.; Kimurab, A.; Chibab, S. A sialic acid-binding lectin from the mushroom Hericium erinaceum. FEBS Lett. 1994, 340, 56–58. [Google Scholar] [CrossRef] [PubMed]
- Suzuki, T.; Sugiyama, K.; Hirai, H.; Ito, H.; Morita, T.; Dohra, H.; Murata, T.; Usui, T.; Tateno, H.; Hirabayashi, J.; et al. Mannose-specific lectin from the mushroom Hygrophorus russula. Glycobiology 2012, 22, 616–629. [Google Scholar] [CrossRef] [PubMed]
- Guillot, J.; Gernaud, L.; Gueugnot, I.; Damez, M. Purification and properties of two hemagglutinins of the mushroom Laccaria amethystina. Biochemistry 1983, 22, 5365–5369. [Google Scholar] [CrossRef]
- Lyimo, B.; Yagi, F.; Minami, Y. Primary structure and specificity of a new member of galectin family from the Amethyst deceiver mushroom Laccaria amethystina. Biosci. Biotechnol. Biochem. 2011, 75, 62–69. [Google Scholar] [CrossRef] [PubMed]
- Wohlschlager, T.; Butschi, A.; Grassi, P.; Sutov, G.; Gauss, R.; Hauck, D.; Schmieder, S.S.; Knobel, M.; Titz, A.; Dell, A.; et al. Methylated glycans as conserved targets of animal and fungal innate defense. Proc. Natl. Acad. Sci. USA 2014, 111, E2787–E2796. [Google Scholar] [CrossRef] [PubMed]
- Guillot, J.; Giollant, M.; Damez, M.; Dusser, M. Isolation and characterization of a lectin from the mushroom, Lactarius deliciosus. J. Biochem. 1991, 109, 840–845. [Google Scholar] [PubMed]
- Giollant, M.; Guillot, J.; Damez, M.; Dusser, M.; Didier, P.; Didier, E. Characterization of a Lectin from Lactarius deterrimus (Research on the Possible Involvement of the Fungal Lectin in Recognition between Mushroom and Spruce during the Early Stages of Mycorrhizae Formation). Plant Physiol. 1993, 101, 513–522. [Google Scholar] [PubMed]
- Wu, Y.; Wang, H.; Ng, T.B. Purification and characterization of a lectin with antiproliferative activity toward cancer cells from the dried fruit bodies of Lactarius flavidulus. Carbohydr. Res. 2011, 346, 2576–2581. [Google Scholar] [CrossRef] [PubMed]
- Panchak, L.V.; Antoniuk, V.O. Purification of lectin from fruiting bodies of Lactarius rufus (Scop.: Fr.)Fr. and its carbohydrate specificity. Ukr. Biokhim. Zh. 2007, 79, 123–128. [Google Scholar] [PubMed]
- Konska, G.; Guillot, J.; Dusser, M.; Damez, M.; Botton, B. Isolation and characterization of an N-acetyllactosamine-binding lectin from the mushroom Laetiporus sulfureus. J. Biochem. 1994, 116, 519–523. [Google Scholar] [PubMed]
- Mancheño, J.M.; Tateno, H.; Goldstein, I.J.; Martínez-Ripoll, M.; Hermoso, J.A. Structural analysis of the Laetiporus sulphureus hemolytic pore-forming lectin in complex with sugars. J. Biol. Chem. 2005, 280, 17251–17259. [Google Scholar] [CrossRef] [PubMed]
- Tateno, H.; Goldstein, I.J. Molecular cloning, expression, and characterization of novel hemolytic lectins from the mushroom Laetiporus sulphureus, which show homology to bacterial toxins. J. Biol. Chem. 2003, 278, 40455–40463. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.X.; Ng, T.B.; Ooi, V.E.C. Studies on purification of a lectin from fruiting bodies of the edible shiitake mushroom Lentinus edodes. Int. J. Biochem. Cell Biol. 1999, 31, 595–599. [Google Scholar] [CrossRef]
- Moon, I.J.; Chung, S.R.; Jeune, K.H. Mitotic stimulation and cancer cell agglutination of the lectin from Lentinus edodes. Yakhak Hoeji 1995, 39, 260–267. (In Korean) [Google Scholar]
- Goldstein, I.J.; Winter, H.C.; Aurandt, J.; Confer, L.; Adamson, J.T.; Hakansson, K.; Remmer, H. A new alpha-galactosyl-binding protein from the mushroom Lyophyllum decastes. Arch. Biochem. Biophys. 2007, 467, 268–274. [Google Scholar] [CrossRef] [PubMed]
- Ng, T.B.; Lam, Y.W. Isolation of a novel agglutinin with complex carbohydrate binding specificity from fresh fruiting bodies of the edible mushroom Lyophyllum shimeiji. Biochem. Biophys. Res. Commun. 2002, 290, 563–568. [Google Scholar] [CrossRef] [PubMed]
- Žurga, S.; Pohleven, J.; Renko, M.; Bleuler-Martinez, S.; Sosnowski, P.; Turk, D.; Künzler, M.; Kos, J.; Sabotič, J. A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic. FEBS J. 2014, 281, 3489–3506. [Google Scholar] [CrossRef] [PubMed]
- Winter, H.C.; Mostafapour, K.; Goldstein, I.J. The mushroom Marasmius oreades lectin is a blood group type B agglutinin that recognizes the Galalpha 1,3Gal and Galalpha 1,3Galbeta 1,4GlcNAc porcine xenotransplantation epitopes with high affinity. J. Biol. Chem. 2002, 277, 14996–15001. [Google Scholar] [CrossRef] [PubMed]
- Cordara, G.; Egge-Jacobsen, W.; Johansen, H.T.; Winter, H.C.; Goldstein, I.J.; Sandvig, K.; Krengel, U. Marasmius oreades agglutinin (MOA) is a chimerolectin with proteolytic activity. Biochem. Biophys. Res. Commun. 2011, 408, 405–410. [Google Scholar] [CrossRef] [PubMed]
- Cordara, G.; Winter, H.C.; Goldstein, I.J.; Krengel, U.; Sandvig, K. The fungal chimerolectin MOA inhibits protein and DNA synthesis in NIH/3T3 cells and may induce BAX-mediated apoptosis. Biochem. Biophys. Res. Commun. 2014, 447, 586–589. [Google Scholar] [CrossRef] [PubMed]
- Shimokawa, M.; Fukudome, A.; Yamashita, R.; Minami, Y.; Yagi, F.; Tateno, H.; Hirabayashi, J. Characterization and cloning of GNA-like lectin from the mushroom Marasmius oreades. Glycoconj. J. 2012, 29, 457–465. [Google Scholar] [CrossRef] [PubMed]
- Kawagishi, H.; Takagi, J.; Taira, T.; Murata, T.; Usui, T. Purification and characterization of a lectin from the mushroom Mycoleptodonoides aitchisonii. Phytochemistry 2001, 56, 53–58. [Google Scholar] [CrossRef] [PubMed]
- Zhang, G.Q.; Sun, J.; Wang, H.X.; Ng, T.B. A novel lectin with antiproliferative activity from the medicinal mushroom Pholiota adiposa. Acta Biochim. Pol. 2009, 56, 415–421. [Google Scholar] [PubMed]
- Kobayashi, Y.; Tateno, H.; Dohra, H.; Moriwaki, K.; Miyoshi, E.; Hirabayashi, J.; Kawagishi, H. A novel core fucose-specific lectin from the mushroom Pholiota squarrosa. J. Biol. Chem. 2012, 287, 33973–33982. [Google Scholar] [CrossRef]
- Suzuki, T.; Amano, Y.; Fujita, M.; Kobayashi, Y.; Dohra, H.; Hirai, H.; Murata, T.; Usui, T.; Morita, T.; Kawagishi, H. Purification, characterization, and cDNA cloning of a lectin from the mushroom Pleurocybella porrigens. Biosci. Biotechnol. Biochem. 2009, 73, 702–709. [Google Scholar] [CrossRef] [PubMed]
- Xu, C.J.; Wang, Y.X.; Niu, B.N.; Liu, B.; Li, Y.B.; Wang, X.M.; Lu, S.L. Isolation and characterization of a novel lectin with mitogenic activity from Pleurotus ferulae. Pak. J. Pharm. Sci. 2014, 27, 983–989. [Google Scholar] [PubMed]
- Gao, W.; Sun, Y.; Chen, S.; Zhang, J.; Kang, J.; Wang, Y.; Wang, H.; Xia, G.; Liu, Q.; Kang, Y. Mushroom lectin enhanced immunogenicity of HBV DNA vaccine in C57BL/6 and HBsAg-transgenic mice. Vaccine 2013, 31, 2273–2280. [Google Scholar] [CrossRef] [PubMed]
- Jedinak, A.; Dudhgaonkar, S.; Wu, Q.L.; Simon, J.; Sliva, D. Anti-inflammatory activity of edible oyster mushroom is mediated through the inhibition of NF-κB and AP-1 signaling. Nutr. J. 2011, 10, p. 52. Available online: http://www.biomedcentral.com/content/pdf/1475-2891-10-52.pdf (accessed on 24 December 2014).
- Wang, H.; Ng, T.B. Isolation of a novel N-acetylglucosamine-specific lectin from fresh sclerotia of the edible mushroom Pleurotus tuber-regium. Protein Expr. Purif. 2003, 29, 156–160. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.; Ng, T.B.; Liu, Q. A novel lectin from the wild mushroom Polyporus adusta. Biochem. Biophys. Res. Commun. 2003, 307, 535–539. [Google Scholar] [CrossRef] [PubMed]
- Mo, H.; Winter, H.C.; Goldstein, I.J. Purification and characterization of a Neu5Acalpha2-6Galbeta1-4Glc/GlcNAc-specific lectin from the fruiting body of the polypore mushroom Polyporus squamosus. J. Biol. Chem. 2000, 275, 10623–10629. [Google Scholar] [CrossRef] [PubMed]
- Cioci, G.; Mitchell, E.P.; Chazalet, V.; Debray, H.; Oscarson, S.; Lahmann, M.; Gautier, C.; Breton, C.; Perez, S.; Imberty, A. β-propeller crystal structure of Psathyrella velutina lectin: An integrin-like fungal protein interacting with monosaccharides and calcium. J. Mol. Biol. 2006, 357, 1575–1591. [Google Scholar] [CrossRef] [PubMed]
- Kochibe, N.; Matta, K.L. Purification and properties of an N-acetylglucosamine-specific lectin from Psathyrella velutina mushroom. J. Biol. Chem. 1989, 264, 173–177. [Google Scholar] [PubMed]
- Zhao, S.; Zhao, Y.; Li, S.; Zhao, J.; Zhang, G.; Wang, H.; Ng, T.B. A novel lectin with highly potent antiproliferative and HIV-1 reverse transcriptase inhibitory activities from the edible wild mushroom Russula delica. Glycoconj. J. 2010, 27, 259–265. [Google Scholar] [CrossRef] [PubMed]
- Han, C.H.; Liu, Q.H.; Ng, T.B.; Wang, H.X. A novel homodimeric lactose-binding lectin from the edible split gill medicinal mushroom Schizophyllum commune. Biochem. Biophys. Res. Commun. 2005, 336, 252–257. [Google Scholar] [CrossRef] [PubMed]
- Zhang, W.; Tian, G.; Geng, X.; Zhao, Y.; Ng, T.B.; Zhao, L.; Wang, H. Isolation and Characterization of a Novel Lectin from the Edible Mushroom Stropharia rugosoannulata. Molecules 2014, 19, 19880–19891. [Google Scholar] [CrossRef] [PubMed]
- Trigueros, V.; Lougarre, A.; Ali-Ahmed, D.; Rahbé, Y.; Guillot, J.; Chavant, L.; Fournier, D.; Paquereau, L. Xerocomus chrysenteron lectin: Identification of a new pesticidal protein. Biochim. Biophys. Acta 2003, 1621, 292–298. [Google Scholar] [CrossRef] [PubMed]
- Liu, Q.; Wang, H.; Ng, T.B. Isolation and characterization of a novel lectin from the wild mushroom Xerocomus spadiceus. Peptides 2004, 25, 7–10. [Google Scholar] [CrossRef] [PubMed]
- Liu, Q.; Wang, H.; Ng, T.B. First report of a xylose-specific lectin with potent hemagglutinating, antiproliferative and anti-mitogenic activities from a wild ascomycete mushroom. Biochim. Biophys. Acta 2006, 1760, 1914–1919. [Google Scholar] [CrossRef] [PubMed]
- Wang, H.X.; Ooi, V.E.; Ng, T.B.; Chiu, K.W.; Chang, S.T. Hypotensive and vasorelaxing activities of a lectin from the edible mushroom Tricholoma mongolicum. Pharmacol. Toxicol. 1996, 79, 318–323. [Google Scholar] [CrossRef] [PubMed]
- Fukumori, F.; Takeuchi, N.; Hagiwara, T.; Ohbayashi, H.; Endo, T.; Kochibe, N.; Nagata, Y.; Kobata, A. Primary structure of a fucose-specific lectin obtained from a mushroom, Aleuria aurantia. J. Biochem. 1990, 107, 190–196. [Google Scholar] [PubMed]
- Crenshaw, R.W.; Harper, S.N.; Moyer, M.; Privalle, L.S. Isolation and characterization of a cDNA clone encoding a lectin gene from Agaricus bisporus. Plant Physiol. 1995, 107, 1465–1466. [Google Scholar] [CrossRef] [PubMed]
- Ko, J.L.; Hsu, C.I.; Lin, R.H.; Kao, C.L.; Lin, J.Y. A new fungal immunomodulatory protein, FIP-five isolated from the edible mushroom, Flammulina velutipes and its complete amino acid sequence. Eur. J. Biochem. 1995, 228, 244–249. [Google Scholar] [CrossRef] [PubMed]
- Li, Y.; Zhang, G.; Ng, T.B.; Wang, H. A novel lectin with antiproliferative and HIV-1 reverse transcriptase inhibitory activities from dried fruiting bodies of the monkey head mushroom Hericium erinaceum. J. Biomed. Biotechnol. 2010, 2010, 716515. [Google Scholar] [CrossRef] [PubMed]
- Martin, F.; Aerts, A.; Ahren, D.; Brun, A.; Danchin, E.G.; Duchaussoy, F.; Gibon, J.; Kohler, A. The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 2008, 452, 42–43. [Google Scholar] [CrossRef] [PubMed]
- Kruger, R.P.; Winter, H.C.; Simonson-Leff, N.; Stuckey, J.A.; Goldstein, I.J.; Dixon, J.E. Cloning, expression, and characterization of the Galalpha 1,3Gal high affinity lectin from the mushroom Marasmius oreades. J. Biol. Chem. 2002, 277, 15002–15005. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.X.; Zhang, G.Q.; Zhao, S.; Xu, F.; Zhou, Y.; Li Geng, X.; Liu, Y.; Wang, H.X. Purification and characterization of a novel lectin with antiphytovirus activities from the wild mushroom Paxillus involutus. Protein Pept. Lett. 2013, 20, 767–774. [Google Scholar] [CrossRef] [PubMed]
- Kawagishi, H.; Abe, Y.; Nagata, T.; Kimura, A.; Chiba, S. A lectin from the mushroom Pholiota aurivella. Agric. Biol. Chem. 1991, 55, 2485–2489. [Google Scholar] [CrossRef] [PubMed]
- Oguri, S.; Ando, A.; Nagata, Y. A novel developmental stage-specific lectin of the basidiomycete Pleurotus cornucopiae. J. Bacteriol. 1996, 178, 5692–5698. [Google Scholar] [PubMed]
- Devi, K.S.; Roy, B.; Patra, P.; Sahoo, B.; Islam, S.S.; Maiti, T.K. Characterization and lectin microarray of an immunomodulatory heteroglucan from Pleurotus ostreatus mycelia. Carbohydr. Polym. 2013, 94, 857–865. [Google Scholar] [CrossRef] [PubMed]
- Guillot, J.; Konska, G. Lectins in higher fungi. Biochem. Syst. Ecol. 1997, 25, 203–230. [Google Scholar] [CrossRef]
- Khan, F.; Khan, M.I. Fungal Lectins: Current molecular and biochemical perspectives. Int. J. Biol. Chem. 2011, 5, 1–20. [Google Scholar] [CrossRef]
- Lin, J.Y.; Chou, T.B. Isolation and characterization of a lectin from edible mushroom, Volvariella volvacea. J. Biochem. 1984, 96, 35–40. [Google Scholar] [PubMed]
- Yang, N.; Tong, X.; Xiang, Y.; Zhang, Y.; Liang, Y.; Sun, H.; Wang, D.C. Molecular character of the recombinant antitumor lectin from the edible mushroom Agrocybe aegerita. J. Biochem. 2005, 138, 145–150. [Google Scholar] [CrossRef] [PubMed]
- Lin, W.H.; Hung, C.H.; Hsu, C.I.; Lin, J.Y. Dimerization of the N-terminal amphipathic alpha-helix domain of the fungal immunomodulatory protein from Ganoderma tsugae (Fip-gts) defined by a yeast two-hybrid system and site-directed mutagenesis. J. Biol. Chem. 1997, 272, 20044–20048. [Google Scholar] [CrossRef] [PubMed]
- Bastiaan-Net, S.; Chanput, W.; Hertz, A.; Zwittink, R.D.; Mes, J.J.; Wichers, H.J. Biochemical and functional characterization of recombinant fungal immunomodulatory proteins (rFIPs). Int. Immunopharmacol. 2013, 15, 167–175. [Google Scholar] [CrossRef] [PubMed]
- Wasser, S.P. Medicinal mushroom science: Current perspectives, advances, evidences, and challenges. Biomed. J. 2014, 37, 345–356. [Google Scholar] [PubMed]
© 2014 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license ( http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Singh, S.S.; Wang, H.; Chan, Y.S.; Pan, W.; Dan, X.; Yin, C.M.; Akkouh, O.; Ng, T.B. Lectins from Edible Mushrooms. Molecules 2015, 20, 446-469. https://doi.org/10.3390/molecules20010446
Singh SS, Wang H, Chan YS, Pan W, Dan X, Yin CM, Akkouh O, Ng TB. Lectins from Edible Mushrooms. Molecules. 2015; 20(1):446-469. https://doi.org/10.3390/molecules20010446
Chicago/Turabian StyleSingh, Senjam Sunil, Hexiang Wang, Yau Sang Chan, Wenliang Pan, Xiuli Dan, Cui Ming Yin, Ouafae Akkouh, and Tzi Bun Ng. 2015. "Lectins from Edible Mushrooms" Molecules 20, no. 1: 446-469. https://doi.org/10.3390/molecules20010446
APA StyleSingh, S. S., Wang, H., Chan, Y. S., Pan, W., Dan, X., Yin, C. M., Akkouh, O., & Ng, T. B. (2015). Lectins from Edible Mushrooms. Molecules, 20(1), 446-469. https://doi.org/10.3390/molecules20010446