Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

Al-Zamel, Noura; Al-Sabah, Suleiman; Luqmani, Yunus; Adi, Lobna; Chacko, Siby; Schneider, Tom Dario; Krasel, Cornelius

doi:10.3390/ijms21093357

Open AccessCorrection

Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

¹

Department of Pharmacology & Toxicology, Faculty of Medicine, Kuwait University, PO Box 24923, 13110 Safat, Kuwait

²

Department of Pharmaceutical Chemistry, Faculty of Pharmacy, Kuwait University, PO Box 24923, 13110 Safat, Kuwait

³

Institute of Forensic Medicine, Department of Forensic Pharmacology and Toxicology, University of Zurich, 190/52 CH-8057 Zurich, Switzerland

⁴

School of Pharmacy, Institute for Pharmacology and Toxicology, The Philipps University of Marburg, Karl-von-Frisch-Straße, 135033 Marburg, Germany

^*

Author to whom correspondence should be addressed.

Int. J. Mol. Sci. 2020, 21(9), 3357; https://doi.org/10.3390/ijms21093357

Submission received: 7 May 2020 / Accepted: 7 May 2020 / Published: 9 May 2020

Download Versions Notes

The author wishes to make the following correction to this paper [1]. Due to mislabeling, replace: Ijms 21 03357 i001

with

There is an error in the peptide sequence of GIP in Figure 1. Two amino acid residues are missing. The correct sequence for GIP is: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ. The authors would like to apologize for any inconvenience caused to the readers by these changes.

References

Al-Zamel, N.; Al-Sabah, S.; Luqmani, Y.; Adi, L.; Chacko, S.; Schneider, T.D.; Krasel, C. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. [Google Scholar] [CrossRef] [PubMed] [Green Version]

© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).

Share and Cite

MDPI and ACS Style

Al-Zamel, N.; Al-Sabah, S.; Luqmani, Y.; Adi, L.; Chacko, S.; Schneider, T.D.; Krasel, C. Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. Int. J. Mol. Sci. 2020, 21, 3357. https://doi.org/10.3390/ijms21093357

AMA Style

Al-Zamel N, Al-Sabah S, Luqmani Y, Adi L, Chacko S, Schneider TD, Krasel C. Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. International Journal of Molecular Sciences. 2020; 21(9):3357. https://doi.org/10.3390/ijms21093357

Chicago/Turabian Style

Al-Zamel, Noura, Suleiman Al-Sabah, Yunus Luqmani, Lobna Adi, Siby Chacko, Tom Dario Schneider, and Cornelius Krasel. 2020. "Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532." International Journal of Molecular Sciences 21, no. 9: 3357. https://doi.org/10.3390/ijms21093357

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Menu

Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

References

Share and Cite

Article Metrics

Article Access Statistics

Further Information

Guidelines

MDPI Initiatives

Follow MDPI