Next Article in Journal
Characterization of Fumonisin A-Series by High-Resolution Liquid Chromatography-Orbitrap Mass Spectrometry
Next Article in Special Issue
Okinalysin, a Novel P-I Metalloproteinase from Ovophis okinavensis: Biological Properties and Effect on Vascular Endothelial Cells
Previous Article in Journal / Special Issue
Engineering Venom’s Toxin-Neutralizing Antibody Fragments and Its Therapeutic Potential

Toxins 2014, 6(8), 2568-2579; doi:10.3390/toxins6082568

The Activation Effect of Hainantoxin-I, a Peptide Toxin from the Chinese Spider, Ornithoctonus hainana, on Intermediate-Conductance Ca2+-Activated K+ Channels
Pengfei Huang , Yiya Zhang , Xinyi Chen , Li Zhu , Dazhong Yin , Xiongzhi Zeng * and Songping Liang *
Key Laboratory of Protein Chemistry and Developmental Biology of the Ministry of Education, College of Life Sciences, Hunan Normal University, Changsha 410081, Hunan, China; E-Mails: (P.H.); (Y.Z.); (X.C.); (L.Z.); (D.Y.)
These authors contributed equally to this work.
Authors to whom correspondence should be addressed; E-Mails: (X.Z.); (S.L.); Tel.: +86-731-8887-2556 (X.Z. & S.L.); Fax: +86-731-8886-1304 (X.Z. & S.L.).
Received: 26 May 2014; in revised form: 28 July 2014 / Accepted: 14 August 2014 /
Published: 21 August 2014


: Intermediate-conductance Ca2+-activated K+ (IK) channels are calcium/calmodulin-regulated voltage-independent K+ channels. Activation of IK currents is important in vessel and respiratory tissues, rendering the channels potential drug targets. A variety of small organic molecules have been synthesized and found to be potent activators of IK channels. However, the poor selectivity of these molecules limits their therapeutic value. Venom-derived peptides usually block their targets with high specificity. Therefore, we searched for novel peptide activators of IK channels by testing a series of toxins from spiders. Using electrophysiological experiments, we identified hainantoxin-I (HNTX-I) as an IK-channel activator. HNTX-I has little effect on voltage-gated Na+ and Ca2+ channels from rat dorsal root ganglion neurons and on the heterologous expression of voltage-gated rapidly activating delayed rectifier K+ channels (human ether-à-go-go-related gene; human ERG) in HEK293T cells. Only 35.2% ± 0.4% of the currents were activated in SK channels, and there was no effect on BK channels. We demonstrated that HNTX-I was not a phrenic nerve conduction blocker or acutely toxic. This is believed to be the first report of a peptide activator effect on IK channels. Our study suggests that the activity and selectivity of HNTX-I on IK channels make HNTX-I a promising template for designing new drugs for cardiovascular diseases.
IK channels; peptide activator; HNTX-I; selectivity; new drug design

1. Introduction

The intermediate-conductance Ca2+-activated K+ (IK) channels belong to the gene family of calcium/calmodulin-regulated and voltage-independent K+ channels (SK1/SK2/SK3 and IK) [1] and contribute to cellular functions by producing membrane hyperpolarization, thus regulating intracellular Ca2+ signaling. IK channels are gated solely by internal Ca2+, with a unit conductance of 20–85 pS. Expression of hIK1 in HEK293T cells gives rise to inwardly rectifying K+ currents, which are activated by submicromolar concentrations of intracellular Ca2+ (EC50 = 0.3 μM) [2]. From the pathophysiological perspective, disturbances of endothelial functions leading to reduced endothelium-dependent vasodilatation are present in patients with cardiovascular risk factors. Under normal physiological conditions, endothelium-dependent vasodilatation results from membrane hyperpolarization and the subsequent increase in endothelial cell (EC) Ca2+. The EC membrane potential is regulated by several ion channels, including cation and K+ channels. Of the large group of K+ channels, Ca2+-activated K+ channels especially play a role in controlling membrane hyperpolarization in vascular cells. Accordingly, studies by several groups have shown that organic small molecule activators of IK channels, such as NS309 (3-oxime-6,7-dichloro-1H-indole-2,3-dione) [3] and DC-EBIO (5,6-dichloro-1-ethyl-1,3-dihydro-2H-benzimidazole-2-one) [4], are, to some degree, efficient in halting cardiovascular disease processes in animal models [5].

There are a variety of valuable pharmacological tools available to study the contribution of specific IK channels to the mechanism of endothelium-dependent dilation in isolated vessels and to blood pressure control in vivo. IK channel modulators mainly comprise small organic compounds and venom-derived peptides [6]. These different classes of chemicals modulate the channel by binding to either the external or the internal face of the ion-conducting pore. Among the different ion modulators, venom-derived peptides usually block their targets with high affinity, that is, with IC50 in the micromolar or even nanomolar range, and are therefore considered as the most selective and potent ion-channel inhibitors. The disadvantage of venom-derived peptides that affect IK channels is that, to date, they are only inhibitors and not activators. Some small organic compounds also exhibit high affinity for IK channels, but at higher concentrations, they usually exert non-specific actions. A disadvantage of DC-EBIO and NS309 is that both compounds block L-type Ca2+ channels with an IC50 of 70 and 10 mM [7], respectively, and NS309 at micromolar concentrations also inhibits cardiac hERG K+ channels [3], thus raising concerns about its in vivo usage. However, in keeping with the uncertain or weak selectivity of some of the activators, caution is indicated in interpreting results when using higher dosages in vitro and in vivo [8]. For this reason, we screened for peptide-positive gating modulators from venom-derived peptides as alternatives to the existing small organic activators.

Spider venoms contain a variety of toxins that target ion channels and have been used as a potential source of new compounds with specific pharmacological properties. Hainantoxin-I (HNTX-I, Mu-theraphotoxin-Hhn2b, UniProtKB: D2Y1X7) is a polypeptide neurotoxin isolated from the venom of Chinese bird spider Ornithoctonus hainana (O. hainana) [9]. Composed of 33 residues and stabilized by intracellular disulfide bridges (Cys2–Cys17, Cys9–Cys22 and Cys16–Cys29), the toxin adopts a typical inhibitor cystine knot (ICK) structural motif that frequently emerges in spider toxins and conotoxins. A three-dimensional solution structure of HNTX-I has been determined using two-dimensional 1H-NMR spectroscopy [9] (Figure 1A, PDB: 1N1X). Our previous works demonstrated that HNTX-I shows no effect on the neuronal TTX-S VGSCs in adult rat dorsal root ganglion neurons nor does it target VGSCs in cardiac or skeletal muscles of mammals. It selectively blocks rNav1.2/β1 and para/tipE channels expressed in Xenopus laevis oocytes.

In the present study, IK-transfected HEK293T cells were studied in the whole-cell configuration of the patch-clamp technique. HNTX-I activated IK channels with an EC50 value of 26.3 ± 0.4 μM (n = 5). To test the selectivity of the compound, we screened it against a panel of other channels and revealed that voltage-gated Na+ channels, Ca2+ channels and hERG K+ channels were insensitive to 100 μM HNTX-I. Furthermore, a phrenic nerve conduction study and a toxicity test of mouse increase the pharmaceutical value of HNTX-I.

2. Results and Discussion

2.1. Defining the HNTX-I for hIK1 Activate

The amino acid sequence of HNTX-I is ECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL. Its experimental average molecular mass is 3,608.02 Da, and its monoisotopic molecular mass is 3605.62 Da, consistent with the calculated molecular mass for HNTX-I-amide. Hence, it was concluded that HNTX-I is amidated at the C-terminally. The disulfide linkages of HNTX-I were determined to be Cys2–Cys17, Cys9–Cys22 and Cys16–Cys29 (known as the 1–4, 2–5 and 3–6 disulfide patterns). The final sequence of this toxin has been confirmed by the data of disulfide bond assignment and 2D-NMR [9]. Figure 1B shows currents from a representative IK-transfected HEK293T cell elicited by voltage ramps with 0.3 μM free Ca2+ in the pipette solution in the presence and absence of HNTX-I, indicating that the toxin enhanced the amplitude of IK currents by 33.2% ± 0.5% and 97% ± 0.7% at the concentration of 40 and 80 μM, respectively (n = 5). In experiments with buffered Ca2+-free pipette solutions (10 mM EGTA with no added Ca2+), HNTX-I was not able to activate the IK channels (data not shown). The time course of an experiment on hIK1 channels is shown in Figure 2A. After 5 min of equilibration, the intracellular Ca2+ concentration stabilized at the new level (influenced by the buffered 0.3 μM pipette concentration). After 40 μM HNTX-I was applied, a higher current level was reached within ~3 min (n = 5), and upon washing, the current returned to baseline with approximately the same time characteristics. Application of 80 μM HNTX-I clearly demonstrated the dose-dependency, as well as reversible nature of this compound on hIK1 channels. HNTX-I activated the IK channels in a dose-dependent manner with an EC50 value of 26.3 ± 0.4 μM (n = 5, Figure 2B).

Defining the current shortly before the application as 100%, the Imax was 197% for 80 μM HNTX-I and did not change with a higher concentration of 200 μM. After the application of 80 μM HNTX-I, NS309 still activated the current about 1.5-fold (Figure 3A). Figure 3B shows that 100 nM NS309 activated hIK1 channels in the presence of 80 μM HNTX-I. The EC50 value for NS309 was 30 nM using the hIK1 cell line [3]. After the initial equilibration period, HNTX-I was added at 80 μM to yield a higher current within ~3 min. Then, 100 nM NS309 was applied and reached the peak in under 1 min. Thus, the potency and kinetics of NS309 were not notably influenced by HNTX-I.

In general, hydrophobic and polar residue hot spots are important binding determinants in toxins and ion channel interactions. Studies of site-directed mutagenesis in VGSCs and their toxins have demonstrated that most of the toxins act at binding sites at the outer membrane ([10,11,12,13,14,15]). In our previous work, we have shown that HNTX-I inhibits VGSCs in both vertebrates and insects. HNTX-I should therefore present a similar type of interacting surface as other toxins whose binding sites are at the outer membrane. In our previous work, we have shown that such a basic profile has also been found in HNTX-I [9]. From these data, there is a strong possibility that HNTX-I exerts extracellular binding. On the contrary, the binding pocket for the compounds of the 1-EBIO class, which penetrates cells, is located at the calmodulin interface [16,17].

Toxins 06 02568 g001 1024
Figure 1. (A) Three-dimensional solution structure of hainantoxin-I (HNTX-I), PDB: 1N1X; (B) the effect of HNTX-I on whole cell currents obtained by voltage ramps applied to HEK293T cells expressing hIK1.

Click here to enlarge figure

Figure 1. (A) Three-dimensional solution structure of hainantoxin-I (HNTX-I), PDB: 1N1X; (B) the effect of HNTX-I on whole cell currents obtained by voltage ramps applied to HEK293T cells expressing hIK1.
Toxins 06 02568 g001 1024
Toxins 06 02568 g002 1024
Figure 2. (A) Dose- and time-dependency of HNTX-I-induced increase in hIK1 current. The current was measured at 0 mV and plotted as a function of time (15 s between each data point) (n = 5). HNTX-I (40 and 80 μM) was present in the bath solution during the periods indicated by the solid bars; (B) the dose-response curve for HNTX-I on hIK1 current. One hundred percent denotes the baseline current level at 300 nM free Ca2+ concentration. The points represent the mean ± S.E. (n = 5).

Click here to enlarge figure

Figure 2. (A) Dose- and time-dependency of HNTX-I-induced increase in hIK1 current. The current was measured at 0 mV and plotted as a function of time (15 s between each data point) (n = 5). HNTX-I (40 and 80 μM) was present in the bath solution during the periods indicated by the solid bars; (B) the dose-response curve for HNTX-I on hIK1 current. One hundred percent denotes the baseline current level at 300 nM free Ca2+ concentration. The points represent the mean ± S.E. (n = 5).
Toxins 06 02568 g002 1024
Toxins 06 02568 g003 1024
Figure 3. (A) The effect of NS309 (3-oxime-6,7-dichloro-1H-indole-2,3-dione) on whole cell currents in the presence of HNTX-I. HNTX-I activated IK channels at concentrations of 80 μM and 200 μM. NS309-modulated (100 nM NS309) IK channels co-treated with 80 and 200 μM HNTX-I; (B) The dose- and time-dependency of NS309 (100 nM) for the activation of hIK1 channels in the presence of HNTX-I (80 μM) (n = 5). The line represents the best fit to a standard Boltzmann equation with an EC50 value of 26.3 ± 0.4 μM (n = 5).

Click here to enlarge figure

Figure 3. (A) The effect of NS309 (3-oxime-6,7-dichloro-1H-indole-2,3-dione) on whole cell currents in the presence of HNTX-I. HNTX-I activated IK channels at concentrations of 80 μM and 200 μM. NS309-modulated (100 nM NS309) IK channels co-treated with 80 and 200 μM HNTX-I; (B) The dose- and time-dependency of NS309 (100 nM) for the activation of hIK1 channels in the presence of HNTX-I (80 μM) (n = 5). The line represents the best fit to a standard Boltzmann equation with an EC50 value of 26.3 ± 0.4 μM (n = 5).
Toxins 06 02568 g003 1024

2.2. HNTX-I Is a Highly Selective Activator of hIK1 Current

In contrast to HNTX-I, many small organic compounds block TTX-sensitive (TTX-S) Na+ channels, high-threshold voltage-dependent Ca2+ channels, delayed-rectifier K+ channels and hERG K+channels at submicromolar concentrations [3]. HNTX-I was characterized further to test its selectivity. In our previous work [9], HNTX-I has no effect on TTX-S Na+ channels and tetrodotoxin-resistant (TTX-R) Na+ channels. Figure 4 shows the effect of externally-applied HNTX-I on L-type Ca2+ channels (Figure 4A), T-type Ca2+ channels (Figure 4B) in dorsal root ganglia (DRG) and hERG K+ channels (Figure 4C) in HEK293T cells. At the highest test concentrations (100 μM), HNTX-I had no effect on or blocked TTX-S Na+ channels, by only 10% to 20%. In summary, the voltage-gated Ca2+ and the voltage-gated Na+ and hERG K+ channels in HEK293T cells were insensitive to HNTX-I, which is consistent with our previous data [9]. The hERG K+ channel has become a primary antitarget (i.e., an unwanted target) in drug development, because its blockade by drugs can lead to QT prolongation. A growing list of agents with “QT liability” has been withdrawn from the market or restricted in their use [18,19]. Currently, for promising drug candidates, integration of data from hERG K+ channels assays with information from other pre-clinical safety screens remains essential. For this reason, HNTX-I probably offers a novel, promising treatment alternative to cardiovascular disease drugs without permanent side effects and without the risk of multiple drug interactions. Small-conductance Ca2+-activated K+ (SK) and big-conductance Ca2+-activated K+ (BK) channels are structurally similar to IK channels; therefore, we tested the SK1 and BK channels. After application of 100 μM HNTX-I, only 35.2% ± 0.4% of the currents were activated in SK channels (n = 5, Figure 5A), and there was no effect on BK channels (Figure 5B). Based on its high selectivity, we used HNTX-I for subsequent experiments.

2.3. HNTX-I Has No Obvious Block on Phrenic Nerve Conduction in Mice

In control experiments with the preparations immersed in Tyrode’s solution, there was no significant change in the twitch responses within 4 h. HNTX-I (1 μM) did not inhibit the nerve-evoked twitch tension after a latent period of varying length. To demonstrate further that HNTX-I has little effect on phrenic nerve conduction, we examined the effects of the toxin at 10 and 100 μM concentrations, (n = 5), and there was still no apparent blockades in the twitch responses within 4 h. The results show that HNTX-I did not influence the neuromuscular transmission at doses of 100 μM or lower.

Toxins 06 02568 g004 1024
Figure 4. (A) 100 μM HNTX-I had no effect on voltage-gated L-type Ca2+ channels from rat dorsal root ganglia (DRG) (n = 5); (B) 100 μM HNTX-I had no effect on voltage-gated T-type Ca2+ channels from rat DRGs (n = 5); (C) 100 μM HNTX-I had no effect on hERG K+ channel in HEK293T cells (n = 5).

Click here to enlarge figure

Figure 4. (A) 100 μM HNTX-I had no effect on voltage-gated L-type Ca2+ channels from rat dorsal root ganglia (DRG) (n = 5); (B) 100 μM HNTX-I had no effect on voltage-gated T-type Ca2+ channels from rat DRGs (n = 5); (C) 100 μM HNTX-I had no effect on hERG K+ channel in HEK293T cells (n = 5).
Toxins 06 02568 g004 1024
Toxins 06 02568 g005 1024
Figure 5. (A) 100 μM HNTX-I only activated about 35.2% ± 0.4% of the currents of SK1 channels (n = 5); (B) 100 μM HNTX-I had no effect on BK channels (n = 5).

Click here to enlarge figure

Figure 5. (A) 100 μM HNTX-I only activated about 35.2% ± 0.4% of the currents of SK1 channels (n = 5); (B) 100 μM HNTX-I had no effect on BK channels (n = 5).
Toxins 06 02568 g005 1024

2.4. HNTX-I Is Nontoxic in an in vivo Toxicity Test

Mice injected intravenously with multiple doses of 0.5, 1.0, 1.5, 2.0 and 2.5 mg/kg HNTX-I (each doses of the toxin used in five mice) appeared clinically normal during the seven-day study. The behaviors of the HNTX-I-treated group were similar to the control mice injected with the vehicle. No aggressive behavior was directed towards another individual, and no aggressive/defensive responses were elicited. The pelage of the mice was not depilated. HNTX-I did not cause death at any concentration. We investigated the toxic effects of HNTX-I on American cockroach (Periplaneta americana). A large dose injection did not produce symptoms of poisoning. Collectively, data from these toxicity studies suggest that HNTX-I is not acutely toxic. HNTX-I has no obvious block on phrenic nerve conduction in mice and was safe in mice and American cockroaches. The remarkable specificity and pharmacological diversity of HNTX-I has made it a valuable source of lead molecules for drug discovery.

3. Experimental Section

3.1. Toxins

HNTX-I from adult female O. hainana spider venom was collected and purified by ion-exchange chromatography and reversed-phase high performance liquid chromatography (RP-HPLC), as described in our previous work [20]. The molecular mass was determined by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS).

3.2. Cells

Adult Sprague-Dawley rats of both species were euthanized by CO2 asphyxiation and decapitated. Dorsal root ganglia (DRG) neurons were harvested from the rat spinal cord and collected in Dulbecco’s modified Eagle’s medium, then treated with protease (20 U/mL; Sigma, St. Louis, MO, USA) for 20 min followed by collagenase (0.28 U/mL; Sigma, St. Louis, MO, USA) for 40 min. Neurons were dissociated in Ham’s F12 medium supplemented with 10% horse serum, penicillin (100 U/mL), streptomycin (100 μg/mL) and L-glutamine (3.0 mM). Cells were plated on glass coverslips coated with poly-L-lysine and maintained at 37 °C in a 95% O2, 5% CO2 incubator for 24 h before electrophysiological recordings [21].

The human embryonic kidney 293T (HEK293T) cells were maintained in Dulbecco’s modified Eagle’s medium, supplemented with 100 U/mL penicillin/streptomycin, 25 mM HEPES, 10% fetal bovine serum (GIBCO-Life Technologies, Carlsbad, CA, USA) and 3 mM taurine (Sigma-Aldrich, St. Louis, MO, USA) at 37 °C and 95% O2, 5% CO2. One day before transfection, HEK293T cells were plated on 35-mm dishes (Falcon Corning-IBD, Franklin Lakes, NJ, USA) and transiently transfected with Lipofectamine 2000 Transfection Reagent (Invitrogen-Life Technologies, Carlsbad, CA, USA) according to the manufacturer’s protocol using 1 μg of either hIK1 or other channel DNA and 0.5 μg EGFP-C1 DNA. After incubation for 4–6 h, cells were replated in 35-mm culture dishes. Transfected cells were used for experiments within 1 to 2 days after transfection [22].

3.3. Electrophysiology

Cells were studied in the whole cell configuration of the patch-clamp technique using an EPC-10 amplifier and the Pulse program (HEKA Electronics, Mahone Bay, NS, Canada). Patch pipettes fabricated from borosilicate glass tubes using a P-97 puller (Sutter Instruments, Novato, CA, USA) were pulled to a resistance of 2.0–2.9 MΩ after heat-polishing. Membrane currents were usually filtered at 5 kHz and sampled at 20 kHz. Voltage errors were minimized using 60%–80% series-resistance compensation, and the capacitance artifact was canceled using the amplifier circuitry. Since leak currents were relatively small and can be a nonlinear function of voltage, no electronic compensation for the voltage-dependent leak current was used [23].

The holding potential in all experiments was −90 mV. For measurement of IK and SK1 currents, we used an internal pipette solution containing (in mM): 144 KCl, 10 EGTA, 7.6 CaCl2, 1.2 MgCl2 and 10 HEPES (0.3d 10 HEPES2+ and 1 mM free Mg2+), pH 7.2, 290–310 mOsm. The extracellular solution had the following composition (in mM): 140 NaCl, 4 KCl, 0.1 CaCl2, 3 MgCl2 and 10 HEPES (pH = 7.4), 290–310 mOsm [3]. IK and SK1 currents in HEK293T cells were elicited by 200-ms voltage ramps from −120 mV to 40 mV applied every 5 s, and the currents were measured at 0 mV. The BK channels were transiently expressed in HEK293T cells and studied with a pipette solution containing (in mM): 140 Mes, 160 KOH, 10 HEPES, 3.25 Ca(Mes)2, 3.25 CaCl2, pH 7.0, 290–310 mOsm; the bath solution contained (in mM): 140 Mes, 160 KOH, 2 MgCl2, 10 HEPES, pH 7.0, 290–310 mOsm. IK and SK1 currents in HEK293T cells were elicited by the 200-ms depolarized potential of 30 mV. The TTX-S voltage-gated Na+ channels on DRG neurons were studied with an internal pipette solution containing (in mM): 145 CsCl, 4 MgCl2, 10 HEPES, 10 EGTA, 10 glucose, 2 ATP (pH 7.2), 290–310 mOsm; and the bath solution contained (in mM): 145 NaCl, 2.5 KCl, 1.5 CaCl2, 1.2 MgCl2, 10 HEPES, 10 glucose (pH 7.4), 290–310 mOsm. Tetrodotoxin (TTX; 0.5TX) was added to the bath solution when recording TTX-R channels. The clones of hERG K+ channel were transiently expressed in HEK293T cells and studied with a pipette solution containing (in mM): 140 KCl, 10 HEPES, 5 EGTA, 5 ATP-Mg, and 1 MgCl2 (pH 7.2), 290–310 mOsm; the bath solution contained (in mM): 160 NaCl, 2.5 KCl, 2 CaCl2, 1 MgCl2, 10 HEPES, 10 glucose (pH 7.4), 290–310 mOsm. For hERG K+ channels recording, the currents were evoked by a 200-ms depolarized potential of 30 mV, and the reduction of the current amplitude was taken as the measure of channel blocking. Ca2+ channel currents from DRGs were recorded with a 200-ms depolarizing pulse of 10 mV with a pipette solution containing (in mM): 110 Cs-methane sulfonate, 14 phosphocreatine, 10 HEPES, 10 EGTA, 5 ATP-Mg (pH 7.4); and the external solution contained (in mM): 10 BaCl2, 125 tetraethylammonium (TEA)-Cl, 0.3 TTX and 10 HEPES (pH 7.4). For all currents elicited by voltage ramps, series resistance was not used. For calculation of EC50 values, data points were fitted using the Boltzmann equation: y = A2 + (A1A2)/1 + e(xx0)/dx.

3.4. Blocked Studies of Phrenic Nerve Conduction

The twitch-tension experiments were performed using mouse phrenic nerve-diaphragm preparations. Adult Kunming albino mice (18–22 g of either gender) were killed by cervical dislocation. After dissection, the preparations were placed in a Plexiglas chamber immersed in Tyrode’s solution or toxin solutions continuously bubbled with 95% O2, 5% CO2 and maintained at 30–32 °C. The electrical stimulation was applied indirectly to the phrenic nerve with a suction electrode at 0.2 Hz with pulses of 0.2 ms in duration and supramaximally. For direct stimulation, the muscle was stimulated at a frequency of 0.2 Hz (supramaximal, 2 ms, square wave). A mechanical-electric transducer made of a semiconductor strain gauge was used to transform the twitch responses into electric signals. The signals were amplified with a preamplifier (BL-420S, Chengdu, Sichuan, China) and the output from the preamplifier was instantly measured and displayed by a computer, which, in turn, creates a real-time picture on the monitor [24,25]. The time from the application of HNTX-I to complete blocking of neuromuscular transmission was defined as blocking time, and the concentrations of HNTX-I we used were 1 μM, 10 μM and 100 μM.

3.5. Acute in vivo Toxicity Determinations

Five mice (17–19 g) were injected intravenously with multiple 1.0-mL doses of 0.5–2.5 mg/kg HNTX-I (in mammalian Ringer solution with 1% ethanol and 2.5% BSA). Five control mice were injected with an equal volume of the vehicle. The toxicity of HNTX-I was qualitatively assayed by intra-abdominal injection into adult male cockroaches (Periplaneta) with body weights of 0.8–1.2 g at doses of 50–250 μg/g using 10-μL solutions (in 0.85% (w/v) normal saline). Mice and cockroaches were observed for adverse effects immediately after dosing, at 4 h after injection and daily for 7 days.

3.6. Statistics

Data are given as the mean ± SEM. Data sets were compared using one-way analysis of variance (ANOVA) and a paired two-tailed Student’s t-test if appropriate. p-values of <0.05 were considered statistically significant.

4. Conclusions

Many studies in animals and even clinical studies have shown that decreased IK-channel activity is associated with endothelial dysfunction in cardiovascular diseases. Endothelium-dependent vasodilatation is mediated by nitric oxide (NO), prostacyclin and an endothelium-derived hyperpolarizing factor (EDHF), and it involves IK channels [5]. Endothelial dysfunction is reflected by blunted vasodilatation, and thus, opening of IK channels can increase both EDHF- and NO-mediated vasodilatation. Therefore, activator IK channels may have the potential to improve endothelial cell functions and be drug targets for the treatment of endothelial dysfunction in cardiovascular disease. Chemicals modulating IK-channel function fall into two general categories: organic small molecules and venom-derived peptides. Small organic activators, although known to exert potent pharmacological effects, have been previously described to exert non-specific actions at higher concentrations. Venom-derived peptides have proven to be useful pharmacological tools for high potency and specificity [6]. Unfortunately, to date, no peptides activating IK channels have been identified.

In the present study, we investigated HNTX-I, which is the first selective peptide activator of IK channels. In a screening program for activity, HNTX-I activated the IK channels with an EC50 value of 26.3 ± 0.4 μM, which demonstrated a new positive modulator of IK channels. HNTX-I plays its full part without any distinct influence on NS309 affinity, indicating that the binding sites of these two compounds for activation may be different. In addition to this, HNTX-I had no effect on or blocked voltage-gated Na+, K+ and Ca2+ channels by only 10% to 20% at a concentration of 100 μM. HNTX-I had no effect on hERG K+ channels.

The standard reference compounds, NS309 and DC-EBIO, have low potency and lack of selectivity, hindering their potential for clinical use. A key contributing factor is the lack of structural information about IK channels. However, the NMR solution structure of HNTX-I has been deposited in the PDB. Therefore, the 3D structure of HNTX-I provides important clues to its peptide-channel interaction. For this reason, with its great selectivity, HNTX-I is not just a promising pharmacological tool for new drug design, but it may also prove to be useful for gaining structural information about the IK channel protein itself and continue to be used widely to study IK channel gating.


We are grateful to Zhonghua Liu for his advice on this manuscript. This work was supported by the National 973 Project of China under contract (No. 2009CB526510, 2010CB529800 and 2012CB22305), the National Natural Science Foundation of China under contract (No. 31271257), the Scientific Research Fund of Hunan Provincial Education Department (13B087), the Opening Fund of Key Laboratory of Protein Chemistry and Developmental Biology of the Ministry of Education, Hunan Normal University (DF1104), and the Cooperative Innovation Center of Engineering and New Products for Developmental Biology of Hunan Province (20134486).

Author Contributions

Songping Liang and Pengfei Huang designed the appropriate technology routes. Pengfei Huang and Yiya Zhang conducted main experiments. Xinyi Chen and Li Zhu participated in whole-cell patch clamp. Xiongzhi Zeng and Dazhong Yin supervised the project and wrote the paper. All authors read and approved the final manuscript.

Conflicts of Interest

The authors declare no conflict of interest.


  1. Wei, A.D.; Gutman, G.A.; Aldrich, R.; Chandy, K.G.; Grissmer, S.; Wulff, H. International union of pharmacology. Lii. Nomenclature and molecular relationships of calcium-activated potassium channels. Pharmacol. Rev. 2005, 57, 463–472. [Google Scholar]
  2. Ishii, T.M.; Silvia, C.; Hirschberg, B.; Bond, C.T.; Adelman, J.P.; Maylie, J. A human intermediate conductance calcium-activated potassium channel. Proc. Natl. Acad. Sci. USA 1997, 94, 11651–11656. [Google Scholar] [PubMed]
  3. Strobaek, D.; Teuber, L.; Jorgensen, T.D.; Ahring, P.K.; Kjaer, K.; Hansen, R.S.; Olesen, S.P.; Christophersen, P.; Skaaning-Jensen, B. Activation of human IK and SK Ca2+-activated K+ channels by NS309 (6,7-dichloro-1h-indole-2,3-dione 3-oxime). Biochim. Biophys. Acta 2004, 1665, 1–5. [Google Scholar]
  4. Singh, S.; Syme, C.A.; Singh, A.K.; Devor, D.C.; Bridges, R.J. Benzimidazolone activators of chloride secretion: Potential therapeutics for cystic fibrosis and chronic obstructive pulmonary disease. J. Pharmacol. Exp. Ther. 2001, 296, 600–611. [Google Scholar] [PubMed]
  5. Dalsgaard, T.; Kroigaard, C.; Simonsen, U. Calcium-activated potassium channels—A therapeutic target for modulating nitric oxide in cardiovascular disease? Expert Opin. Ther. Targets 2010, 14, 825–837. [Google Scholar]
  6. Wulff, H.; Zhorov, B.S. K+ channel modulators for the treatment of neurological disorders and autoimmune diseases. Chem. Rev. 2008, 108, 1744–1773. [Google Scholar] [CrossRef] [PubMed]
  7. Morimura, K.; Yamamura, H.; Ohya, S.; Imaizumi, Y. Voltage-dependent Ca2+-channel block by openers of intermediate and small conductance Ca2+-activated K+ channels in urinary bladder smooth muscle cells. J. Pharmacol. Sci. 2006, 100, 237–241. [Google Scholar] [PubMed]
  8. Grgic, I.; Kaistha, B.P.; Hoyer, J.; Kohler, R. Endothelial Ca+-activated K+ channels in normal and impaired edhf-dilator responses—Relevance to cardiovascular pathologies and drug discovery. Br. J. Pharmacol. 2009, 157, 509–526. [Google Scholar] [PubMed]
  9. Li, D.; Xiao, Y.; Hu, W.; Xie, J.; Bosmans, F.; Tytgat, J.; Liang, S. Function and solution structure of hainantoxin-I, a novel insect sodium channel inhibitor from the chinese bird spider Selenocosmia hainana. FEBS Lett. 2003, 555, 616–622. [Google Scholar] [CrossRef] [PubMed]
  10. Cestele, S.; Catterall, W.A. Molecular mechanisms of neurotoxin action on voltage-gated sodium channels. Biochimie 2000, 82, 883–892. [Google Scholar] [CrossRef] [PubMed]
  11. Cummins, T.R.; Aglieco, F.; Dib-Hajj, S.D. Critical molecular determinants of voltage-gated sodium channel sensitivity to mu-conotoxins GIIIA/B. Mol. Pharmacol. 2002, 61, 1192–1201. [Google Scholar] [PubMed]
  12. Hui, K.; Lipkind, G.; Fozzard, H.A.; French, R.J. Electrostatic and steric contributions to block of the skeletal muscle sodium channel by mu-conotoxin. J. Gen. Physiol. 2002, 119, 45–54. [Google Scholar] [CrossRef] [PubMed]
  13. Li, R.A.; Sato, K.; Kodama, K.; Kohno, T.; Xue, T.; Tomaselli, G.F.; Marban, E. Charge conversion enables quantification of the proximity between a normally-neutral mu-conotoxin (GIIIA) site and the Na+ channel pore. FEBS Lett. 2002, 511, 159–164. [Google Scholar] [PubMed]
  14. Terlau, H.; Heinemann, S.H.; Stuhmer, W.; Pusch, M.; Conti, F.; Imoto, K.; Numa, S. Mapping the site of block by tetrodotoxin and saxitoxin of sodium channel II. FEBS Lett. 1991, 293, 93–96. [Google Scholar] [CrossRef] [PubMed]
  15. Wakamatsu, K.; Kohda, D.; Hatanaka, H.; Lancelin, J.M.; Ishida, Y.; Oya, M.; Nakamura, H.; Inagaki, F.; Sato, K. Structure-activity relationships of mu-conotoxin GIIIA: Structure determination of active and inactive sodium channel blocker peptides by nmr and simulated annealing calculations. Biochemistry 1992, 31, 12577–12584. [Google Scholar] [CrossRef] [PubMed]
  16. Zhang, M.; Pascal, J.M.; Schumann, M.; Armen, R.S.; Zhang, J.F. Identification of the functional binding pocket for compounds targeting small-conductance Ca2+-activated potassium channels. Nat. Commun. 2012, 3, 1021. [Google Scholar] [CrossRef] [PubMed]
  17. Zhang, M.; Pascal, J.M.; Zhang, J.F. Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation. Proc. Natl. Acad. Sci. USA 2013, 110, 4828–4833. [Google Scholar] [CrossRef] [PubMed]
  18. Hancox, J.C.; McPate, M.J.; El Harchi, A.; Zhang, Y.H. The herg potassium channel and herg screening for drug-induced torsades de pointes. Pharmacol. Ther. 2008, 119, 118–132. [Google Scholar] [CrossRef] [PubMed]
  19. Raschi, E.; Vasina, V.; Poluzzi, E.; De Ponti, F. The herg K+ channel: Target and antitarget strategies in drug development. Pharmacol. Res. 2008, 57, 181–195. [Google Scholar] [CrossRef] [PubMed]
  20. Liu, Z.; Dai, J.; Chen, Z.; Hu, W.; Xiao, Y.; Liang, S. Isolation and characterization of hainantoxin-IV, a novel antagonist of tetrodotoxin-sensitive sodium channels from the chinese bird spider Selenocosmia hainana. Cell. Mol. Life Sci. 2003, 60, 972–978. [Google Scholar] [CrossRef] [PubMed]
  21. Bosmans, F.; Rash, L.; Zhu, S.; Diochot, S.; Lazdunski, M.; Escoubas, P.; Tytgat, J. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol. Pharmacol. 2006, 69, 419–429. [Google Scholar] [CrossRef] [PubMed]
  22. Struyk, A.F.; Scoggan, K.A.; Bulman, D.E.; Cannon, S.C. The human skeletal muscle Na channel mutation R669H associated with hypokalemic periodic paralysis enhances slow inactivation. J. Neurosci. 2000, 20, 8610–8617. [Google Scholar] [PubMed]
  23. Rowe, A.H.; Xiao, Y.; Rowe, M.P.; Cummins, T.R.; Zakon, H.H. Voltage-gated sodium channel in grasshopper mice defends against bark scorpion toxin. Science 2013, 342, 441–446. [Google Scholar] [CrossRef] [PubMed]
  24. Liang, S.P.; Zhang, D.Y.; Pan, X.; Chen, Q.; Zhou, P.A. Properties and amino acid sequence of huwentoxin-I, a neurotoxin purified from the venom of the chinese bird spider Selenocosmia huwena. Toxicon 1993, 31, 969–978. [Google Scholar] [CrossRef] [PubMed]
  25. Zhou, P.A.; Xie, X.J.; Li, M.; Yang, D.M.; Xie, Z.P.; Zong, X.; Liang, S.P. Blockade of neuromuscular transmission by huwentoxin-i, purified from the venom of the chinese bird spider Selenocosmia huwena. Toxicon 1997, 35, 39–45. [Google Scholar] [CrossRef] [PubMed]
Toxins EISSN 2072-6651 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of Contents Alert