Mar. Drugs 2013, 11(6), 1800-1814; doi:10.3390/md11061800
Article

A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

1,†email, 2,†,* email, 3email, 1email, 1email, 2email and 1,2email
1 Biotechnological Institute of Chinese Materia Medica, Jinan University, Guangzhou 510632, China 2 College of Pharmacy, Jinan University, Guangzhou 510632, China 3 Guangdong Food and Drug Vocational-Technical School, Guangzhou 510663, China These authors contributed equally to this work.
* Author to whom correspondence should be addressed.
Received: 4 March 2013; in revised form: 22 April 2013 / Accepted: 8 May 2013 / Published: 24 May 2013
PDF Full-text Download PDF Full-Text [683 KB, uploaded 24 May 2013 14:28 CEST]
Abstract: A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.
Keywords: Arca subcrenata; peptide; antiproliferative activity; antioxidant activity

Article Statistics

Load and display the download statistics.

Citations to this Article

Cite This Article

MDPI and ACS Style

Chen, L.; Song, L.; Li, T.; Zhu, J.; Xu, J.; Zheng, Q.; Yu, R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Mar. Drugs 2013, 11, 1800-1814.

AMA Style

Chen L, Song L, Li T, Zhu J, Xu J, Zheng Q, Yu R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Marine Drugs. 2013; 11(6):1800-1814.

Chicago/Turabian Style

Chen, Lili; Song, Liyan; Li, Tingfei; Zhu, Jianhua; Xu, Jian; Zheng, Qin; Yu, Rongmin. 2013. "A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata." Mar. Drugs 11, no. 6: 1800-1814.

Mar. Drugs EISSN 1660-3397 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of Contents Alert