Next Article in Journal
Diarrhetic Shellfish Toxins and Other Lipophilic Toxins of Human Health Concern in Washington State
Previous Article in Journal
The Promoting Effect of Ishige sinicola on Hair Growth
Mar. Drugs 2013, 11(6), 1800-1814; doi:10.3390/md11061800

A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

, 2,†,* , 3
, 1
, 1
, 2
 and 1,2
Received: 4 March 2013 / Revised: 22 April 2013 / Accepted: 8 May 2013 / Published: 24 May 2013
View Full-Text   |   Download PDF [683 KB, uploaded 24 May 2013]   |   Browse Figures
Abstract: A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.
Keywords: Arca subcrenata; peptide; antiproliferative activity; antioxidant activity Arca subcrenata; peptide; antiproliferative activity; antioxidant activity
This is an open access article distributed under the Creative Commons Attribution License which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Export to BibTeX |

MDPI and ACS Style

Chen, L.; Song, L.; Li, T.; Zhu, J.; Xu, J.; Zheng, Q.; Yu, R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Mar. Drugs 2013, 11, 1800-1814.

AMA Style

Chen L, Song L, Li T, Zhu J, Xu J, Zheng Q, Yu R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Marine Drugs. 2013; 11(6):1800-1814.

Chicago/Turabian Style

Chen, Lili; Song, Liyan; Li, Tingfei; Zhu, Jianhua; Xu, Jian; Zheng, Qin; Yu, Rongmin. 2013. "A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata." Mar. Drugs 11, no. 6: 1800-1814.

Mar. Drugs EISSN 1660-3397 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of Contents Alert