Summary

1. Notes


2. Result Statistics

Figure 1. False discovery rate (FDR) curve. X axis is the number of peptide-spectrum matches (PSM) being kept. Y axis is the corresponding FDR.



Figure 2. PSM score distribution. (a) Distribution of PEAKS peptide score; (b) Scatterplot of PEAKS peptide score versus precursor mass error.

(a)
(b)
Table 1. Statistics of data.
#Scans#FeaturesIdentified#Peptides#Sequences#Proteins*
MS1MS2#PSMs#Scans#FeaturesGroupsAllTop
Total1244980019113530418537761422162560182590347
BRom1244980019113530418537761422162560182590347
* proteins with significant peptides are used in counts.

Figure 3. Sample overlap for Proteins and Peptides (up to 8 samples). (a) All Proteins; (b) Top Proteins; (c) Peptides;

(a)
Not applicable to only one sample
(b)
Not applicable to only one sample
(c)
Not applicable to only one sample

Figure 4. Distribution of peptide feature detection. (a) Feature m/z distribution; (b) Feature RT distribution.

(a)
(b)

Figure 5. Distribution of identified peptide features. (a) Feature abundance distribution; (b) De novo sequencing validation.

(a)
(b)
Table 2. Result filtration parameters.
Peptide -10lgP≥39.2
PTM Ascore≥0
Protein -10lgP≥20
Proteins unique peptides≥1
De novo score(%)≥50%
Table 3. Statistics of filtered result.
FDR (Peptide-Spectrum Matches)0.1%
FDR (Peptide Sequences)0.6%
FDR (Protein Group)4.9%
De Novo Only Spectra29088
Table 4. PTM profile.
Name ∆Mass Position #PSM -10lgP Abundance AScore
Carbamidomethyl57.02C317197.961.64E81000.00
Oxidation15.99M15182.391.29E81000.00

3. Experiment Control

Figure 6. Precursor mass error of peptide-spectrum matches (PSM) in filtered result. (a) Distribution of precursor mass error in ppm; (b) Scatterplot of precursor m/z versus precursor mass error in ppm.

(a)
(b)

Table 5. Number of identified peptides in each sample by the number of missed cleavages.

Missed Cleavages01234+
BRom23123316100

4. Other Information

Table 6. Search parameters.
Search Engine Name: PEAKS
Parent Mass Error Tolerance: 10.0 ppm
Fragment Mass Error Tolerance: 0.6 Da
Precursor Mass Search Type: monoisotopic
Enzyme: Trypsin
Max Missed Cleavages: 2
Digest Mode: Semispecific
Fixed Modifications:
  Carbamidomethylation: 57.02
Variable Modifications:
  Oxidation (M): 15.99
Max Variable PTM Per Peptide: 3
Database: NCBI_Serpentes_BRom
Taxon: All
Contaminant Database: cRAP_contaminants
Searched Entry: 410203
FDR Estimation: Enabled
Merge Options: no merge
Precursor Options: corrected
Charge Options: no correction
Filter Charge: 2 - 8
Process: true
Associate chimera: yes
Table 7. Instrument parameters.
Fractions: 01122020_RID_2209_BuCaKA02.raw
Ion Source: ESI(nano-spray)
Fragmentation Mode: CID, CAD(y and b ions)
MS Scan Mode: FT-ICR/Orbitrap
MS/MS Scan Mode: FT-ICR/Orbitrap

Protein List

Protein Accession Contains:
Protein Description Contains:
Protein Sample Area >=
Protein PTM Contains:
Protein Group Protein ID Accession -10lgP Coverage (%) Coverage (%) BRom Area BRom #Peptides #Unique #Spec BRom PTM Avg. Mass Description
6 2 T_61 391.12 47 47 8.7342E10 60 45 258 Y 63952 T_61
6 3 T_55 391.12 46 46 8.7342E10 60 45 258 Y 64771 T_55
6 4 T_59 391.12 46 46 8.7342E10 60 45 258 Y 64771 T_59
6 5 T_58 391.12 46 46 8.7342E10 60 45 258 Y 64771 T_58
6 6 T_60 391.12 46 46 8.7342E10 60 45 258 Y 64771 T_60
10 12 T_46 364.17 32 32 9.2239E9 48 8 220 Y 66303 T_46
20 1 T_35 343.67 53 53 1.259E9 35 28 70 Y 64644 T_35
16 30 T_114 337.39 100 100 2.868E9 36 9 109 Y 11178 T_114
18 13 T_111 334.73 45 45 5.192E8 32 13 72 Y 54357 T_111
1 31 T_113 331.88 81 81 1.081E11 41 15 934 Y 11386 T_113
9 35 T_115 328.36 81 81 2.795E10 37 15 186 Y 11316 T_115
3 45 T_18 322.68 50 50 6.5104E10 30 4 398 Y 19178 T_18
13 48 T_24 312.93 67 67 4.1932E10 27 19 154 Y 13522 T_24
14 49 Q8QFW4.1 306.09 68 68 8.6489E9 24 17 173 Y 16358 RecName: Full=Basic phospholipase A2 beta-bungarotoxin A1 chain; Short=Beta-BuTX A1 chain; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
14 50 AAL87003.1 306.09 68 68 8.6489E9 24 17 173 Y 16358 beta-bungarotoxin A chain precursor [Bungarus caeruleus]
12 72 T_148 300.21 38 38 1.0136E10 23 23 195 Y 15865 T_148
4 71 ABG90492.1 289.92 52 52 2.4407E8 21 1 298 Y 13164 beta-bungarotoxin A8 chain, partial [Bungarus multicinctus]
21 88 T_26 278.54 44 44 1.4514E9 17 2 56 Y 14060 T_26
8 130 T_1 274.40 65 65 1.0272E11 16 16 253 Y 9903 T_1
19 43 Q8QFW3.1 269.83 51 51 1.3486E10 18 7 70 Y 16120 RecName: Full=Basic phospholipase A2 beta-bungarotoxin A2 chain; Short=Beta-BuTX A2 chain; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
19 44 AAL87004.1 269.83 51 51 1.3486E10 18 7 70 Y 16120 beta-bungarotoxin A2 chain precursor [Bungarus caeruleus]
25 52 JAA74736.1 262.34 21 21 4.0747E6 11 1 39 Y 60425 ACN-Den-1, partial [Denisonia devisi]
36 59 T_84 239.39 36 36 5.1117E8 15 13 24 N 21916 T_84
26 61 ABN72539.1 232.45 24 24 2.1472E8 12 2 38 Y 58811 L-amino acid oxidase [Bungarus multicinctus]
26 62 A8QL51.1 232.45 24 24 2.1472E8 12 2 38 Y 58811 RecName: Full=L-amino-acid oxidase; Short=Bm-LAAO; Short=LAO; Flags: Precursor
39 800 ABU63164.1 226.51 15 15 5.6303E8 8 2 19 Y 15950 phospholipase A2 precursor BF-40 [Bungarus fasciatus]
39 802 ABU63166.1 226.51 15 15 5.6303E8 8 2 19 Y 16004 phospholipase A2 precursor BF-42 [Bungarus fasciatus]
31 36 T_134 222.97 34 34 1.3852E9 13 3 31 Y 47274 T_134
31 37 T_137 222.97 34 34 1.3852E9 13 3 31 Y 47274 T_137
31 38 T_130 222.97 34 34 1.3852E9 13 3 31 Y 47274 T_130
27 46 T_22 221.41 51 51 3.9964E10 9 6 25 Y 19316 T_22
27 47 T_23 221.41 51 51 3.9964E10 9 6 25 Y 19364 T_23
32 213 XP_026570824.1 220.81 37 37 1.0003E9 7 7 29 N 15616 hemoglobin subunit alpha [Pseudonaja textilis]
33 184 T_3 211.53 71 71 4.116E9 9 9 22 Y 9828 T_3
34 135 XP_026548868.1 207.69 43 43 2.9266E8 13 6 26 Y 16270 hemoglobin subunit beta-1 [Notechis scutatus]
22 239 T_141 201.08 35 35 3.1355E10 11 8 47 Y 14129 T_141
22 240 T_140 201.08 29 29 3.1355E10 11 8 47 Y 17021 T_140
17 804 1PO8 199.58 19 19 3.5918E10 9 5 75 Y 13201 Chain A, Phospholipase A2
17 805 1TC8 199.58 19 19 3.5918E10 9 5 75 Y 13201 Chain A, Phospholipase A2 Isoform 1
17 806 AAS20530.1 199.58 16 16 3.5918E10 9 5 75 Y 15058 phospholipase A2 isoform 1, partial [Bungarus caeruleus]
17 807 Q6SLM2.1 199.58 16 16 3.5918E10 9 5 75 Y 15058 RecName: Full=Acidic phospholipase A2 1; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
41 231 XP_026555558.1 189.93 10 10 7.5733E8 9 9 13 Y 61349 hepatocyte growth factor activator [Pseudonaja textilis]
2 394 T_15 188.15 39 39 3.1068E10 7 6 499 Y 10070 T_15
40 87 T_19 186.46 43 43 2.4096E8 8 4 13 Y 20104 T_19
49 247 XP_034286707.1 185.07 7 7 0 8 1 12 Y 64689 acetylcholinesterase isoform X3 [Pantherophis guttatus]
49 248 XP_034286706.1 185.07 7 7 0 8 1 12 Y 68560 acetylcholinesterase isoform X2 [Pantherophis guttatus]
49 249 XP_034286705.1 185.07 7 7 0 8 1 12 Y 68691 acetylcholinesterase isoform X1 [Pantherophis guttatus]
46 379 T_2 182.89 38 38 9.7681E8 6 6 15 Y 9840 T_2
44 69 T_21 182.71 47 47 0 8 1 11 Y 20086 T_21
38 86 LAA65154.1 182.69 47 47 0 8 1 16 Y 12644 hypothetical protein [Micrurus corallinus]
42 81 T_43 180.60 33 33 2.855E9 7 5 17 Y 37263 T_43
37 85 T_142 179.26 48 48 8.1278E8 8 8 16 Y 17070 T_142
35 372 T_64 178.85 36 36 4.8443E8 9 9 20 Y 16469 T_64
35 373 T_65 178.85 36 36 4.8443E8 9 9 20 Y 16469 T_65
35 374 T_68 178.85 36 36 4.8443E8 9 9 20 Y 16469 T_68
35 375 T_66 178.85 34 34 4.8443E8 9 9 20 Y 17239 T_66
35 376 T_63 178.85 27 27 4.8443E8 9 9 20 Y 22360 T_63
35 377 T_67 178.85 27 27 4.8443E8 9 9 20 Y 22360 T_67
59 131 ETE71045.1 168.06 62 62 2.1386E7 6 6 6 Y 11903 hypothetical protein L345_03149, partial [Ophiophagus hannah]
63 102 XP_026559591.1 163.42 25 25 5.184E7 5 5 5 Y 38486 annexin A1 [Pseudonaja textilis]
63 103 XP_026559592.1 163.42 25 25 5.184E7 5 5 5 Y 38486 annexin A1 [Pseudonaja textilis]
53 158 0412250A 142.26 32 32 0 4 1 8 Y 13489 toxin A,beta1 bungaro
53 168 0402253A 142.26 32 32 0 4 1 8 Y 13561 toxin RCM A,beta1 bungaro
58 148 T_105 140.27 44 44 3.8676E6 4 1 5 Y 11193 T_105
55 359 T_33 138.09 29 29 1.8382E8 2 2 8 Y 11247 T_33
56 113 T_79 137.59 27 27 5.2864E7 5 5 7 Y 32628 T_79
56 114 T_75 137.59 19 19 5.2864E7 5 5 7 Y 47592 T_75
56 115 T_76 137.59 19 19 5.2864E7 5 5 7 Y 47592 T_76
54 303 XP_026542555.1 135.98 6 6 8.5801E7 4 4 9 Y 53135 multiple inositol polyphosphate phosphatase 1 isoform X2 [Notechis scutatus]
54 304 XP_026542553.1 135.98 6 6 8.5801E7 4 4 9 Y 53549 multiple inositol polyphosphate phosphatase 1 isoform X1 [Notechis scutatus]
64 672 ETE60521.1 134.32 6 6 2.1746E7 4 4 5 Y 48759 hypothetical protein L345_13731, partial [Ophiophagus hannah]
64 896 XP_026580631.1 134.32 23 23 2.1746E7 4 4 5 Y 11919 protein S100-A11-like [Pseudonaja textilis]
64 897 XP_026580634.1 134.32 23 23 2.1746E7 4 4 5 Y 11919 protein S100-A11-like [Pseudonaja textilis]
64 898 JAB53385.1 134.32 23 23 2.1746E7 4 4 5 Y 11921 protein S100-A11 [Micrurus fulvius]
64 899 XP_026580630.1 134.32 23 23 2.1746E7 4 4 5 Y 11919 protein S100-A11-like [Pseudonaja textilis]
64 900 XP_026580635.1 134.32 23 23 2.1746E7 4 4 5 Y 11919 protein S100-A11-like [Pseudonaja textilis]
61 211 XP_026555793.1 134.12 19 19 2.321E8 3 3 6 Y 34167 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like [Pseudonaja textilis]
69 317 XP_032087784.1 118.39 8 8 1.5375E6 3 1 3 N 54267 multiple inositol polyphosphate phosphatase 1 [Thamnophis elegans]
69 455 XP_013925207.1 118.39 11 11 1.5375E6 3 1 3 N 39926 PREDICTED: multiple inositol polyphosphate phosphatase 1 [Thamnophis sirtalis]
70 545 XP_025032622.1 115.41 3 3 6.7052E6 3 1 4 N 67497 acetylcholinesterase isoform X2 [Python bivittatus]
70 546 XP_025032620.1 115.41 3 3 6.7052E6 3 1 4 N 67497 acetylcholinesterase isoform X2 [Python bivittatus]
70 547 XP_025032621.1 115.41 3 3 6.7052E6 3 1 4 N 67497 acetylcholinesterase isoform X2 [Python bivittatus]
70 548 JAC94932.1 115.41 3 3 6.7052E6 3 1 4 N 69041 Acetylcholinesterase transcript 2 [Python regius]
70 549 XP_025032619.1 115.41 3 3 6.7052E6 3 1 4 N 72046 acetylcholinesterase isoform X1 [Python bivittatus]
80 302 ETE64512.1 109.22 3 3 9.6843E6 2 2 2 Y 105984 Golgi apparatus protein 1, partial [Ophiophagus hannah]
80 305 XP_015667558.1 109.22 3 3 9.6843E6 2 2 2 Y 118841 Golgi apparatus protein 1, partial [Protobothrops mucrosquamatus]
80 309 XP_032086218.1 109.22 3 3 9.6843E6 2 2 2 Y 131375 Golgi apparatus protein 1 [Thamnophis elegans]
80 310 XP_034281438.1 109.22 3 3 9.6843E6 2 2 2 Y 131761 Golgi apparatus protein 1 [Pantherophis guttatus]
80 313 LAB62693.1 109.22 4 4 9.6843E6 2 2 2 Y 96178 hypothetical protein [Micrurus surinamensis]
80 314 LAB62690.1 109.22 3 3 9.6843E6 2 2 2 Y 122130 hypothetical protein, partial [Micrurus surinamensis]
80 315 XP_026570202.1 109.22 3 3 9.6843E6 2 2 2 Y 133145 Golgi apparatus protein 1 [Pseudonaja textilis]
80 316 XP_026535930.1 109.22 3 3 9.6843E6 2 2 2 Y 132789 Golgi apparatus protein 1 [Notechis scutatus]
80 337 XP_025027126.1 109.22 10 10 9.6843E6 2 2 2 Y 35196 Golgi apparatus protein 1 [Python bivittatus]
80 362 LAB18302.1 109.22 28 28 9.6843E6 2 2 2 Y 13184 hypothetical protein, partial [Micrurus spixii]
80 363 XP_015686495.1 109.22 19 19 9.6843E6 2 2 2 Y 18984 Golgi apparatus protein 1-like, partial [Protobothrops mucrosquamatus]
80 364 LAB18300.1 109.22 9 9 9.6843E6 2 2 2 Y 39264 hypothetical protein, partial [Micrurus spixii]
85 378 XP_026547933.1 108.91 18 18 1.5097E7 2 2 2 N 17232 fucolectin-like, partial [Notechis scutatus]
85 390 XP_026578807.1 108.91 4 4 1.5097E7 2 2 2 N 88287 LOW QUALITY PROTEIN: uncharacterized protein LOC113451644 [Pseudonaja textilis]
76 339 LAB57810.1 106.24 8 8 1.6383E7 2 2 3 N 34061 hypothetical protein, partial [Micrurus surinamensis]
76 504 P80512.1 106.24 7 7 1.6383E7 2 2 3 N 39955 RecName: Full=Alcohol dehydrogenase 1
76 505 XP_026528465.1 106.24 7 7 1.6383E7 2 2 3 N 39895 alcohol dehydrogenase 1C [Notechis scutatus]
76 506 LAA59635.1 106.24 7 7 1.6383E7 2 2 3 N 39954 hypothetical protein [Micrurus corallinus]
76 507 XP_026554078.1 106.24 7 7 1.6383E7 2 2 3 N 39896 alcohol dehydrogenase 1 [Pseudonaja textilis]
60 418 T_81 104.90 5 5 4.3601E7 2 2 5 N 64044 T_81
60 419 T_83 104.90 5 5 4.3601E7 2 2 5 N 64044 T_83
66 495 XP_026545897.1 103.33 14 14 8.3688E7 2 2 4 Y 16186 hemoglobin subunit beta [Notechis scutatus]
66 916 JAG67762.1 103.33 14 14 8.3688E7 2 2 4 Y 16362 Hemoglobin subunit beta-2 [Boiga irregularis]
66 917 JAG67761.1 103.33 14 14 8.3688E7 2 2 4 Y 16362 Hemoglobin subunit rho [Boiga irregularis]
71 268 ETE73401.1 100.63 3 3 1.4993E7 2 2 3 Y 138992 Coagulation factor X isoform 1, partial [Ophiophagus hannah]
71 294 XP_026580326.1 100.63 11 11 1.4993E7 2 2 3 Y 39293 coagulation factor VII [Pseudonaja textilis]
71 318 JAS05177.1 100.63 9 9 1.4993E7 2 2 3 Y 48122 coagulation factor VII [Micrurus tener]
71 319 JAI09074.1 100.63 9 9 1.4993E7 2 2 3 Y 48122 coagulation factor VII [Micrurus fulvius]
71 320 JAS05063.1 100.63 9 9 1.4993E7 2 2 3 Y 48122 coagulation factor VII [Micrurus fulvius]
71 321 JAB54462.1 100.63 9 9 1.4993E7 2 2 3 Y 48122 coagulation factor 7 [Micrurus fulvius]
71 345 XP_026548111.1 100.63 10 10 1.4993E7 2 2 3 Y 44790 coagulation factor VII, partial [Notechis scutatus]
50 837 AAB20783.1 96.71 36 36 3.4561E6 2 1 11 Y 13014 notechis 11'2=non-toxic phospholipase A2 [Notechis scutatus=Australian tiger snakes, ssp. scutatus, venom, Peptide, 118 aa]
50 841 P08873.1 96.71 30 30 3.4561E6 2 1 11 Y 15903 RecName: Full=Basic phospholipase A2 notechis 11'2; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
50 842 CAA31125.1 96.71 30 30 3.4561E6 2 1 11 Y 15903 PLA2 preprotein (AA-27 to 118) [Notechis scutatus]
78 420 AFJ49950.1 84.90 12 12 1.8158E7 2 2 2 N 50201 Elongation factor 1-alpha 1-like [Crotalus adamanteus]
78 421 JAA97186.1 84.90 12 12 1.8158E7 2 2 2 N 50201 Elongation factor 1-alpha 1 [Crotalus horridus]
78 422 JAI13488.1 84.90 12 12 1.8158E7 2 2 2 N 50201 elongation factor 1-alpha 1 [Crotalus adamanteus]
78 423 JAC95701.1 84.90 12 12 1.8158E7 2 2 2 N 50205 elongation factor-1 alpha [Hypsiglena sp. JMG-2014]
78 424 JAC95700.1 84.90 12 12 1.8158E7 2 2 2 N 50205 Elongation factor 1-alpha 1 [Hypsiglena sp. JMG-2014]
78 425 JAI10049.1 84.90 12 12 1.8158E7 2 2 2 N 50125 elongation factor 1-alpha 1 [Micrurus fulvius]
78 426 JAG46923.1 84.90 12 12 1.8158E7 2 2 2 N 50201 Elongation factor 1-alpha 1 [Crotalus horridus]
78 427 XP_015672964.1 84.90 12 12 1.8158E7 2 2 2 N 50155 elongation factor 1-alpha 1 [Protobothrops mucrosquamatus]
78 428 JAG44960.1 84.90 12 12 1.8158E7 2 2 2 N 50201 elongation factor 1-alpha 1 [Crotalus horridus]
78 429 JAV50678.1 84.90 12 12 1.8158E7 2 2 2 N 50201 Elongation factor 1-alpha 1 [Agkistrodon contortrix contortrix]
78 430 JAB54325.1 84.90 12 12 1.8158E7 2 2 2 N 50125 Elongation factor 1-alpha 1 [Micrurus fulvius]
151 817 XP_015682720.1 76.91 11 11 8.7682E6 1 1 1 N 16531 hemoglobin subunit beta-2 [Protobothrops mucrosquamatus]
99 492 XP_026542227.1 75.36 4 4 5.3043E5 1 1 1 N 51879 6-phosphogluconate dehydrogenase, decarboxylating [Notechis scutatus]
99 663 JAI12109.1 75.36 4 4 5.3043E5 1 1 1 N 53182 6-phosphogluconate dehydrogenase, decarboxylating [Crotalus adamanteus]
99 664 JAG46036.1 75.36 4 4 5.3043E5 1 1 1 N 53165 6-phosphogluconate dehydrogenase, decarboxylating [Crotalus horridus]
99 665 XP_032087395.1 75.36 4 4 5.3043E5 1 1 1 N 53028 6-phosphogluconate dehydrogenase, decarboxylating [Thamnophis elegans]
99 666 XP_015676923.1 75.36 4 4 5.3043E5 1 1 1 N 53093 6-phosphogluconate dehydrogenase, decarboxylating [Protobothrops mucrosquamatus]
99 667 AFJ50914.1 75.36 4 4 5.3043E5 1 1 1 N 53182 6-phosphogluconate dehydrogenase [Crotalus adamanteus]
99 668 JAB53691.1 75.36 4 4 5.3043E5 1 1 1 N 53044 6-phosphogluconate dehydrogenase [Micrurus fulvius]
99 669 JAV51398.1 75.36 4 4 5.3043E5 1 1 1 N 53093 6-phosphogluconate dehydrogenase, decarboxylating [Agkistrodon contortrix contortrix]
99 670 XP_034294750.1 75.36 4 4 5.3043E5 1 1 1 N 53151 6-phosphogluconate dehydrogenase, decarboxylating [Pantherophis guttatus]
99 671 LAA63155.1 75.36 4 4 5.3043E5 1 1 1 N 53179 hypothetical protein, partial [Micrurus corallinus]
99 683 JAG68880.1 75.36 4 4 5.3043E5 1 1 1 N 53122 6-phosphogluconate dehydrogenase [Boiga irregularis]
99 684 LAB46151.1 75.36 3 3 5.3043E5 1 1 1 N 56657 hypothetical protein, partial [Micrurus surinamensis]
48 437 Q9DF52.1 71.14 33 33 1.7513E9 2 1 7 Y 15765 RecName: Full=Basic phospholipase A2 KPA2; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
48 438 AAG13412.1 71.14 33 33 1.7513E9 2 1 7 Y 15765 phospholipase A2 [Bungarus caeruleus]
139 686 P15816.1 70.87 18 18 1.7586E6 1 1 1 Y 9517 RecName: Full=Kappa-2-bungarotoxin; AltName: Full=Kappa-neurotoxin CB1; Flags: Precursor
139 687 CAA35774.1 70.87 18 18 1.7586E6 1 1 1 Y 9517 unnamed protein product [Bungarus multicinctus]
139 876 O12962.1 70.87 18 18 1.7586E6 1 1 1 Y 9474 RecName: Full=Kappa-5-bungarotoxin; Flags: Precursor
139 877 CAA72940.1 70.87 18 18 1.7586E6 1 1 1 Y 9474 kappa5 bungarotoxin [Bungarus multicinctus]
137 602 ACE73577.1 69.57 7 7 1.3601E7 1 1 1 N 26458 cysteine-rich seceretory protein Bc-CRPb [Bungarus candidus]
137 603 ACE73578.1 69.57 7 7 1.3601E7 1 1 1 N 26443 cysteine-rich seceretory protein Bc-CRPa [Bungarus candidus]
137 604 T_89 69.57 7 7 1.3601E7 1 1 1 N 26379 T_89
137 605 T_93 69.57 7 7 1.3601E7 1 1 1 N 26379 T_93
137 606 T_92 69.57 7 7 1.3601E7 1 1 1 N 26379 T_92
137 607 T_95 69.57 7 7 1.3601E7 1 1 1 N 26379 T_95
137 608 T_91 69.57 7 7 1.3601E7 1 1 1 N 27807 T_91
137 609 T_94 69.57 6 6 1.3601E7 1 1 1 N 31259 T_94
137 885 P81993.1 69.57 25 25 1.3601E7 1 1 1 N 7752 RecName: Full=Cysteine-rich venom protein bucarin
137 886 T_96 69.57 10 10 1.3601E7 1 1 1 N 19403 T_96
137 887 ACN93671.1 69.57 7 7 1.3601E7 1 1 1 N 26305 opharin precursor [Ophiophagus hannah]
137 888 ACH73168.1 69.57 7 7 1.3601E7 1 1 1 N 26216 kaouthin-2 precursor [Naja kaouthia]
137 889 AAP20603.1 69.57 7 7 1.3601E7 1 1 1 N 26246 cysteine-rich venom protein [Naja atra]
137 890 Q7ZZN8.1 69.57 7 7 1.3601E7 1 1 1 N 26246 RecName: Full=Cysteine-rich venom protein natrin-2; AltName: Full=Cysteine-rich venom protein 2; AltName: Full=NA-CRVP2; AltName: Full=Protein G2b; Flags: Precursor
137 891 P84808.2 69.57 7 7 1.3601E7 1 1 1 N 26216 RecName: Full=Cysteine-rich venom protein kaouthin-2; AltName: Full=Cysteine-rich venom protein 23; Short=CRVP-23k; Flags: Precursor
137 892 AHZ08822.1 69.57 7 7 1.3601E7 1 1 1 N 26216 cysteine-rich secretory protein [Micropechis ikaheca]
137 893 XP_032069593.1 69.57 7 7 1.3601E7 1 1 1 N 26603 cysteine-rich venom protein kaouthin-2 [Thamnophis elegans]
137 894 JAC94992.1 69.57 7 7 1.3601E7 1 1 1 N 26749 Cysteine-rich secretory protein A [Opheodrys aestivus]
137 895 ETE62137.1 69.57 7 7 1.3601E7 1 1 1 N 27268 hypothetical protein L345_12110, partial [Ophiophagus hannah]
143 774 XP_034292109.1 69.56 7 7 1.5314E7 1 1 1 Y 33533 neural proliferation differentiation and control protein 1 [Pantherophis guttatus]
77 716 Q9PRL9.1 68.46 9 9 8.8287E6 1 1 3 N 15448 RecName: Full=Hemoglobin subunit alpha-1; AltName: Full=Alpha-1-globin; AltName: Full=Hemoglobin alpha-1 chain; AltName: Full=Hemoglobin alpha-I chain
77 717 AAB34003.1 68.46 9 9 8.8287E6 1 1 3 N 15448 hemoglobin alpha I chain [Naja naja=cobra snakes, naja, blood, Peptide, 141 aa]
128 748 XP_034287104.1 68.09 5 5 8.9964E5 1 1 1 N 32547 annexin A3 [Pantherophis guttatus]
128 755 LAB37887.1 68.09 5 5 8.9964E5 1 1 1 N 35845 hypothetical protein [Micrurus spixii]
128 765 JAG68721.1 68.09 5 5 8.9964E5 1 1 1 N 35839 annexin A3 isoform 3 [Boiga irregularis]
128 911 XP_026532239.1 68.09 5 5 8.9964E5 1 1 1 N 35736 annexin A3 [Notechis scutatus]
128 912 XP_013926160.1 68.09 5 5 8.9964E5 1 1 1 N 35733 PREDICTED: annexin A4 [Thamnophis sirtalis]
128 913 XP_026574715.1 68.09 5 5 8.9964E5 1 1 1 N 35888 annexin A3 [Pseudonaja textilis]
128 914 XP_032080318.1 68.09 5 5 8.9964E5 1 1 1 N 35795 annexin A3 [Thamnophis elegans]
128 915 JAC96259.1 68.09 5 5 8.9964E5 1 1 1 N 35689 annexin A3 [Hypsiglena sp. JMG-2014]
112 776 AAL30054.1 67.87 28 28 1.3114E8 1 1 1 Y 9580 kappa 1a bungaratoxin [Bungarus candidus]
112 777 Q8AY56.1 67.87 28 28 1.3114E8 1 1 1 Y 9580 RecName: Full=Kappa 1a-bungarotoxin; Flags: Precursor
140 702 LAA33342.1 67.24 14 14 0 1 1 1 Y 18057 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
140 919 LAB47895.1 67.24 10 10 0 1 1 1 Y 25556 hypothetical protein, partial [Micrurus surinamensis]
152 920 T_74 66.13 18 18 1.8424E6 1 1 1 Y 10142 T_74
121 554 XP_026528620.1 61.92 3 3 2.5269E5 1 1 1 N 58373 prosaposin-like isoform X2 [Notechis scutatus]
121 555 XP_026569354.1 61.92 3 3 2.5269E5 1 1 1 N 58289 prosaposin isoform X2 [Pseudonaja textilis]
121 556 XP_026528619.1 61.92 2 2 2.5269E5 1 1 1 N 58759 prosaposin-like isoform X1 [Notechis scutatus]
121 557 XP_026569353.1 61.92 2 2 2.5269E5 1 1 1 N 58674 prosaposin isoform X1 [Pseudonaja textilis]
121 558 XP_015669101.1 61.92 3 3 2.5269E5 1 1 1 N 57981 prosaposin [Protobothrops mucrosquamatus]
121 559 AFJ51008.1 61.92 3 3 2.5269E5 1 1 1 N 58013 Proactivator polypeptide-like [Crotalus adamanteus]
121 560 BAN82088.1 61.92 2 2 2.5269E5 1 1 1 N 58564 hypothetical protein [Protobothrops flavoviridis]
121 561 ETE61271.1 61.92 3 3 2.5269E5 1 1 1 N 54055 Proactivator polypeptide [Ophiophagus hannah]
121 767 XP_013923763.1 61.92 3 3 2.5269E5 1 1 1 N 58050 PREDICTED: prosaposin isoform X2 [Thamnophis sirtalis]
121 768 XP_013923762.1 61.92 2 2 2.5269E5 1 1 1 N 58435 PREDICTED: prosaposin isoform X1 [Thamnophis sirtalis]
121 926 XP_007441356.1 61.92 3 3 2.5269E5 1 1 1 N 42934 prosaposin-like [Python bivittatus]
121 927 XP_032088229.1 61.92 3 3 2.5269E5 1 1 1 N 58050 prosaposin-like isoform X2 [Thamnophis elegans]
121 928 XP_034291658.1 61.92 2 2 2.5269E5 1 1 1 N 58438 prosaposin-like isoform X4 [Pantherophis guttatus]
121 929 XP_032088228.1 61.92 2 2 2.5269E5 1 1 1 N 58435 prosaposin-like isoform X1 [Thamnophis elegans]
121 930 XP_034291656.1 61.92 2 2 2.5269E5 1 1 1 N 58696 prosaposin-like isoform X2 [Pantherophis guttatus]
121 931 XP_034291657.1 61.92 2 2 2.5269E5 1 1 1 N 58695 prosaposin-like isoform X3 [Pantherophis guttatus]
121 932 XP_034291655.1 61.92 2 2 2.5269E5 1 1 1 N 58824 prosaposin-like isoform X1 [Pantherophis guttatus]
138 620 XP_034265676.1 60.31 5 5 3.5037E6 1 1 1 N 24564 peroxiredoxin-6 [Pantherophis guttatus]
138 960 XP_032082279.1 60.31 5 5 3.5037E6 1 1 1 N 24580 peroxiredoxin-6 [Thamnophis elegans]
138 961 JAI09679.1 60.31 5 5 3.5037E6 1 1 1 N 24589 Peroxiredoxin-6-like protein [Micrurus fulvius]
138 962 AFJ50899.1 60.31 5 5 3.5037E6 1 1 1 N 24496 Peroxiredoxin-6-like [Crotalus adamanteus]
138 963 JAB53717.1 60.31 5 5 3.5037E6 1 1 1 N 24589 peroxiredoxin-6-like protein [Micrurus fulvius]
138 964 XP_026524951.1 60.31 5 5 3.5037E6 1 1 1 N 24549 peroxiredoxin-6 [Notechis scutatus]
138 965 JAG67074.1 60.31 5 5 3.5037E6 1 1 1 N 24547 Peroxiredoxin-6-like protein [Boiga irregularis]
138 966 LAB58410.1 60.31 5 5 3.5037E6 1 1 1 N 24562 hypothetical protein [Micrurus surinamensis]
138 967 JAA96187.1 60.31 5 5 3.5037E6 1 1 1 N 24496 Peroxiredoxin-6-like protein [Crotalus horridus]
138 968 JAV49687.1 60.31 5 5 3.5037E6 1 1 1 N 24496 Peroxiredoxin-6-like protein [Agkistrodon contortrix contortrix]
138 969 XP_015687493.1 60.31 5 5 3.5037E6 1 1 1 N 24526 peroxiredoxin-6 [Protobothrops mucrosquamatus]
138 970 JAI12121.1 60.31 5 5 3.5037E6 1 1 1 N 24496 Peroxiredoxin-6-like protein [Crotalus adamanteus]
138 971 XP_026559154.1 60.31 5 5 3.5037E6 1 1 1 N 24519 peroxiredoxin-6 [Pseudonaja textilis]
153 977 ETE73981.1 58.22 7 7 0 1 1 1 Y 25402 14-3-3 protein sigma, partial [Ophiophagus hannah]
82 703 AAC83997.1 56.12 12 12 1.1946E7 1 1 2 Y 7981 alpha-bungarotoxin isoform R15, partial [Bungarus multicinctus]
82 775 AAC83990.1 56.12 12 12 1.1946E7 1 1 2 Y 8017 alpha-bungarotoxin isoform R12, partial [Bungarus multicinctus]
82 981 P01385.1 56.12 12 12 1.1946E7 1 1 2 Y 8135 RecName: Full=Alpha-elapitoxin-Aa2b; Short=Alpha-EPTX-Aa2b; AltName: Full=Long neurotoxin 1
82 982 0512217A 56.12 12 12 1.1946E7 1 1 2 Y 8060 neurotoxin
82 983 AAC83992.1 56.12 12 12 1.1946E7 1 1 2 Y 7994 alpha-bungarotoxin isoform R9, partial [Bungarus multicinctus]
82 984 1HAJ 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Alpha-bungarotoxin
82 985 1IDH 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, The Nmr Solution Structure Of The Complex Formed Between Alpha-Bungarotoxin And An 18mer Cognate Peptide
82 986 2BTX 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Solution Nmr Structure Of The Complex Of Alpha-Bungarotoxin With A Library Derived Peptide, Nmr, Minimized Average Structure
82 987 1IK8 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Nmr Structure Of Alpha-Bungarotoxin
82 988 1BXP 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Solution Nmr Structure Of The Complex Of Alpha-Bungarotoxin With A Library Derived Peptide, 20 Structures
82 989 1ABT 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Nmr Solution Structure Of An Alpha-Bungarotoxin(Slash) Nicotinic Receptor Peptide Complex
82 990 1IKC 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, Nmr Structure Of Alpha-Bungarotoxin
82 991 AAC83994.1 56.12 12 12 1.1946E7 1 1 2 Y 7994 alpha-bungarotoxin isoform R11, partial [Bungarus multicinctus]
82 992 AAC83991.1 56.12 12 12 1.1946E7 1 1 2 Y 7994 alpha-bungarotoxin isoform R8, partial [Bungarus multicinctus]
82 993 1IDL 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain A, The Nmr Solution Structure Of Alpha-Bungarotoxin
82 994 1HOY 56.12 12 12 1.1946E7 1 1 2 Y 8000 Chain A, Nmr Structure Of The Complex Between A-Bungarotoxin And A Mimotope Of The Nicotinic Acetilcholine Receptor
82 995 AAC83993.1 56.12 12 12 1.1946E7 1 1 2 Y 7994 alpha-bungarotoxin isoform R10, partial [Bungarus multicinctus]
82 996 720920A 56.12 12 12 1.1946E7 1 1 2 Y 7994 toxin alpha,bungaro
82 997 2ABX 56.12 12 12 1.1946E7 1 1 2 Y 7994 Chain B, The Crystal Structure Of Alpha-Bungarotoxin At 2.5 Angstroms Resolution. Relation To Solution Structure And Binding To Acetylcholine Receptor
82 998 CAM11311.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 999 ADN67593.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 three-finger toxin precursor, partial [Bungarus multicinctus]
82 1000 CAM11305.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 1001 CAM11309.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 1002 CAD92407.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31) precursor, partial [Bungarus candidus]
82 1003 CAM11312.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 1004 CAM11307.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus multicinctus]
82 1005 CAM11310.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 1006 CAM11304.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (A31), partial [Bungarus candidus]
82 1007 CAM11302.1 56.12 12 12 1.1946E7 1 1 2 Y 8306 alpha-delta-bungarotoxin-4, partial [Bungarus caeruleus]
82 1008 D2N116.1 56.12 12 12 1.1946E7 1 1 2 Y 8306 RecName: Full=Alpha-delta-bungarotoxin-4; Short=Alpha-delta-Bgt-4; Flags: Precursor
82 1009 CAM11303.1 56.12 12 12 1.1946E7 1 1 2 Y 8228 alpha-bungarotoxin (A5), partial [Bungarus candidus]
82 1010 CAM11306.1 56.12 12 12 1.1946E7 1 1 2 Y 8259 alpha-bungarotoxin (T7/A8), partial [Bungarus candidus]
82 1011 Q8UW29.1 56.12 10 10 1.1946E7 1 1 2 Y 10218 RecName: Full=Long neurotoxin 1; Flags: Precursor
82 1012 AAL54892.1 56.12 10 10 1.1946E7 1 1 2 Y 10218 long neurotoxin isoform [Hydrophis hardwickii]
82 1013 A3FM53.1 56.12 10 10 1.1946E7 1 1 2 Y 10406 RecName: Full=Long neurotoxin 2; Flags: Precursor
82 1014 ABN54806.1 56.12 10 10 1.1946E7 1 1 2 Y 10406 long chain neurotoxin isoform 2 precursor [Hydrophis hardwickii]
82 1015 JAA74770.1 56.12 10 10 1.1946E7 1 1 2 Y 10255 3FTx-Ech-21 [Echiopsis curta]
82 1016 P01384.2 56.12 10 10 1.1946E7 1 1 2 Y 10289 RecName: Full=Alpha-elapitoxin-Nss2a; Short=Alpha-EPTX-Nss2a; AltName: Full=Long neurotoxin 1; Short=LNTX-1; AltName: Full=Notechis III-4; Flags: Precursor
82 1017 ABK63537.1 56.12 10 10 1.1946E7 1 1 2 Y 10289 LNTX-1 precursor [Notechis scutatus]
82 1018 JAA74654.1 56.12 10 10 1.1946E7 1 1 2 Y 10392 3FTx-Aca-27 [Acanthophis wellsi]
82 1019 AAC83981.1 56.12 9 9 1.1946E7 1 1 2 Y 10285 alpha-bungarotoxin precursor [Bungarus multicinctus]
82 1020 AAL30056.1 56.12 9 9 1.1946E7 1 1 2 Y 10285 alpha bungaratoxin [Bungarus candidus]
122 628 LAA32179.1 55.14 3 3 3.3012E5 1 1 1 N 55369 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
122 629 XP_026524224.1 55.14 3 3 3.3012E5 1 1 1 N 55575 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Notechis scutatus]
122 630 XP_026568672.1 55.14 3 3 3.3012E5 1 1 1 N 55506 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Pseudonaja textilis]
122 631 XP_026524225.1 55.14 3 3 3.3012E5 1 1 1 N 55575 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Notechis scutatus]
122 632 XP_026568674.1 55.14 3 3 3.3012E5 1 1 1 N 55506 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Pseudonaja textilis]
122 633 XP_015667825.1 55.14 3 3 3.3012E5 1 1 1 N 55573 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Protobothrops mucrosquamatus]
122 634 XP_026524226.1 55.14 3 3 3.3012E5 1 1 1 N 55575 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Notechis scutatus]
122 635 XP_034288350.1 55.14 3 3 3.3012E5 1 1 1 N 55563 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Pantherophis guttatus]
122 636 XP_007435816.1 55.14 3 3 3.3012E5 1 1 1 N 55487 UTP--glucose-1-phosphate uridylyltransferase isoform X3 [Python bivittatus]
122 637 XP_026568671.1 55.14 3 3 3.3012E5 1 1 1 N 55506 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Pseudonaja textilis]
122 638 XP_026568673.1 55.14 3 3 3.3012E5 1 1 1 N 55506 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Pseudonaja textilis]
122 639 XP_026524223.1 55.14 3 3 3.3012E5 1 1 1 N 55575 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Notechis scutatus]
122 640 ETE70626.1 55.14 3 3 3.3012E5 1 1 1 N 55501 UTP--glucose-1-phosphate uridylyltransferase [Ophiophagus hannah]
122 641 LAB55207.1 55.14 3 3 3.3012E5 1 1 1 N 56720 hypothetical protein [Micrurus surinamensis]
122 642 LAA32175.1 55.14 3 3 3.3012E5 1 1 1 N 56750 hypothetical protein [Micrurus lemniscatus carvalhoi]
122 643 JAV48583.1 55.14 3 3 3.3012E5 1 1 1 N 56815 UTP--glucose-1-phosphate uridylyltransferase [Agkistrodon contortrix contortrix]
122 644 XP_015667816.1 55.14 3 3 3.3012E5 1 1 1 N 56801 UTP--glucose-1-phosphate uridylyltransferase isoform X1 [Protobothrops mucrosquamatus]
122 645 XP_034288348.1 55.14 3 3 3.3012E5 1 1 1 N 56763 UTP--glucose-1-phosphate uridylyltransferase isoform X1 [Pantherophis guttatus]
122 646 XP_007435815.1 55.14 3 3 3.3012E5 1 1 1 N 56687 UTP--glucose-1-phosphate uridylyltransferase isoform X2 [Python bivittatus]
122 647 XP_026524222.1 55.14 3 3 3.3012E5 1 1 1 N 56775 UTP--glucose-1-phosphate uridylyltransferase isoform X1 [Notechis scutatus]
122 648 XP_026568670.1 55.14 3 3 3.3012E5 1 1 1 N 56706 UTP--glucose-1-phosphate uridylyltransferase isoform X1 [Pseudonaja textilis]
122 649 LAA32177.1 55.14 3 3 3.3012E5 1 1 1 N 57127 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
122 650 XP_025027268.1 55.14 2 2 3.3012E5 1 1 1 N 59921 UTP--glucose-1-phosphate uridylyltransferase isoform X1 [Python bivittatus]
129 1050 P02010.1 54.82 21 21 0 1 1 1 N 15437 RecName: Full=Hemoglobin subunit alpha; AltName: Full=Alpha-globin; AltName: Full=Hemoglobin alpha chain
136 569 XP_032076462.1 52.14 5 5 1.1705E6 1 1 1 N 31282 endonuclease domain-containing 1 protein-like isoform X2 [Thamnophis elegans]
136 570 XP_032076461.1 52.14 5 5 1.1705E6 1 1 1 N 34799 endonuclease domain-containing 1 protein-like isoform X1 [Thamnophis elegans]
136 1052 ETE56723.1 52.14 9 9 1.1705E6 1 1 1 N 18083 Endonuclease domain-containing 1 protein [Ophiophagus hannah]
136 1053 XP_026546198.1 52.14 5 5 1.1705E6 1 1 1 N 31377 endonuclease domain-containing 1 protein-like isoform X2 [Notechis scutatus]
136 1054 XP_026546199.1 52.14 5 5 1.1705E6 1 1 1 N 31377 endonuclease domain-containing 1 protein-like isoform X2 [Notechis scutatus]
136 1055 XP_026546197.1 52.14 5 5 1.1705E6 1 1 1 N 31377 endonuclease domain-containing 1 protein-like isoform X2 [Notechis scutatus]
136 1056 JAB54304.1 52.14 5 5 1.1705E6 1 1 1 N 31577 endonuclease domain-containing 1 protein [Micrurus fulvius]
136 1057 XP_026579206.1 52.14 5 5 1.1705E6 1 1 1 N 31175 endonuclease domain-containing 1 protein-like [Pseudonaja textilis]
136 1058 XP_026579205.1 52.14 5 5 1.1705E6 1 1 1 N 31175 endonuclease domain-containing 1 protein-like [Pseudonaja textilis]
136 1059 XP_026579207.1 52.14 5 5 1.1705E6 1 1 1 N 31175 endonuclease domain-containing 1 protein-like [Pseudonaja textilis]
136 1060 XP_026546196.1 52.14 5 5 1.1705E6 1 1 1 N 33047 endonuclease domain-containing 1 protein-like isoform X1 [Notechis scutatus]
136 1061 ETE59939.1 52.14 3 3 1.1705E6 1 1 1 N 51067 Endonuclease domain-containing 1 protein, partial [Ophiophagus hannah]
102 533 LAA72691.1 51.18 6 6 4.5855E5 1 1 1 N 47317 hypothetical protein [Micrurus lemniscatus lemniscatus]
102 534 LAA72685.1 51.18 3 3 4.5855E5 1 1 1 N 103842 hypothetical protein [Micrurus lemniscatus lemniscatus]
102 535 ETE73165.1 51.18 3 3 4.5855E5 1 1 1 N 107545 Trifunctional purine biosynthetic protein adenosine-3 [Ophiophagus hannah]
102 536 LAA72697.1 51.18 3 3 4.5855E5 1 1 1 N 107758 hypothetical protein [Micrurus lemniscatus lemniscatus]
102 752 XP_026519973.1 51.18 6 6 4.5855E5 1 1 1 N 47419 trifunctional purine biosynthetic protein adenosine-3-like [Notechis scutatus]
102 753 XP_026556356.1 51.18 3 3 4.5855E5 1 1 1 N 107597 trifunctional purine biosynthetic protein adenosine-3 [Pseudonaja textilis]
102 754 XP_026556355.1 51.18 3 3 4.5855E5 1 1 1 N 107597 trifunctional purine biosynthetic protein adenosine-3 [Pseudonaja textilis]
102 1062 XP_034291632.1 51.18 3 3 4.5855E5 1 1 1 N 107225 trifunctional purine biosynthetic protein adenosine-3-like [Pantherophis guttatus]
124 699 XP_013931233.1 45.93 21 21 3.3751E7 1 1 1 Y 16229 PREDICTED: hemoglobin subunit beta-2 [Thamnophis sirtalis]
124 700 XP_032075324.1 45.93 21 21 3.3751E7 1 1 1 Y 16227 hemoglobin subunit beta-2 [Thamnophis elegans]
119 508 XP_026561289.1 41.50 1 1 2.615E6 1 1 1 N 96775 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X5 [Pseudonaja textilis]
141 718 XP_007429085.1 40.86 2 2 1.1454E6 1 1 1 N 59718 cochlin [Python bivittatus]
141 1081 LAA86986.1 40.86 5 5 1.1454E6 1 1 1 N 28508 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
141 1082 LAB57337.1 40.86 5 5 1.1454E6 1 1 1 N 30451 hypothetical protein, partial [Micrurus surinamensis]
141 1083 XP_013923615.1 40.86 2 2 1.1454E6 1 1 1 N 59675 PREDICTED: cochlin [Thamnophis sirtalis]
141 1084 XP_026520312.1 40.86 2 2 1.1454E6 1 1 1 N 59883 cochlin [Notechis scutatus]
141 1085 XP_034273852.1 40.86 2 2 1.1454E6 1 1 1 N 59540 cochlin [Pantherophis guttatus]
141 1086 LAB44384.1 40.86 2 2 1.1454E6 1 1 1 N 59763 hypothetical protein [Micrurus spixii]
141 1087 XP_026566518.1 40.86 2 2 1.1454E6 1 1 1 N 59709 cochlin [Pseudonaja textilis]
141 1088 XP_032069561.1 40.86 2 2 1.1454E6 1 1 1 N 62259 cochlin [Thamnophis elegans]
145 1090 XP_026526467.1 40.42 2 2 1.7947E7 1 1 1 N 86822 exocyst complex component 6 [Notechis scutatus]
72 1097 ABW24182.1 40.08 17 17 1.8079E5 1 1 2 Y 16409 PLA-20 precursor [Austrelaps superbus]
104 479 XP_013931090.1 39.69 2 2 0 1 1 1 Y 51798 PREDICTED: beta-enolase [Thamnophis sirtalis]
104 486 XP_032091032.1 39.69 3 3 0 1 1 1 Y 47597 beta-enolase [Thamnophis elegans]
104 676 JAB54294.1 39.69 3 3 0 1 1 1 Y 47587 enolase B [Micrurus fulvius]
104 677 XP_007441409.1 39.69 3 3 0 1 1 1 Y 47642 beta-enolase [Python bivittatus]
104 729 JAG68757.1 39.69 3 3 0 1 1 1 Y 47546 Alpha-enolase [Boiga irregularis]
104 769 CBN61477.1 39.69 3 3 0 1 1 1 Y 47570 unnamed protein product [Python regius]
104 770 AAD41646.1 39.69 3 3 0 1 1 1 Y 47570 alpha enolase [Python regius]
104 771 XP_026571534.1 39.69 3 3 0 1 1 1 Y 47553 alpha-enolase [Pseudonaja textilis]
104 1098 XP_026582136.1 39.69 8 8 0 1 1 1 Y 16189 beta-enolase-like, partial [Pseudonaja textilis]
104 1099 XP_013923835.1 39.69 7 7 0 1 1 1 Y 17757 PREDICTED: gamma-enolase [Thamnophis sirtalis]
104 1100 XP_013916893.1 39.69 7 7 0 1 1 1 Y 17752 PREDICTED: alpha-enolase-like [Thamnophis sirtalis]
104 1101 LAA54352.1 39.69 4 4 0 1 1 1 Y 30239 hypothetical protein [Micrurus corallinus]
104 1102 LAA72706.1 39.69 4 4 0 1 1 1 Y 32447 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
104 1103 LAA54354.1 39.69 3 3 0 1 1 1 Y 39337 hypothetical protein [Micrurus corallinus]
104 1104 LAA54356.1 39.69 3 3 0 1 1 1 Y 41086 hypothetical protein, partial [Micrurus corallinus]
104 1105 LAA78451.1 39.69 3 3 0 1 1 1 Y 41419 hypothetical protein [Micrurus lemniscatus lemniscatus]
104 1106 LAA78455.1 39.69 3 3 0 1 1 1 Y 41419 hypothetical protein [Micrurus lemniscatus lemniscatus]
104 1107 JAI10301.1 39.69 3 3 0 1 1 1 Y 47479 Alpha-enolase [Micrurus fulvius]
104 1108 JAG47510.1 39.69 3 3 0 1 1 1 Y 47465 Alpha-enolase [Crotalus horridus]
104 1109 JAG45884.1 39.69 3 3 0 1 1 1 Y 47491 Alpha-enolase [Crotalus horridus]
104 1110 XP_026569147.1 39.69 3 3 0 1 1 1 Y 47406 gamma-enolase [Pseudonaja textilis]
104 1111 JAA97809.1 39.69 3 3 0 1 1 1 Y 47491 Alpha-enolase [Crotalus horridus]
104 1112 XP_026542044.1 39.69 3 3 0 1 1 1 Y 47378 gamma-enolase [Notechis scutatus]
104 1113 AFJ49385.1 39.69 3 3 0 1 1 1 Y 47491 Alpha-enolase [Crotalus adamanteus]
104 1114 XP_026544503.1 39.69 3 3 0 1 1 1 Y 47550 alpha-enolase [Notechis scutatus]
104 1115 JAC96284.1 39.69 3 3 0 1 1 1 Y 47493 alpha-enolase [Hypsiglena sp. JMG-2014]
104 1116 JAB54295.1 39.69 3 3 0 1 1 1 Y 47479 Alpha-enolase [Micrurus fulvius]
104 1117 JAI14387.1 39.69 3 3 0 1 1 1 Y 47491 Alpha-enolase [Crotalus adamanteus]
104 1118 XP_007420481.1 39.69 3 3 0 1 1 1 Y 47296 gamma-enolase [Python bivittatus]
104 1119 JAV51289.1 39.69 3 3 0 1 1 1 Y 47505 Alpha-enolase [Agkistrodon contortrix contortrix]
104 1120 ETE72098.1 39.69 2 2 0 1 1 1 Y 51701 Gamma-enolase, partial [Ophiophagus hannah]
87 1092 P81236.1 39.20 36 36 0 1 1 1 Y 12857 RecName: Full=Basic phospholipase A2 acanthin-1; Short=svPLA2; AltName: Full=Acanthin I; AltName: Full=Phosphatidylcholine 2-acylhydrolase
total 346 proteins

T_61
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 101.40 2658.4534 26 0.7 1330.2349 2 93.83 1 67305 01122020_RID_2209_BuCaKA02.raw 5.7352E10 14 14 40 65 PEAKS DB
R.AALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 96.22 2601.2791 23 0.3 1301.6472 2 41.43 1 24779 01122020_RID_2209_BuCaKA02.raw 1.888E8 2 2 268 290 Carbamidomethylation C10:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 245 265 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 412 437 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 412 436 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A Y 87.29 2074.0859 18 4.4 692.3723 3 60.27 1 39720 01122020_RID_2209_BuCaKA02.raw 2.2787E8 1 1 198 215 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSR.T N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 216 239 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 410 436 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 541 553 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 77.17 4072.2109 40 4.9 815.4535 5 78.62 1 54698 01122020_RID_2209_BuCaKA02.raw 1.683E9 3 3 26 65 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M Y 75.82 2601.4319 25 1.7 868.1527 3 93.27 1 66854 01122020_RID_2209_BuCaKA02.raw 9.8181E7 1 1 41 65 PEAKS DB
R.AGELKVSTQTGSVR.G Y 75.64 1431.7681 14 0.2 716.8914 2 12.05 1 2024 01122020_RID_2209_BuCaKA02.raw 2.521E6 1 1 26 39 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESR.R Y 75.41 2767.4404 26 0.6 923.4880 3 59.02 1 38537 01122020_RID_2209_BuCaKA02.raw 9.0758E7 1 1 240 265 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A Y 75.28 3034.5657 29 1.4 759.6498 4 72.55 1 49639 01122020_RID_2209_BuCaKA02.raw 4.0261E7 2 2 216 244 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 74.87 5127.6577 48 1.0 1026.5398 5 84.83 1 59856 01122020_RID_2209_BuCaKA02.raw 2.0822E7 1 1 192 239 PEAKS DB
L.KVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 71.73 3702.0256 36 5.4 926.5187 4 75.43 1 52253 01122020_RID_2209_BuCaKA02.raw 5.6822E8 4 4 30 65 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 416 436 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 70.30 3573.9307 35 9.4 715.8001 5 83.23 1 58537 01122020_RID_2209_BuCaKA02.raw 1.4423E10 7 7 31 65 PEAKS DB
V.SPGRAGELKVSTQTGSVR.G Y 70.11 1828.9755 18 0.0 610.6658 3 12.05 1 2023 01122020_RID_2209_BuCaKA02.raw 1.7435E6 1 1 22 39 PEAKS DB
R.LALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 70.03 4445.2812 42 1.3 890.0647 5 76.25 1 52778 01122020_RID_2209_BuCaKA02.raw 6.7471E7 3 3 198 239 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S Y 69.96 2174.0896 18 0.8 725.7044 3 63.32 1 42005 01122020_RID_2209_BuCaKA02.raw 2.4894E7 2 2 291 308 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPR.A Y 69.87 2756.4622 24 2.9 919.8307 3 77.23 1 53582 01122020_RID_2209_BuCaKA02.raw 2.4764E8 4 4 192 215 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 245 266 PEAKS DB
R.RAALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 65.73 2757.3801 24 2.0 690.3537 4 33.56 1 18494 01122020_RID_2209_BuCaKA02.raw 1.5928E7 1 1 267 290 Carbamidomethylation C11:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 54 65 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.32 2488.3477 24 2.0 830.4581 3 86.79 1 61552 01122020_RID_2209_BuCaKA02.raw 8.1857E7 1 1 42 65 PEAKS DB
V.STQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.11 3474.8623 34 6.8 869.7288 4 82.73 1 58133 01122020_RID_2209_BuCaKA02.raw 0 0 0 32 65 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 63.72 4199.0557 39 1.2 1400.6942 3 59.70 1 39174 01122020_RID_2209_BuCaKA02.raw 1.0279E9 3 3 502 540 PEAKS DB
R.GLSLPVLDGHVTAFL.G Y 63.72 1537.8503 15 1.7 769.9337 2 87.38 1 62023 01122020_RID_2209_BuCaKA02.raw 1.6202E7 1 1 40 54 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAF.L Y 63.61 2340.2437 23 0.9 1171.1301 2 64.35 1 42978 01122020_RID_2209_BuCaKA02.raw 5.93E8 2 2 31 53 PEAKS DB
L.PVLDGHVTAFLGIPFAEPPVGR.M Y 63.60 2288.2317 22 2.5 763.7531 3 79.31 1 55332 01122020_RID_2209_BuCaKA02.raw 3.4806E6 1 1 44 65 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESRR.R Y 62.58 2923.5415 27 -0.7 731.8922 4 49.01 1 30339 01122020_RID_2209_BuCaKA02.raw 0 0 0 240 266 PEAKS DB
S.LPVLDGHVTAFLGIPFAEPPVGR.M Y 62.25 2401.3157 23 2.2 801.4476 3 85.81 1 60666 01122020_RID_2209_BuCaKA02.raw 1.1292E7 1 1 43 65 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 53 65 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 62.05 2047.9204 17 0.7 683.6479 3 34.95 1 19633 01122020_RID_2209_BuCaKA02.raw 7.1157E7 1 1 274 290 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.ATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 60.92 2384.2212 20 2.7 795.7498 3 71.29 1 48640 01122020_RID_2209_BuCaKA02.raw 2.1393E7 2 2 534 553 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESR.R Y 60.82 5138.6357 50 0.4 1285.6667 4 83.73 1 58887 01122020_RID_2209_BuCaKA02.raw 9.1205E7 2 2 216 265 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 541 554 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 309 321 PEAKS DB
V.RGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 58.04 2814.5544 27 2.6 704.6477 4 82.79 1 58181 01122020_RID_2209_BuCaKA02.raw 0 0 0 39 65 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAF.L Y 57.78 2838.5239 28 0.1 710.6383 4 60.89 1 40258 01122020_RID_2209_BuCaKA02.raw 9.4408E8 5 5 26 53 PEAKS DB
D.PADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 56.43 3613.8164 33 -0.8 1205.6118 3 56.49 1 36480 01122020_RID_2209_BuCaKA02.raw 4.7617E7 1 1 508 540 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 543 553 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.TQPSLRAQIC(+57.02)AFWNHFLPK.L Y 56.17 2313.1841 19 0.9 579.3038 4 71.36 1 48657 01122020_RID_2209_BuCaKA02.raw 9.1707E6 2 2 535 553 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNATVDPPSADR.R Y 56.04 2980.5017 26 1.6 746.1339 4 77.71 1 54026 01122020_RID_2209_BuCaKA02.raw 0 0 0 541 566 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTAF.L Y 55.10 1424.7664 14 1.4 713.3915 2 76.68 1 53109 01122020_RID_2209_BuCaKA02.raw 6.1163E9 1 1 40 53 PEAKS DB
D.GHVTAFLGIPFAEPPVGR.M Y 53.85 1863.9995 18 1.0 622.3411 3 65.09 1 43442 01122020_RID_2209_BuCaKA02.raw 1.6562E7 1 1 48 65 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLN.A Y 52.39 1971.0189 16 1.1 658.0143 3 78.10 1 54392 01122020_RID_2209_BuCaKA02.raw 1.1181E8 1 1 541 556 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNA.T Y 52.28 2042.0560 17 0.9 1022.0362 2 80.05 1 56080 01122020_RID_2209_BuCaKA02.raw 4.8965E8 4 4 541 557 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 542 553 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTA.F Y 48.82 1277.6979 13 1.7 639.8573 2 62.03 1 40890 01122020_RID_2209_BuCaKA02.raw 8.2252E7 1 1 40 52 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGRMR.F Y 48.68 2945.5950 28 4.5 737.4093 4 85.11 1 60069 01122020_RID_2209_BuCaKA02.raw 1.6187E7 2 2 40 67 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A Y 46.40 1961.0020 17 1.8 654.6758 3 46.23 1 28435 01122020_RID_2209_BuCaKA02.raw 0 0 0 199 215 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 216 239 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
G.SVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 45.26 3000.6548 29 6.1 751.1755 4 83.64 1 58882 01122020_RID_2209_BuCaKA02.raw 0 0 0 37 65 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 541 552 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 43.03 3202.6047 29 0.2 1068.5424 3 65.06 1 43406 01122020_RID_2209_BuCaKA02.raw 2.1659E8 1 1 512 540 PEAKS DB
R.GLSLPVLDGHVTAFLG.I Y 42.79 1594.8718 16 2.7 798.4453 2 85.31 1 60432 01122020_RID_2209_BuCaKA02.raw 5.2128E8 2 2 40 55 PEAKS DB
L.NTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.22 2937.5071 25 4.0 735.3870 4 74.50 1 51499 01122020_RID_2209_BuCaKA02.raw 2.6172E8 1 1 529 553 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.13 5811.8530 52 3.1 1453.9750 4 82.20 1 57744 01122020_RID_2209_BuCaKA02.raw 1.5131E9 1 1 502 553 Carbamidomethylation C43:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLG.I Y 41.47 2510.3491 25 1.1 837.7913 3 72.55 1 49756 01122020_RID_2209_BuCaKA02.raw 2.5098E7 1 1 31 55 PEAKS DB
total 61 peptides
T_55
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 101.40 2658.4534 26 0.7 1330.2349 2 93.83 1 67305 01122020_RID_2209_BuCaKA02.raw 5.7352E10 14 14 48 73 PEAKS DB
R.AALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 96.22 2601.2791 23 0.3 1301.6472 2 41.43 1 24779 01122020_RID_2209_BuCaKA02.raw 1.888E8 2 2 276 298 Carbamidomethylation C10:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 253 273 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 420 445 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A Y 87.29 2074.0859 18 4.4 692.3723 3 60.27 1 39720 01122020_RID_2209_BuCaKA02.raw 2.2787E8 1 1 206 223 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSR.T N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 224 247 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 77.17 4072.2109 40 4.9 815.4535 5 78.62 1 54698 01122020_RID_2209_BuCaKA02.raw 1.683E9 3 3 34 73 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M Y 75.82 2601.4319 25 1.7 868.1527 3 93.27 1 66854 01122020_RID_2209_BuCaKA02.raw 9.8181E7 1 1 49 73 PEAKS DB
R.AGELKVSTQTGSVR.G Y 75.64 1431.7681 14 0.2 716.8914 2 12.05 1 2024 01122020_RID_2209_BuCaKA02.raw 2.521E6 1 1 34 47 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESR.R Y 75.41 2767.4404 26 0.6 923.4880 3 59.02 1 38537 01122020_RID_2209_BuCaKA02.raw 9.0758E7 1 1 248 273 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A Y 75.28 3034.5657 29 1.4 759.6498 4 72.55 1 49639 01122020_RID_2209_BuCaKA02.raw 4.0261E7 2 2 224 252 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 74.87 5127.6577 48 1.0 1026.5398 5 84.83 1 59856 01122020_RID_2209_BuCaKA02.raw 2.0822E7 1 1 200 247 PEAKS DB
L.KVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 71.73 3702.0256 36 5.4 926.5187 4 75.43 1 52253 01122020_RID_2209_BuCaKA02.raw 5.6822E8 4 4 38 73 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 424 444 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 70.30 3573.9307 35 9.4 715.8001 5 83.23 1 58537 01122020_RID_2209_BuCaKA02.raw 1.4423E10 7 7 39 73 PEAKS DB
V.SPGRAGELKVSTQTGSVR.G Y 70.11 1828.9755 18 0.0 610.6658 3 12.05 1 2023 01122020_RID_2209_BuCaKA02.raw 1.7435E6 1 1 30 47 PEAKS DB
R.LALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 70.03 4445.2812 42 1.3 890.0647 5 76.25 1 52778 01122020_RID_2209_BuCaKA02.raw 6.7471E7 3 3 206 247 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S Y 69.96 2174.0896 18 0.8 725.7044 3 63.32 1 42005 01122020_RID_2209_BuCaKA02.raw 2.4894E7 2 2 299 316 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPR.A Y 69.87 2756.4622 24 2.9 919.8307 3 77.23 1 53582 01122020_RID_2209_BuCaKA02.raw 2.4764E8 4 4 200 223 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 253 274 PEAKS DB
R.RAALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 65.73 2757.3801 24 2.0 690.3537 4 33.56 1 18494 01122020_RID_2209_BuCaKA02.raw 1.5928E7 1 1 275 298 Carbamidomethylation C11:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 62 73 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.32 2488.3477 24 2.0 830.4581 3 86.79 1 61552 01122020_RID_2209_BuCaKA02.raw 8.1857E7 1 1 50 73 PEAKS DB
V.STQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.11 3474.8623 34 6.8 869.7288 4 82.73 1 58133 01122020_RID_2209_BuCaKA02.raw 0 0 0 40 73 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 63.72 4199.0557 39 1.2 1400.6942 3 59.70 1 39174 01122020_RID_2209_BuCaKA02.raw 1.0279E9 3 3 510 548 PEAKS DB
R.GLSLPVLDGHVTAFL.G Y 63.72 1537.8503 15 1.7 769.9337 2 87.38 1 62023 01122020_RID_2209_BuCaKA02.raw 1.6202E7 1 1 48 62 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAF.L Y 63.61 2340.2437 23 0.9 1171.1301 2 64.35 1 42978 01122020_RID_2209_BuCaKA02.raw 5.93E8 2 2 39 61 PEAKS DB
L.PVLDGHVTAFLGIPFAEPPVGR.M Y 63.60 2288.2317 22 2.5 763.7531 3 79.31 1 55332 01122020_RID_2209_BuCaKA02.raw 3.4806E6 1 1 52 73 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESRR.R Y 62.58 2923.5415 27 -0.7 731.8922 4 49.01 1 30339 01122020_RID_2209_BuCaKA02.raw 0 0 0 248 274 PEAKS DB
S.LPVLDGHVTAFLGIPFAEPPVGR.M Y 62.25 2401.3157 23 2.2 801.4476 3 85.81 1 60666 01122020_RID_2209_BuCaKA02.raw 1.1292E7 1 1 51 73 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 61 73 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 62.05 2047.9204 17 0.7 683.6479 3 34.95 1 19633 01122020_RID_2209_BuCaKA02.raw 7.1157E7 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.ATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 60.92 2384.2212 20 2.7 795.7498 3 71.29 1 48640 01122020_RID_2209_BuCaKA02.raw 2.1393E7 2 2 542 561 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESR.R Y 60.82 5138.6357 50 0.4 1285.6667 4 83.73 1 58887 01122020_RID_2209_BuCaKA02.raw 9.1205E7 2 2 224 273 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 317 329 PEAKS DB
V.RGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 58.04 2814.5544 27 2.6 704.6477 4 82.79 1 58181 01122020_RID_2209_BuCaKA02.raw 0 0 0 47 73 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAF.L Y 57.78 2838.5239 28 0.1 710.6383 4 60.89 1 40258 01122020_RID_2209_BuCaKA02.raw 9.4408E8 5 5 34 61 PEAKS DB
D.PADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 56.43 3613.8164 33 -0.8 1205.6118 3 56.49 1 36480 01122020_RID_2209_BuCaKA02.raw 4.7617E7 1 1 516 548 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.TQPSLRAQIC(+57.02)AFWNHFLPK.L Y 56.17 2313.1841 19 0.9 579.3038 4 71.36 1 48657 01122020_RID_2209_BuCaKA02.raw 9.1707E6 2 2 543 561 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNATVDPPSADR.R Y 56.04 2980.5017 26 1.6 746.1339 4 77.71 1 54026 01122020_RID_2209_BuCaKA02.raw 0 0 0 549 574 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTAF.L Y 55.10 1424.7664 14 1.4 713.3915 2 76.68 1 53109 01122020_RID_2209_BuCaKA02.raw 6.1163E9 1 1 48 61 PEAKS DB
D.GHVTAFLGIPFAEPPVGR.M Y 53.85 1863.9995 18 1.0 622.3411 3 65.09 1 43442 01122020_RID_2209_BuCaKA02.raw 1.6562E7 1 1 56 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLN.A Y 52.39 1971.0189 16 1.1 658.0143 3 78.10 1 54392 01122020_RID_2209_BuCaKA02.raw 1.1181E8 1 1 549 564 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNA.T Y 52.28 2042.0560 17 0.9 1022.0362 2 80.05 1 56080 01122020_RID_2209_BuCaKA02.raw 4.8965E8 4 4 549 565 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTA.F Y 48.82 1277.6979 13 1.7 639.8573 2 62.03 1 40890 01122020_RID_2209_BuCaKA02.raw 8.2252E7 1 1 48 60 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGRMR.F Y 48.68 2945.5950 28 4.5 737.4093 4 85.11 1 60069 01122020_RID_2209_BuCaKA02.raw 1.6187E7 2 2 48 75 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A Y 46.40 1961.0020 17 1.8 654.6758 3 46.23 1 28435 01122020_RID_2209_BuCaKA02.raw 0 0 0 207 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
G.SVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 45.26 3000.6548 29 6.1 751.1755 4 83.64 1 58882 01122020_RID_2209_BuCaKA02.raw 0 0 0 45 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 43.03 3202.6047 29 0.2 1068.5424 3 65.06 1 43406 01122020_RID_2209_BuCaKA02.raw 2.1659E8 1 1 520 548 PEAKS DB
R.GLSLPVLDGHVTAFLG.I Y 42.79 1594.8718 16 2.7 798.4453 2 85.31 1 60432 01122020_RID_2209_BuCaKA02.raw 5.2128E8 2 2 48 63 PEAKS DB
L.NTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.22 2937.5071 25 4.0 735.3870 4 74.50 1 51499 01122020_RID_2209_BuCaKA02.raw 2.6172E8 1 1 537 561 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.13 5811.8530 52 3.1 1453.9750 4 82.20 1 57744 01122020_RID_2209_BuCaKA02.raw 1.5131E9 1 1 510 561 Carbamidomethylation C43:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLG.I Y 41.47 2510.3491 25 1.1 837.7913 3 72.55 1 49756 01122020_RID_2209_BuCaKA02.raw 2.5098E7 1 1 39 63 PEAKS DB
total 61 peptides
T_59
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 101.40 2658.4534 26 0.7 1330.2349 2 93.83 1 67305 01122020_RID_2209_BuCaKA02.raw 5.7352E10 14 14 48 73 PEAKS DB
R.AALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 96.22 2601.2791 23 0.3 1301.6472 2 41.43 1 24779 01122020_RID_2209_BuCaKA02.raw 1.888E8 2 2 276 298 Carbamidomethylation C10:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 253 273 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 420 445 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A Y 87.29 2074.0859 18 4.4 692.3723 3 60.27 1 39720 01122020_RID_2209_BuCaKA02.raw 2.2787E8 1 1 206 223 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSR.T N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 224 247 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 77.17 4072.2109 40 4.9 815.4535 5 78.62 1 54698 01122020_RID_2209_BuCaKA02.raw 1.683E9 3 3 34 73 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M Y 75.82 2601.4319 25 1.7 868.1527 3 93.27 1 66854 01122020_RID_2209_BuCaKA02.raw 9.8181E7 1 1 49 73 PEAKS DB
R.AGELKVSTQTGSVR.G Y 75.64 1431.7681 14 0.2 716.8914 2 12.05 1 2024 01122020_RID_2209_BuCaKA02.raw 2.521E6 1 1 34 47 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESR.R Y 75.41 2767.4404 26 0.6 923.4880 3 59.02 1 38537 01122020_RID_2209_BuCaKA02.raw 9.0758E7 1 1 248 273 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A Y 75.28 3034.5657 29 1.4 759.6498 4 72.55 1 49639 01122020_RID_2209_BuCaKA02.raw 4.0261E7 2 2 224 252 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 74.87 5127.6577 48 1.0 1026.5398 5 84.83 1 59856 01122020_RID_2209_BuCaKA02.raw 2.0822E7 1 1 200 247 PEAKS DB
L.KVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 71.73 3702.0256 36 5.4 926.5187 4 75.43 1 52253 01122020_RID_2209_BuCaKA02.raw 5.6822E8 4 4 38 73 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 424 444 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 70.30 3573.9307 35 9.4 715.8001 5 83.23 1 58537 01122020_RID_2209_BuCaKA02.raw 1.4423E10 7 7 39 73 PEAKS DB
V.SPGRAGELKVSTQTGSVR.G Y 70.11 1828.9755 18 0.0 610.6658 3 12.05 1 2023 01122020_RID_2209_BuCaKA02.raw 1.7435E6 1 1 30 47 PEAKS DB
R.LALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 70.03 4445.2812 42 1.3 890.0647 5 76.25 1 52778 01122020_RID_2209_BuCaKA02.raw 6.7471E7 3 3 206 247 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S Y 69.96 2174.0896 18 0.8 725.7044 3 63.32 1 42005 01122020_RID_2209_BuCaKA02.raw 2.4894E7 2 2 299 316 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPR.A Y 69.87 2756.4622 24 2.9 919.8307 3 77.23 1 53582 01122020_RID_2209_BuCaKA02.raw 2.4764E8 4 4 200 223 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 253 274 PEAKS DB
R.RAALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 65.73 2757.3801 24 2.0 690.3537 4 33.56 1 18494 01122020_RID_2209_BuCaKA02.raw 1.5928E7 1 1 275 298 Carbamidomethylation C11:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 62 73 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.32 2488.3477 24 2.0 830.4581 3 86.79 1 61552 01122020_RID_2209_BuCaKA02.raw 8.1857E7 1 1 50 73 PEAKS DB
V.STQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.11 3474.8623 34 6.8 869.7288 4 82.73 1 58133 01122020_RID_2209_BuCaKA02.raw 0 0 0 40 73 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 63.72 4199.0557 39 1.2 1400.6942 3 59.70 1 39174 01122020_RID_2209_BuCaKA02.raw 1.0279E9 3 3 510 548 PEAKS DB
R.GLSLPVLDGHVTAFL.G Y 63.72 1537.8503 15 1.7 769.9337 2 87.38 1 62023 01122020_RID_2209_BuCaKA02.raw 1.6202E7 1 1 48 62 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAF.L Y 63.61 2340.2437 23 0.9 1171.1301 2 64.35 1 42978 01122020_RID_2209_BuCaKA02.raw 5.93E8 2 2 39 61 PEAKS DB
L.PVLDGHVTAFLGIPFAEPPVGR.M Y 63.60 2288.2317 22 2.5 763.7531 3 79.31 1 55332 01122020_RID_2209_BuCaKA02.raw 3.4806E6 1 1 52 73 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESRR.R Y 62.58 2923.5415 27 -0.7 731.8922 4 49.01 1 30339 01122020_RID_2209_BuCaKA02.raw 0 0 0 248 274 PEAKS DB
S.LPVLDGHVTAFLGIPFAEPPVGR.M Y 62.25 2401.3157 23 2.2 801.4476 3 85.81 1 60666 01122020_RID_2209_BuCaKA02.raw 1.1292E7 1 1 51 73 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 61 73 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 62.05 2047.9204 17 0.7 683.6479 3 34.95 1 19633 01122020_RID_2209_BuCaKA02.raw 7.1157E7 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.ATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 60.92 2384.2212 20 2.7 795.7498 3 71.29 1 48640 01122020_RID_2209_BuCaKA02.raw 2.1393E7 2 2 542 561 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESR.R Y 60.82 5138.6357 50 0.4 1285.6667 4 83.73 1 58887 01122020_RID_2209_BuCaKA02.raw 9.1205E7 2 2 224 273 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 317 329 PEAKS DB
V.RGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 58.04 2814.5544 27 2.6 704.6477 4 82.79 1 58181 01122020_RID_2209_BuCaKA02.raw 0 0 0 47 73 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAF.L Y 57.78 2838.5239 28 0.1 710.6383 4 60.89 1 40258 01122020_RID_2209_BuCaKA02.raw 9.4408E8 5 5 34 61 PEAKS DB
D.PADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 56.43 3613.8164 33 -0.8 1205.6118 3 56.49 1 36480 01122020_RID_2209_BuCaKA02.raw 4.7617E7 1 1 516 548 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.TQPSLRAQIC(+57.02)AFWNHFLPK.L Y 56.17 2313.1841 19 0.9 579.3038 4 71.36 1 48657 01122020_RID_2209_BuCaKA02.raw 9.1707E6 2 2 543 561 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNATVDPPSADR.R Y 56.04 2980.5017 26 1.6 746.1339 4 77.71 1 54026 01122020_RID_2209_BuCaKA02.raw 0 0 0 549 574 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTAF.L Y 55.10 1424.7664 14 1.4 713.3915 2 76.68 1 53109 01122020_RID_2209_BuCaKA02.raw 6.1163E9 1 1 48 61 PEAKS DB
D.GHVTAFLGIPFAEPPVGR.M Y 53.85 1863.9995 18 1.0 622.3411 3 65.09 1 43442 01122020_RID_2209_BuCaKA02.raw 1.6562E7 1 1 56 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLN.A Y 52.39 1971.0189 16 1.1 658.0143 3 78.10 1 54392 01122020_RID_2209_BuCaKA02.raw 1.1181E8 1 1 549 564 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNA.T Y 52.28 2042.0560 17 0.9 1022.0362 2 80.05 1 56080 01122020_RID_2209_BuCaKA02.raw 4.8965E8 4 4 549 565 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTA.F Y 48.82 1277.6979 13 1.7 639.8573 2 62.03 1 40890 01122020_RID_2209_BuCaKA02.raw 8.2252E7 1 1 48 60 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGRMR.F Y 48.68 2945.5950 28 4.5 737.4093 4 85.11 1 60069 01122020_RID_2209_BuCaKA02.raw 1.6187E7 2 2 48 75 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A Y 46.40 1961.0020 17 1.8 654.6758 3 46.23 1 28435 01122020_RID_2209_BuCaKA02.raw 0 0 0 207 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
G.SVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 45.26 3000.6548 29 6.1 751.1755 4 83.64 1 58882 01122020_RID_2209_BuCaKA02.raw 0 0 0 45 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 43.03 3202.6047 29 0.2 1068.5424 3 65.06 1 43406 01122020_RID_2209_BuCaKA02.raw 2.1659E8 1 1 520 548 PEAKS DB
R.GLSLPVLDGHVTAFLG.I Y 42.79 1594.8718 16 2.7 798.4453 2 85.31 1 60432 01122020_RID_2209_BuCaKA02.raw 5.2128E8 2 2 48 63 PEAKS DB
L.NTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.22 2937.5071 25 4.0 735.3870 4 74.50 1 51499 01122020_RID_2209_BuCaKA02.raw 2.6172E8 1 1 537 561 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.13 5811.8530 52 3.1 1453.9750 4 82.20 1 57744 01122020_RID_2209_BuCaKA02.raw 1.5131E9 1 1 510 561 Carbamidomethylation C43:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLG.I Y 41.47 2510.3491 25 1.1 837.7913 3 72.55 1 49756 01122020_RID_2209_BuCaKA02.raw 2.5098E7 1 1 39 63 PEAKS DB
total 61 peptides
T_58
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 101.40 2658.4534 26 0.7 1330.2349 2 93.83 1 67305 01122020_RID_2209_BuCaKA02.raw 5.7352E10 14 14 48 73 PEAKS DB
R.AALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 96.22 2601.2791 23 0.3 1301.6472 2 41.43 1 24779 01122020_RID_2209_BuCaKA02.raw 1.888E8 2 2 276 298 Carbamidomethylation C10:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 253 273 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 420 445 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A Y 87.29 2074.0859 18 4.4 692.3723 3 60.27 1 39720 01122020_RID_2209_BuCaKA02.raw 2.2787E8 1 1 206 223 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSR.T N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 224 247 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 77.17 4072.2109 40 4.9 815.4535 5 78.62 1 54698 01122020_RID_2209_BuCaKA02.raw 1.683E9 3 3 34 73 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M Y 75.82 2601.4319 25 1.7 868.1527 3 93.27 1 66854 01122020_RID_2209_BuCaKA02.raw 9.8181E7 1 1 49 73 PEAKS DB
R.AGELKVSTQTGSVR.G Y 75.64 1431.7681 14 0.2 716.8914 2 12.05 1 2024 01122020_RID_2209_BuCaKA02.raw 2.521E6 1 1 34 47 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESR.R Y 75.41 2767.4404 26 0.6 923.4880 3 59.02 1 38537 01122020_RID_2209_BuCaKA02.raw 9.0758E7 1 1 248 273 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A Y 75.28 3034.5657 29 1.4 759.6498 4 72.55 1 49639 01122020_RID_2209_BuCaKA02.raw 4.0261E7 2 2 224 252 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 74.87 5127.6577 48 1.0 1026.5398 5 84.83 1 59856 01122020_RID_2209_BuCaKA02.raw 2.0822E7 1 1 200 247 PEAKS DB
L.KVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 71.73 3702.0256 36 5.4 926.5187 4 75.43 1 52253 01122020_RID_2209_BuCaKA02.raw 5.6822E8 4 4 38 73 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 424 444 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 70.30 3573.9307 35 9.4 715.8001 5 83.23 1 58537 01122020_RID_2209_BuCaKA02.raw 1.4423E10 7 7 39 73 PEAKS DB
V.SPGRAGELKVSTQTGSVR.G Y 70.11 1828.9755 18 0.0 610.6658 3 12.05 1 2023 01122020_RID_2209_BuCaKA02.raw 1.7435E6 1 1 30 47 PEAKS DB
R.LALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 70.03 4445.2812 42 1.3 890.0647 5 76.25 1 52778 01122020_RID_2209_BuCaKA02.raw 6.7471E7 3 3 206 247 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S Y 69.96 2174.0896 18 0.8 725.7044 3 63.32 1 42005 01122020_RID_2209_BuCaKA02.raw 2.4894E7 2 2 299 316 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPR.A Y 69.87 2756.4622 24 2.9 919.8307 3 77.23 1 53582 01122020_RID_2209_BuCaKA02.raw 2.4764E8 4 4 200 223 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 253 274 PEAKS DB
R.RAALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 65.73 2757.3801 24 2.0 690.3537 4 33.56 1 18494 01122020_RID_2209_BuCaKA02.raw 1.5928E7 1 1 275 298 Carbamidomethylation C11:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 62 73 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.32 2488.3477 24 2.0 830.4581 3 86.79 1 61552 01122020_RID_2209_BuCaKA02.raw 8.1857E7 1 1 50 73 PEAKS DB
V.STQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.11 3474.8623 34 6.8 869.7288 4 82.73 1 58133 01122020_RID_2209_BuCaKA02.raw 0 0 0 40 73 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 63.72 4199.0557 39 1.2 1400.6942 3 59.70 1 39174 01122020_RID_2209_BuCaKA02.raw 1.0279E9 3 3 510 548 PEAKS DB
R.GLSLPVLDGHVTAFL.G Y 63.72 1537.8503 15 1.7 769.9337 2 87.38 1 62023 01122020_RID_2209_BuCaKA02.raw 1.6202E7 1 1 48 62 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAF.L Y 63.61 2340.2437 23 0.9 1171.1301 2 64.35 1 42978 01122020_RID_2209_BuCaKA02.raw 5.93E8 2 2 39 61 PEAKS DB
L.PVLDGHVTAFLGIPFAEPPVGR.M Y 63.60 2288.2317 22 2.5 763.7531 3 79.31 1 55332 01122020_RID_2209_BuCaKA02.raw 3.4806E6 1 1 52 73 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESRR.R Y 62.58 2923.5415 27 -0.7 731.8922 4 49.01 1 30339 01122020_RID_2209_BuCaKA02.raw 0 0 0 248 274 PEAKS DB
S.LPVLDGHVTAFLGIPFAEPPVGR.M Y 62.25 2401.3157 23 2.2 801.4476 3 85.81 1 60666 01122020_RID_2209_BuCaKA02.raw 1.1292E7 1 1 51 73 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 61 73 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 62.05 2047.9204 17 0.7 683.6479 3 34.95 1 19633 01122020_RID_2209_BuCaKA02.raw 7.1157E7 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.ATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 60.92 2384.2212 20 2.7 795.7498 3 71.29 1 48640 01122020_RID_2209_BuCaKA02.raw 2.1393E7 2 2 542 561 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESR.R Y 60.82 5138.6357 50 0.4 1285.6667 4 83.73 1 58887 01122020_RID_2209_BuCaKA02.raw 9.1205E7 2 2 224 273 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 317 329 PEAKS DB
V.RGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 58.04 2814.5544 27 2.6 704.6477 4 82.79 1 58181 01122020_RID_2209_BuCaKA02.raw 0 0 0 47 73 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAF.L Y 57.78 2838.5239 28 0.1 710.6383 4 60.89 1 40258 01122020_RID_2209_BuCaKA02.raw 9.4408E8 5 5 34 61 PEAKS DB
D.PADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 56.43 3613.8164 33 -0.8 1205.6118 3 56.49 1 36480 01122020_RID_2209_BuCaKA02.raw 4.7617E7 1 1 516 548 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.TQPSLRAQIC(+57.02)AFWNHFLPK.L Y 56.17 2313.1841 19 0.9 579.3038 4 71.36 1 48657 01122020_RID_2209_BuCaKA02.raw 9.1707E6 2 2 543 561 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNATVDPPSADR.R Y 56.04 2980.5017 26 1.6 746.1339 4 77.71 1 54026 01122020_RID_2209_BuCaKA02.raw 0 0 0 549 574 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTAF.L Y 55.10 1424.7664 14 1.4 713.3915 2 76.68 1 53109 01122020_RID_2209_BuCaKA02.raw 6.1163E9 1 1 48 61 PEAKS DB
D.GHVTAFLGIPFAEPPVGR.M Y 53.85 1863.9995 18 1.0 622.3411 3 65.09 1 43442 01122020_RID_2209_BuCaKA02.raw 1.6562E7 1 1 56 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLN.A Y 52.39 1971.0189 16 1.1 658.0143 3 78.10 1 54392 01122020_RID_2209_BuCaKA02.raw 1.1181E8 1 1 549 564 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNA.T Y 52.28 2042.0560 17 0.9 1022.0362 2 80.05 1 56080 01122020_RID_2209_BuCaKA02.raw 4.8965E8 4 4 549 565 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTA.F Y 48.82 1277.6979 13 1.7 639.8573 2 62.03 1 40890 01122020_RID_2209_BuCaKA02.raw 8.2252E7 1 1 48 60 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGRMR.F Y 48.68 2945.5950 28 4.5 737.4093 4 85.11 1 60069 01122020_RID_2209_BuCaKA02.raw 1.6187E7 2 2 48 75 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A Y 46.40 1961.0020 17 1.8 654.6758 3 46.23 1 28435 01122020_RID_2209_BuCaKA02.raw 0 0 0 207 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
G.SVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 45.26 3000.6548 29 6.1 751.1755 4 83.64 1 58882 01122020_RID_2209_BuCaKA02.raw 0 0 0 45 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 43.03 3202.6047 29 0.2 1068.5424 3 65.06 1 43406 01122020_RID_2209_BuCaKA02.raw 2.1659E8 1 1 520 548 PEAKS DB
R.GLSLPVLDGHVTAFLG.I Y 42.79 1594.8718 16 2.7 798.4453 2 85.31 1 60432 01122020_RID_2209_BuCaKA02.raw 5.2128E8 2 2 48 63 PEAKS DB
L.NTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.22 2937.5071 25 4.0 735.3870 4 74.50 1 51499 01122020_RID_2209_BuCaKA02.raw 2.6172E8 1 1 537 561 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.13 5811.8530 52 3.1 1453.9750 4 82.20 1 57744 01122020_RID_2209_BuCaKA02.raw 1.5131E9 1 1 510 561 Carbamidomethylation C43:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLG.I Y 41.47 2510.3491 25 1.1 837.7913 3 72.55 1 49756 01122020_RID_2209_BuCaKA02.raw 2.5098E7 1 1 39 63 PEAKS DB
total 61 peptides
T_60
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 101.40 2658.4534 26 0.7 1330.2349 2 93.83 1 67305 01122020_RID_2209_BuCaKA02.raw 5.7352E10 14 14 48 73 PEAKS DB
R.AALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 96.22 2601.2791 23 0.3 1301.6472 2 41.43 1 24779 01122020_RID_2209_BuCaKA02.raw 1.888E8 2 2 276 298 Carbamidomethylation C10:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 253 273 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 420 445 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A Y 87.29 2074.0859 18 4.4 692.3723 3 60.27 1 39720 01122020_RID_2209_BuCaKA02.raw 2.2787E8 1 1 206 223 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSR.T N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 224 247 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 77.17 4072.2109 40 4.9 815.4535 5 78.62 1 54698 01122020_RID_2209_BuCaKA02.raw 1.683E9 3 3 34 73 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M Y 75.82 2601.4319 25 1.7 868.1527 3 93.27 1 66854 01122020_RID_2209_BuCaKA02.raw 9.8181E7 1 1 49 73 PEAKS DB
R.AGELKVSTQTGSVR.G Y 75.64 1431.7681 14 0.2 716.8914 2 12.05 1 2024 01122020_RID_2209_BuCaKA02.raw 2.521E6 1 1 34 47 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESR.R Y 75.41 2767.4404 26 0.6 923.4880 3 59.02 1 38537 01122020_RID_2209_BuCaKA02.raw 9.0758E7 1 1 248 273 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A Y 75.28 3034.5657 29 1.4 759.6498 4 72.55 1 49639 01122020_RID_2209_BuCaKA02.raw 4.0261E7 2 2 224 252 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 74.87 5127.6577 48 1.0 1026.5398 5 84.83 1 59856 01122020_RID_2209_BuCaKA02.raw 2.0822E7 1 1 200 247 PEAKS DB
L.KVSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 71.73 3702.0256 36 5.4 926.5187 4 75.43 1 52253 01122020_RID_2209_BuCaKA02.raw 5.6822E8 4 4 38 73 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 424 444 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 70.30 3573.9307 35 9.4 715.8001 5 83.23 1 58537 01122020_RID_2209_BuCaKA02.raw 1.4423E10 7 7 39 73 PEAKS DB
V.SPGRAGELKVSTQTGSVR.G Y 70.11 1828.9755 18 0.0 610.6658 3 12.05 1 2023 01122020_RID_2209_BuCaKA02.raw 1.7435E6 1 1 30 47 PEAKS DB
R.LALQWIQNNIHPFGGNPRAVTIFGESAGAASVGMHLLSTQSR.T Y 70.03 4445.2812 42 1.3 890.0647 5 76.25 1 52778 01122020_RID_2209_BuCaKA02.raw 6.7471E7 3 3 206 247 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S Y 69.96 2174.0896 18 0.8 725.7044 3 63.32 1 42005 01122020_RID_2209_BuCaKA02.raw 2.4894E7 2 2 299 316 PEAKS DB
M.GLLDQRLALQWIQNNIHPFGGNPR.A Y 69.87 2756.4622 24 2.9 919.8307 3 77.23 1 53582 01122020_RID_2209_BuCaKA02.raw 2.4764E8 4 4 200 223 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 253 274 PEAKS DB
R.RAALLGKQLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 65.73 2757.3801 24 2.0 690.3537 4 33.56 1 18494 01122020_RID_2209_BuCaKA02.raw 1.5928E7 1 1 275 298 Carbamidomethylation C11:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 62 73 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.32 2488.3477 24 2.0 830.4581 3 86.79 1 61552 01122020_RID_2209_BuCaKA02.raw 8.1857E7 1 1 50 73 PEAKS DB
V.STQTGSVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 65.11 3474.8623 34 6.8 869.7288 4 82.73 1 58133 01122020_RID_2209_BuCaKA02.raw 0 0 0 40 73 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 63.72 4199.0557 39 1.2 1400.6942 3 59.70 1 39174 01122020_RID_2209_BuCaKA02.raw 1.0279E9 3 3 510 548 PEAKS DB
R.GLSLPVLDGHVTAFL.G Y 63.72 1537.8503 15 1.7 769.9337 2 87.38 1 62023 01122020_RID_2209_BuCaKA02.raw 1.6202E7 1 1 48 62 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAF.L Y 63.61 2340.2437 23 0.9 1171.1301 2 64.35 1 42978 01122020_RID_2209_BuCaKA02.raw 5.93E8 2 2 39 61 PEAKS DB
L.PVLDGHVTAFLGIPFAEPPVGR.M Y 63.60 2288.2317 22 2.5 763.7531 3 79.31 1 55332 01122020_RID_2209_BuCaKA02.raw 3.4806E6 1 1 52 73 PEAKS DB
R.TLFQRAILQSGGPNAPWATVTPAESRR.R Y 62.58 2923.5415 27 -0.7 731.8922 4 49.01 1 30339 01122020_RID_2209_BuCaKA02.raw 0 0 0 248 274 PEAKS DB
S.LPVLDGHVTAFLGIPFAEPPVGR.M Y 62.25 2401.3157 23 2.2 801.4476 3 85.81 1 60666 01122020_RID_2209_BuCaKA02.raw 1.1292E7 1 1 51 73 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 61 73 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S Y 62.05 2047.9204 17 0.7 683.6479 3 34.95 1 19633 01122020_RID_2209_BuCaKA02.raw 7.1157E7 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.ATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 60.92 2384.2212 20 2.7 795.7498 3 71.29 1 48640 01122020_RID_2209_BuCaKA02.raw 2.1393E7 2 2 542 561 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESR.R Y 60.82 5138.6357 50 0.4 1285.6667 4 83.73 1 58887 01122020_RID_2209_BuCaKA02.raw 9.1205E7 2 2 224 273 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 317 329 PEAKS DB
V.RGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 58.04 2814.5544 27 2.6 704.6477 4 82.79 1 58181 01122020_RID_2209_BuCaKA02.raw 0 0 0 47 73 PEAKS DB
R.AGELKVSTQTGSVRGLSLPVLDGHVTAF.L Y 57.78 2838.5239 28 0.1 710.6383 4 60.89 1 40258 01122020_RID_2209_BuCaKA02.raw 9.4408E8 5 5 34 61 PEAKS DB
D.PADKSGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 56.43 3613.8164 33 -0.8 1205.6118 3 56.49 1 36480 01122020_RID_2209_BuCaKA02.raw 4.7617E7 1 1 516 548 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.TQPSLRAQIC(+57.02)AFWNHFLPK.L Y 56.17 2313.1841 19 0.9 579.3038 4 71.36 1 48657 01122020_RID_2209_BuCaKA02.raw 9.1707E6 2 2 543 561 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNATVDPPSADR.R Y 56.04 2980.5017 26 1.6 746.1339 4 77.71 1 54026 01122020_RID_2209_BuCaKA02.raw 0 0 0 549 574 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTAF.L Y 55.10 1424.7664 14 1.4 713.3915 2 76.68 1 53109 01122020_RID_2209_BuCaKA02.raw 6.1163E9 1 1 48 61 PEAKS DB
D.GHVTAFLGIPFAEPPVGR.M Y 53.85 1863.9995 18 1.0 622.3411 3 65.09 1 43442 01122020_RID_2209_BuCaKA02.raw 1.6562E7 1 1 56 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLN.A Y 52.39 1971.0189 16 1.1 658.0143 3 78.10 1 54392 01122020_RID_2209_BuCaKA02.raw 1.1181E8 1 1 549 564 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKLLNA.T Y 52.28 2042.0560 17 0.9 1022.0362 2 80.05 1 56080 01122020_RID_2209_BuCaKA02.raw 4.8965E8 4 4 549 565 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GLSLPVLDGHVTA.F Y 48.82 1277.6979 13 1.7 639.8573 2 62.03 1 40890 01122020_RID_2209_BuCaKA02.raw 8.2252E7 1 1 48 60 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGRMR.F Y 48.68 2945.5950 28 4.5 737.4093 4 85.11 1 60069 01122020_RID_2209_BuCaKA02.raw 1.6187E7 2 2 48 75 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A Y 46.40 1961.0020 17 1.8 654.6758 3 46.23 1 28435 01122020_RID_2209_BuCaKA02.raw 0 0 0 207 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
G.SVRGLSLPVLDGHVTAFLGIPFAEPPVGR.M Y 45.26 3000.6548 29 6.1 751.1755 4 83.64 1 58882 01122020_RID_2209_BuCaKA02.raw 0 0 0 45 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A Y 43.03 3202.6047 29 0.2 1068.5424 3 65.06 1 43406 01122020_RID_2209_BuCaKA02.raw 2.1659E8 1 1 520 548 PEAKS DB
R.GLSLPVLDGHVTAFLG.I Y 42.79 1594.8718 16 2.7 798.4453 2 85.31 1 60432 01122020_RID_2209_BuCaKA02.raw 5.2128E8 2 2 48 63 PEAKS DB
L.NTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.22 2937.5071 25 4.0 735.3870 4 74.50 1 51499 01122020_RID_2209_BuCaKA02.raw 2.6172E8 1 1 537 561 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TGNPTDPADKSGAWPTYTASQPQYVQLNTQPLATQPSLRAQIC(+57.02)AFWNHFLPK.L Y 42.13 5811.8530 52 3.1 1453.9750 4 82.20 1 57744 01122020_RID_2209_BuCaKA02.raw 1.5131E9 1 1 510 561 Carbamidomethylation C43:Carbamidomethylation:1000.00 PEAKS DB
K.VSTQTGSVRGLSLPVLDGHVTAFLG.I Y 41.47 2510.3491 25 1.1 837.7913 3 72.55 1 49756 01122020_RID_2209_BuCaKA02.raw 2.5098E7 1 1 39 63 PEAKS DB
total 61 peptides
T_46
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.IDFKGNTVGLAALGSLC(+57.02)SVKYSVAVIQDYSK.R Y 96.62 3302.7219 31 4.3 1101.9193 3 76.99 1 53318 01122020_RID_2209_BuCaKA02.raw 6.5213E8 5 5 276 306 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.IDFKGNTVGLAALGSLC(+57.02)SVK.Y Y 96.48 2049.0928 20 1.0 1025.5547 2 61.93 1 40849 01122020_RID_2209_BuCaKA02.raw 8.2934E9 3 3 276 295 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.NDNAQLLTRIDFKGNTVGLAALGSLC(+57.02)SVK.Y Y 83.77 3074.6182 29 0.6 1025.8806 3 67.59 1 45617 01122020_RID_2209_BuCaKA02.raw 8.6656E7 5 5 267 295 Carbamidomethylation C26:Carbamidomethylation:1000.00 PEAKS DB
K.GNTVGLAALGSLC(+57.02)SVK.Y N 82.54 1545.8185 16 1.2 773.9175 2 54.52 1 34666 01122020_RID_2209_BuCaKA02.raw 1.9308E8 1 1 280 295 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.YSVAVIQDYSKR.T N 82.32 1427.7408 12 1.0 714.8784 2 25.60 1 12556 01122020_RID_2209_BuCaKA02.raw 9.1389E7 1 1 296 307 PEAKS DB
K.YSVAVIQDYSK.R N 80.30 1271.6398 11 1.5 636.8281 2 35.71 1 20291 01122020_RID_2209_BuCaKA02.raw 3.0445E7 1 1 296 306 PEAKS DB
R.LNFHIALIGLEIWSKR.D N 80.23 1909.0938 16 2.1 637.3732 3 72.46 1 49569 01122020_RID_2209_BuCaKA02.raw 2.5467E7 2 2 222 237 PEAKS DB
K.GNTVGLAALGSLC(+57.02)SVKYSVAVIQDYSKR.T N 80.09 2955.5488 28 0.9 739.8951 4 67.74 1 45639 01122020_RID_2209_BuCaKA02.raw 5.8811E8 2 2 280 307 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
L.TRIDFKGNTVGLAALGSLC(+57.02)SVK.Y Y 77.54 2306.2417 22 1.3 769.7555 3 50.90 1 31805 01122020_RID_2209_BuCaKA02.raw 8.9942E7 2 2 274 295 Carbamidomethylation C19:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTILR.R N 76.43 1558.9082 13 4.2 780.4647 2 100.36 1 72488 01122020_RID_2209_BuCaKA02.raw 2.5848E8 12 12 208 220 PEAKS DB
R.RVYELVNILNTILR.R N 75.99 1715.0094 14 -0.8 572.6766 3 82.30 1 57621 01122020_RID_2209_BuCaKA02.raw 1.0959E8 2 2 207 220 PEAKS DB
L.GSLC(+57.02)SVKYSVAVIQDYSKR.T N 75.11 2159.1045 19 2.7 720.7107 3 35.42 1 20245 01122020_RID_2209_BuCaKA02.raw 4.748E7 1 1 289 307 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
G.NTVGLAALGSLC(+57.02)SVK.Y N 74.25 1488.7970 15 3.1 745.4081 2 54.18 1 34449 01122020_RID_2209_BuCaKA02.raw 3.2913E6 1 1 281 295 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
R.DKINVQSDVKATLK.S N 74.05 1557.8726 14 2.9 520.2996 3 15.58 1 4756 01122020_RID_2209_BuCaKA02.raw 1.9437E4 3 3 238 251 PEAKS DB
K.VKKYIELYMAVDNR.M Y 73.89 1740.9232 14 1.3 581.3158 3 27.71 1 14116 01122020_RID_2209_BuCaKA02.raw 7.416E6 1 1 179 192 PEAKS DB
K.GNTVGLAALGSLC(+57.02)SVKYSVAVIQDYSK.R N 73.80 2799.4475 27 0.7 934.1571 3 74.40 1 51257 01122020_RID_2209_BuCaKA02.raw 3.0528E6 1 1 280 306 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
L.AALGSLC(+57.02)SVKYSVAVIQDYSKR.T N 73.79 2414.2627 22 0.8 805.7621 3 48.80 1 30105 01122020_RID_2209_BuCaKA02.raw 4.4384E7 1 1 286 307 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.RVYELVNILNTILRR.L N 73.73 1871.1105 15 2.3 624.7122 3 74.19 1 50882 01122020_RID_2209_BuCaKA02.raw 1.819E8 2 2 207 221 PEAKS DB
S.VKYSVAVIQDYSK.R N 73.13 1498.8031 13 2.1 750.4104 2 27.40 1 14044 01122020_RID_2209_BuCaKA02.raw 9.3489E6 1 1 294 306 PEAKS DB
K.RRVYELVNILNTILR.R N 73.13 1871.1105 15 1.4 624.7117 3 72.32 1 49628 01122020_RID_2209_BuCaKA02.raw 3.7773E7 2 2 206 220 PEAKS DB
S.VKYSVAVIQDYSKR.T N 72.52 1654.9042 14 1.5 828.4606 2 21.08 1 8895 01122020_RID_2209_BuCaKA02.raw 1.795E6 1 1 294 307 PEAKS DB
G.LAALGSLC(+57.02)SVKYSVAVIQDYSKR.T N 71.17 2527.3467 23 1.6 632.8450 4 56.26 1 36281 01122020_RID_2209_BuCaKA02.raw 4.7681E6 1 1 285 307 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.NGLPC(+57.02)RNNQGYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IALMGPNVK.A N 71.08 3811.7473 33 1.5 953.9456 4 37.05 1 21303 01122020_RID_2209_BuCaKA02.raw 9.2632E8 2 2 471 503 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTILRR.L N 70.77 1715.0094 14 0.6 858.5125 2 87.67 1 62336 01122020_RID_2209_BuCaKA02.raw 7.9997E8 22 22 208 221 PEAKS DB
V.YELVNILNTILR.R N 68.64 1459.8398 12 5.3 730.9310 2 92.27 1 66192 01122020_RID_2209_BuCaKA02.raw 1.0989E8 3 3 209 220 PEAKS DB
R.VC(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 68.59 2395.0857 21 -0.1 1198.5500 2 58.89 1 38316 01122020_RID_2209_BuCaKA02.raw 4.5386E8 2 2 551 571 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
L.NFHIALIGLEIWSKR.D N 68.46 1796.0096 15 0.6 599.6775 3 64.95 1 43392 01122020_RID_2209_BuCaKA02.raw 5.4615E6 1 1 223 237 PEAKS DB
R.NNQGYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IALMGPNVK.A N 67.23 3114.4143 27 1.1 1558.2161 2 41.61 1 24894 01122020_RID_2209_BuCaKA02.raw 3.2808E8 3 3 477 503 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.YNGKC(+57.02)PTLTNQC(+57.02)IALMGPNVK.A N 65.75 2378.1545 21 0.1 1190.0847 2 36.28 1 20814 01122020_RID_2209_BuCaKA02.raw 6.173E7 1 1 483 503 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
I.ALIGLEIWSK.R N 61.16 1128.6543 10 0.6 565.3348 2 67.13 1 45199 01122020_RID_2209_BuCaKA02.raw 2.8404E6 1 1 227 236 PEAKS DB
H.IALIGLEIWSK.R N 61.01 1241.7383 11 4.0 621.8789 2 77.42 1 53834 01122020_RID_2209_BuCaKA02.raw 2.4633E7 1 1 226 236 PEAKS DB
K.INVQSDVKATLK.S N 60.79 1314.7507 12 1.0 658.3833 2 17.83 1 6419 01122020_RID_2209_BuCaKA02.raw 3.7588E6 1 1 240 251 PEAKS DB
R.NNQGYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IALMGPNVKASR.D N 60.31 3428.5847 30 0.6 858.1539 4 34.90 1 19665 01122020_RID_2209_BuCaKA02.raw 2.2249E7 1 1 477 506 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
H.IALIGLEIWSKR.D N 58.71 1397.8395 12 0.8 699.9276 2 62.08 1 41072 01122020_RID_2209_BuCaKA02.raw 1.3504E8 1 1 226 237 PEAKS DB
R.NGLPC(+57.02)RNNQGYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IALM(+15.99)GPNVK.A N 58.17 3827.7422 33 2.4 1276.9244 3 33.05 1 18101 01122020_RID_2209_BuCaKA02.raw 9.6615E7 2 2 471 503 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00;M28:Oxidation (M):1000.00 PEAKS DB
R.IDFKGNTVGLAALGSL.C Y 58.09 1574.8667 16 2.1 788.4423 2 74.83 1 51742 01122020_RID_2209_BuCaKA02.raw 5.7233E7 1 1 276 291 PEAKS DB
Y.ELVNILNTILR.R N 57.08 1296.7765 11 1.6 649.3965 2 83.53 1 58885 01122020_RID_2209_BuCaKA02.raw 2.3504E8 3 3 210 220 PEAKS DB
R.DSC(+57.02)FTLNQR.G N 56.35 1139.5029 9 0.9 570.7593 2 23.69 1 10975 01122020_RID_2209_BuCaKA02.raw 6.8626E6 1 1 507 515 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTILRRLNFH.I N 55.34 2226.2637 18 2.0 743.0966 3 102.90 1 75118 01122020_RID_2209_BuCaKA02.raw 1.1381E7 1 1 208 225 PEAKS DB
R.RLNFHIALIGLEIWSKR.D N 54.39 2065.1948 17 3.5 689.4080 3 63.58 1 42153 01122020_RID_2209_BuCaKA02.raw 6.407E7 1 1 221 237 PEAKS DB
K.SISDEPHSEFSSC(+57.02)SVQEHQRYLLK.D N 51.51 2862.3242 24 0.8 716.5889 4 22.77 1 10269 01122020_RID_2209_BuCaKA02.raw 4.272E6 1 1 344 367 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
V.C(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 51.10 2296.0173 20 0.1 1149.0161 2 57.12 1 36890 01122020_RID_2209_BuCaKA02.raw 4.1311E7 1 1 552 571 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTIL.R N 49.98 1402.8071 12 1.1 702.4116 2 122.78 1 90483 01122020_RID_2209_BuCaKA02.raw 4.8269E6 1 1 208 219 PEAKS DB
R.IDFKGNTVGLAALGSLC(+57.02).S Y 47.99 1734.8975 17 1.1 868.4570 2 73.26 1 50242 01122020_RID_2209_BuCaKA02.raw 3.7098E7 1 1 276 292 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
E.LVNILNTILR.R N 47.27 1167.7339 10 2.0 584.8754 2 72.87 1 49866 01122020_RID_2209_BuCaKA02.raw 2.8702E7 1 1 211 220 PEAKS DB
R.IDFKGNTVGLAALGSLC(+57.02)SVKYS.V Y 45.97 2299.1882 22 1.1 1150.6027 2 65.95 1 44235 01122020_RID_2209_BuCaKA02.raw 0 0 0 276 297 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.NNQGYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IAL.M N 44.45 2488.0933 21 1.4 1245.0557 2 45.14 1 27453 01122020_RID_2209_BuCaKA02.raw 1.2974E7 1 1 477 497 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.RVYELVNILNTIL.R N 44.30 1558.9082 13 2.4 780.4633 2 95.52 1 68628 01122020_RID_2209_BuCaKA02.raw 2.1584E6 1 1 207 219 PEAKS DB
V.YELVNILNTILRR.L N 40.63 1615.9409 13 1.1 808.9786 2 80.27 1 56086 01122020_RID_2209_BuCaKA02.raw 4.0753E6 1 1 209 221 PEAKS DB
total 49 peptides
T_35
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.ISGYILPYKIINVGSEKVGIIGYTTK.E N 97.22 2825.5942 26 1.1 707.4066 4 64.17 1 42708 01122020_RID_2209_BuCaKA02.raw 2.0622E8 2 2 168 193 PEAKS DB
K.ASGNPILLNKSIQEDPAVKAEVSR.M Y 90.98 2535.3655 24 2.3 634.8501 4 30.94 1 16417 01122020_RID_2209_BuCaKA02.raw 3.4664E7 2 2 317 340 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFKGR.E Y 87.10 2703.3445 23 1.7 902.1237 3 80.71 1 56399 01122020_RID_2209_BuCaKA02.raw 3.7945E7 2 2 91 113 PEAKS DB
K.LTTLGVNKIIALGHSGFKEDC(+57.02)R.I Y 84.69 2428.2896 22 0.5 608.0800 4 38.10 1 22251 01122020_RID_2209_BuCaKA02.raw 5.1088E6 1 1 221 242 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
R.HGQGSGELLQVSGIKVVYDLSQKPGKR.V Y 84.47 2879.5618 27 1.5 576.9205 5 37.42 1 21629 01122020_RID_2209_BuCaKA02.raw 7.7281E7 2 2 457 483 PEAKS DB
R.MKVQLQSYSSQVIGK.T Y 83.18 1694.9025 15 0.6 848.4590 2 27.68 1 14243 01122020_RID_2209_BuCaKA02.raw 1.2487E8 2 2 341 355 PEAKS DB
K.YLGYLNVIFDDKGKVIK.A Y 78.91 1984.1033 17 2.1 662.3764 3 55.49 1 35690 01122020_RID_2209_BuCaKA02.raw 2.0973E8 2 2 300 316 PEAKS DB
K.ISGYILPYKIINVGSEK.V N 78.21 1893.0610 17 2.0 632.0289 3 55.31 1 35284 01122020_RID_2209_BuCaKA02.raw 1.345E8 1 1 168 184 PEAKS DB
R.ATHRNVLLLDAGDQYQGTVWFNYFKGR.E Y 76.85 3168.5894 27 1.4 793.1558 4 61.48 1 40465 01122020_RID_2209_BuCaKA02.raw 2.5236E8 4 4 87 113 PEAKS DB
K.GPIASKISGYILPYKIINVGSEK.V Y 76.23 2446.3835 23 1.9 612.6043 4 55.41 1 35550 01122020_RID_2209_BuCaKA02.raw 6.6678E7 1 1 162 184 PEAKS DB
R.QVPVVQAYAFGK.Y N 74.86 1305.7081 12 1.9 653.8625 2 42.08 1 25183 01122020_RID_2209_BuCaKA02.raw 1.5608E7 1 1 288 299 PEAKS DB
R.ATHRNVLLLDAGDQYQGTVWFNYFK.G Y 74.70 2955.4668 25 3.4 739.8765 4 69.33 1 46967 01122020_RID_2209_BuCaKA02.raw 7.4329E7 3 3 87 111 PEAKS DB
K.SIQEDPAVKAEVSR.M Y 74.61 1527.7892 14 1.6 764.9031 2 12.11 1 2075 01122020_RID_2209_BuCaKA02.raw 8.4204E5 1 1 327 340 PEAKS DB
R.YDAMALGNHEFDNGLNGLLDPLLKNVKFPILSANIRPK.G Y 74.03 4207.2251 38 1.0 842.4531 5 84.37 1 59405 01122020_RID_2209_BuCaKA02.raw 1.2988E7 1 1 124 161 PEAKS DB
L.GNHEFDNGLNGLLDPLLKNVKFPILSANIRPK.G Y 73.58 3542.9360 32 0.9 709.5952 5 77.15 1 53585 01122020_RID_2209_BuCaKA02.raw 1.9863E7 2 2 130 161 PEAKS DB
G.DSSNHNSGDLDISIVSDYIKR.M Y 73.40 2334.1086 21 2.0 779.0450 3 54.19 1 34699 01122020_RID_2209_BuCaKA02.raw 9.655E7 4 4 529 549 PEAKS DB
Q.VPVVQAYAFGK.Y N 71.48 1177.6495 11 1.1 589.8327 2 38.91 1 22947 01122020_RID_2209_BuCaKA02.raw 6.1249E5 1 1 289 299 PEAKS DB
K.ETPILSNPGPYLEFR.D Y 70.08 1731.8832 15 0.1 866.9490 2 65.11 1 43441 01122020_RID_2209_BuCaKA02.raw 5.5765E7 1 1 194 208 PEAKS DB
K.YLGYLNVIFDDKGK.V Y 69.27 1643.8558 14 1.3 822.9363 2 62.23 1 41088 01122020_RID_2209_BuCaKA02.raw 2.3839E7 1 1 300 313 PEAKS DB
K.VGIIGYTTKETPILSNPGPYLEFR.D Y 69.07 2664.4163 24 0.4 889.1464 3 68.11 1 46095 01122020_RID_2209_BuCaKA02.raw 8.0267E7 1 1 185 208 PEAKS DB
A.GSFKLTILHTNDVHAR.V Y 68.98 1807.9692 16 1.6 603.6647 3 19.57 1 7750 01122020_RID_2209_BuCaKA02.raw 1.1225E7 2 2 40 55 PEAKS DB
E.TPILSNPGPYLEFR.D Y 67.29 1602.8406 14 0.8 802.4282 2 61.12 1 40259 01122020_RID_2209_BuCaKA02.raw 1.503E7 1 1 195 208 PEAKS DB
R.QVPVVQAYAFGKYLGYL.N N 67.18 1915.0243 17 0.6 958.5200 2 82.93 1 58321 01122020_RID_2209_BuCaKA02.raw 1.5413E8 2 2 288 304 PEAKS DB
K.VQLQSYSSQVIGK.T Y 63.95 1435.7671 13 1.9 718.8922 2 30.21 1 15960 01122020_RID_2209_BuCaKA02.raw 6.9334E6 1 1 343 355 PEAKS DB
R.VVSLNVLC(+57.02)TEC(+57.02)RVPTYVPLEMKK.T Y 62.65 2734.4219 23 2.4 684.6144 4 54.14 1 34480 01122020_RID_2209_BuCaKA02.raw 1.9293E7 1 1 484 506 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
M.ALGNHEFDNGLNGLLDPLLK.N Y 62.65 2149.1167 20 1.8 717.3808 3 74.49 1 51310 01122020_RID_2209_BuCaKA02.raw 1.0742E6 1 1 128 147 PEAKS DB
A.GSFKLTILHTNDVHARVEQTSR.D Y 61.69 2508.3196 22 1.1 628.0879 4 19.87 1 8002 01122020_RID_2209_BuCaKA02.raw 1.2654E7 1 1 40 61 PEAKS DB
L.GNHEFDNGLNGLLDPLLK.N Y 61.43 1964.9955 18 3.5 656.0081 3 71.62 1 48917 01122020_RID_2209_BuCaKA02.raw 0 0 0 130 147 PEAKS DB
F.DNGLNGLLDPLLK.N Y 56.77 1380.7612 13 2.0 691.3893 2 83.74 1 58962 01122020_RID_2209_BuCaKA02.raw 0 0 0 135 147 PEAKS DB
L.KGDSSNHNSGDLDISIVSDYIKR.M Y 55.54 2519.2251 23 2.1 630.8149 4 40.63 1 24203 01122020_RID_2209_BuCaKA02.raw 9.8917E6 1 1 527 549 PEAKS DB
G.DSSNHNSGDLDISIVSDYIK.R Y 55.30 2178.0076 20 -0.5 727.0095 3 65.83 1 44064 01122020_RID_2209_BuCaKA02.raw 7.3596E6 1 1 529 548 PEAKS DB
R.QVPVVQAYAFGKYLGY.L N 46.91 1801.9402 16 1.5 901.9788 2 99.81 1 72177 01122020_RID_2209_BuCaKA02.raw 2.7558E5 1 1 288 303 PEAKS DB
K.GVDVVVGGHTNT.F N 42.35 1153.5728 12 2.0 577.7948 2 17.43 1 6387 01122020_RID_2209_BuCaKA02.raw 1.2061E6 1 1 249 260 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFK.G Y 41.75 2490.2219 21 0.9 1246.1194 2 94.14 1 67510 01122020_RID_2209_BuCaKA02.raw 7.2772E5 1 1 91 111 PEAKS DB
R.QVPVVQAYAFGKYLGYLNVIFDDKGK.V Y 40.92 2931.5535 26 0.3 733.8959 4 84.28 1 59385 01122020_RID_2209_BuCaKA02.raw 1.7157E6 1 1 288 313 PEAKS DB
total 35 peptides
T_114
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TYSYTC(+57.02)TKPDLTC(+57.02)TDAAGSC(+57.02)AR.F Y 93.21 2498.0513 22 1.8 833.6925 3 22.09 1 10078 01122020_RID_2209_BuCaKA02.raw 2.0345E8 2 2 49 70 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISSSTTC(+57.02)K Y 92.17 1855.8809 17 1.5 928.9491 2 49.78 1 31251 01122020_RID_2209_BuCaKA02.raw 1.776E9 2 2 86 102 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.44 2266.9624 20 -2.4 1134.4857 2 32.64 1 17782 01122020_RID_2209_BuCaKA02.raw 3.5219E7 2 2 6 25 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.01 2138.8674 19 0.4 1070.4414 2 44.33 1 26645 01122020_RID_2209_BuCaKA02.raw 9.6633E9 3 3 7 25 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 85.01 1975.8040 18 0.4 988.9097 2 38.86 1 23078 01122020_RID_2209_BuCaKA02.raw 3.3628E9 2 2 8 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIM(+15.99)ISSSTTC(+57.02)K Y 82.39 1871.8757 17 0.8 936.9459 2 40.67 1 24331 01122020_RID_2209_BuCaKA02.raw 1.2934E8 1 1 86 102 Oxidation (M); Carbamidomethylation M9:Oxidation (M):1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGTGTPVDELDR.C N 82.21 1595.6886 15 1.6 798.8528 2 33.04 1 18122 01122020_RID_2209_BuCaKA02.raw 5.3035E8 3 3 11 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGTGTPVDELDR.C N 81.92 1758.7518 16 0.3 880.3834 2 37.99 1 22078 01122020_RID_2209_BuCaKA02.raw 4.9681E7 1 1 10 25 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 80.82 1846.8164 15 -0.1 924.4154 2 36.40 1 20993 01122020_RID_2209_BuCaKA02.raw 1.3034E10 13 13 71 85 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YDEAKKIHGC(+57.02)NPTTK.T N 80.25 2869.2041 23 1.4 574.8489 5 12.05 1 2027 01122020_RID_2209_BuCaKA02.raw 0 0 0 26 48 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 77.93 1918.7826 17 1.1 960.3996 2 38.92 1 22863 01122020_RID_2209_BuCaKA02.raw 7.0014E7 2 2 9 25 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNIGNIMISSSTTC(+57.02)K Y 75.65 2718.3179 25 0.5 907.1137 3 60.88 1 40112 01122020_RID_2209_BuCaKA02.raw 3.1585E8 2 2 78 102 Carbamidomethylation C5:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)ARFLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 75.35 2233.9854 18 2.1 559.5048 4 29.81 1 15728 01122020_RID_2209_BuCaKA02.raw 1.7382E7 1 1 68 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGTGTPVDELDR.C N 70.03 1435.6580 14 1.4 718.8373 2 31.57 1 17094 01122020_RID_2209_BuCaKA02.raw 9.8214E7 1 1 12 25 PEAKS DB
Y.LKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 69.19 2380.0464 21 0.9 794.3568 3 38.32 1 22508 01122020_RID_2209_BuCaKA02.raw 1.3586E8 1 1 5 25 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.YGGTGTPVDELDR.C N 68.14 1378.6365 13 1.7 690.3267 2 30.08 1 15917 01122020_RID_2209_BuCaKA02.raw 1.3749E8 1 1 13 25 PEAKS DB
T.TKTYSYTC(+57.02)TKPDLTC(+57.02)TDAAGSC(+57.02)AR.F Y 67.48 2727.1938 24 2.2 682.8073 4 14.35 1 3882 01122020_RID_2209_BuCaKA02.raw 6.801E6 2 2 47 70 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 66.01 3853.4846 32 0.6 1285.5029 3 41.35 1 24801 01122020_RID_2209_BuCaKA02.raw 3.1534E9 2 2 7 38 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
T.YSYTC(+57.02)TKPDLTC(+57.02)TDAAGSC(+57.02)AR.F Y 64.81 2397.0034 21 1.9 800.0099 3 20.99 1 8853 01122020_RID_2209_BuCaKA02.raw 1.9379E6 1 1 50 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02).Y N 63.90 2458.9287 21 1.8 1230.4739 2 48.28 1 29764 01122020_RID_2209_BuCaKA02.raw 8.9471E6 1 1 7 27 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNI.G N 62.47 1438.7278 13 3.0 720.3733 2 50.01 1 31149 01122020_RID_2209_BuCaKA02.raw 0 0 0 78 90 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
F.LC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 61.05 1699.7480 14 2.4 567.5913 3 22.40 1 9949 01122020_RID_2209_BuCaKA02.raw 3.0159E7 2 2 72 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.YLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 57.42 2543.1096 22 0.4 848.7108 3 42.36 1 25537 01122020_RID_2209_BuCaKA02.raw 4.2549E7 1 1 4 25 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAALC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 76 85 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
F.AKAPYNIGNIMISSSTTC(+57.02)K Y 53.57 2055.0129 19 2.3 686.0132 3 36.75 1 21219 01122020_RID_2209_BuCaKA02.raw 3.0788E6 1 1 84 102 Carbamidomethylation C18:Carbamidomethylation:1000.00 PEAKS DB
N.IMISSSTTC(+57.02)K Y 53.19 1126.5363 10 1.3 564.2761 2 12.11 1 2078 01122020_RID_2209_BuCaKA02.raw 1.1258E6 1 1 93 102 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
P.YNIGNIMISSSTTC(+57.02)K Y 51.32 1687.7909 15 1.1 844.9036 2 45.46 1 27804 01122020_RID_2209_BuCaKA02.raw 1.5758E7 1 1 88 102 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAKK.I N 50.58 3981.5796 33 0.5 996.4027 4 34.30 1 19058 01122020_RID_2209_BuCaKA02.raw 1.957E9 2 2 7 39 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMIS.S N 48.60 1191.5958 11 0.9 596.8057 2 70.10 1 47633 01122020_RID_2209_BuCaKA02.raw 3.0202E8 1 1 86 96 PEAKS DB
C.DC(+57.02)DRTAALC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 74 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)F.A N 44.26 1647.6843 13 0.5 824.8499 2 55.77 1 35810 01122020_RID_2209_BuCaKA02.raw 2.2718E7 1 1 71 83 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GGTGTPVDELDR.C N 44.26 1215.5731 12 0.2 608.7939 2 24.73 1 11888 01122020_RID_2209_BuCaKA02.raw 2.8666E5 1 1 14 25 PEAKS DB
V.DELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 41.02 2360.9097 18 2.3 591.2360 4 16.87 1 5694 01122020_RID_2209_BuCaKA02.raw 3.8429E6 1 1 21 38 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 40.59 3981.5796 33 1.7 797.3245 5 33.51 1 18445 01122020_RID_2209_BuCaKA02.raw 1.0219E8 2 2 6 38 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
WIAYLKYGC(+57.02)YC(+57.02)G.Y N 40.55 1552.6843 12 3.1 777.3518 2 53.53 1 33953 01122020_RID_2209_BuCaKA02.raw 2.1406E6 1 1 1 12 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISSSTT.C Y 40.41 1567.7552 15 0.5 784.8853 2 68.86 1 46501 01122020_RID_2209_BuCaKA02.raw 4.1472E8 1 1 86 100 PEAKS DB
D.C(+57.02)DRTAALC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 37 peptides
T_111
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SIQFAKQLHPELSEAAIKTLAK.Q Y 95.83 2422.3584 22 0.9 606.5974 4 39.52 1 23337 01122020_RID_2209_BuCaKA02.raw 8.5428E7 1 1 173 194 PEAKS DB
R.DSTALFPSIYLEIVLKSSANALKFVHHR.L Y 93.89 3155.7131 28 3.7 632.1522 5 85.50 1 60508 01122020_RID_2209_BuCaKA02.raw 2.672E8 5 5 262 289 PEAKS DB
K.QLHPELSEAAIKTLAK.Q Y 91.26 1747.9832 16 0.9 583.6688 3 29.18 1 15057 01122020_RID_2209_BuCaKA02.raw 2.4989E7 1 1 179 194 PEAKS DB
K.QLHPELSEAAIKTLAKQEYEK.A Y 87.02 2425.2852 21 0.6 607.3289 4 33.30 1 18158 01122020_RID_2209_BuCaKA02.raw 7.4059E7 1 1 179 199 PEAKS DB
R.MIPLKTFHGLGVIDWENWRPQWDR.N N 85.69 2993.5122 24 1.0 749.3861 4 69.60 1 47315 01122020_RID_2209_BuCaKA02.raw 8.6499E8 3 3 138 161 PEAKS DB
K.TFHGLGVIDWENWRPQWDRNWGSK.N N 78.24 2983.4265 24 0.5 746.8643 4 65.21 1 43525 01122020_RID_2209_BuCaKA02.raw 2.0561E8 2 2 143 166 PEAKS DB
K.HSDSNAFLHLFPDSFK.I Y 76.83 1860.8794 16 1.4 621.3013 3 54.96 1 35108 01122020_RID_2209_BuCaKA02.raw 4.1484E6 1 1 398 413 PEAKS DB
K.TFHGLGVIDWENWRPQWDRNWGSKNVYR.N N 76.82 3515.7024 28 1.7 586.9587 6 60.26 1 39703 01122020_RID_2209_BuCaKA02.raw 1.1791E8 4 4 143 170 PEAKS DB
Y.LEIVLKSSANALKFVHHR.L Y 76.61 2061.1846 18 1.5 688.0698 3 24.89 1 11998 01122020_RID_2209_BuCaKA02.raw 1.1977E7 1 1 272 289 PEAKS DB
F.HGLGVIDWENWRPQWDR.N N 74.88 2163.0398 17 1.5 722.0216 3 62.72 1 41513 01122020_RID_2209_BuCaKA02.raw 1.0693E7 1 1 145 161 PEAKS DB
M.IPLKTFHGLGVIDWENWRPQWDR.N N 74.70 2862.4717 23 2.4 716.6269 4 65.54 1 43835 01122020_RID_2209_BuCaKA02.raw 3.7443E7 2 2 139 161 PEAKS DB
T.FHGLGVIDWENWRPQWDRNWGSKNVYR.N N 73.07 3414.6548 27 2.4 683.9399 5 59.74 1 39259 01122020_RID_2209_BuCaKA02.raw 1.1516E7 1 1 144 170 PEAKS DB
T.FHGLGVIDWENWRPQWDRNWGSK.N N 72.71 2882.3789 23 1.0 721.6027 4 64.66 1 43174 01122020_RID_2209_BuCaKA02.raw 0 0 0 144 166 PEAKS DB
F.HGLGVIDWENWRPQWDRNWGSKNVYR.N N 72.19 3267.5862 26 1.2 654.5253 5 55.12 1 35225 01122020_RID_2209_BuCaKA02.raw 3.0043E7 1 1 145 170 PEAKS DB
K.TFHGLGVIDWENWRPQWDR.N N 70.71 2411.1560 19 0.4 603.7965 4 68.13 1 45893 01122020_RID_2209_BuCaKA02.raw 5.4873E7 2 2 143 161 PEAKS DB
R.DSTALFPSIYLEIVLKSSANALK.F Y 69.71 2479.3574 23 2.2 827.4615 3 100.06 1 72446 01122020_RID_2209_BuCaKA02.raw 3.7541E6 1 1 262 284 PEAKS DB
R.M(+15.99)IPLKTFHGLGVIDWENWRPQWDR.N N 68.57 3009.5071 24 0.5 753.3844 4 66.33 1 44566 01122020_RID_2209_BuCaKA02.raw 1.1028E7 1 1 138 161 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
F.HGLGVIDWENWRPQWDRNWGSK.N N 65.22 2735.3105 22 1.7 684.8361 4 60.91 1 39964 01122020_RID_2209_BuCaKA02.raw 7.3967E7 1 1 145 166 PEAKS DB
P.SIEISRNDQLLWLWR.D Y 63.12 1928.0269 15 1.8 643.6841 3 69.84 1 47430 01122020_RID_2209_BuCaKA02.raw 7.9751E6 1 1 247 261 PEAKS DB
K.APMYPNEPFLVFWNAPTTQC(+57.02)QMR.Y Y 62.84 2797.2815 23 -0.7 933.4338 3 85.49 1 60433 01122020_RID_2209_BuCaKA02.raw 5.5217E6 1 1 46 68 Carbamidomethylation C20:Carbamidomethylation:1000.00 PEAKS DB
R.NDQLLWLWR.D N 61.56 1242.6509 9 1.8 622.3339 2 76.01 1 52505 01122020_RID_2209_BuCaKA02.raw 1.468E7 1 1 253 261 PEAKS DB
R.DTLLLAENMRPDGYWGYYLYPDC(+57.02)YNYNYK.K N 61.22 3669.6221 29 1.5 1224.2164 3 86.29 1 61045 01122020_RID_2209_BuCaKA02.raw 4.3071E7 2 2 207 235 Carbamidomethylation C23:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PSIEISRNDQLLWLWR.D Y 60.26 2185.1101 17 0.8 729.3779 3 71.20 1 48584 01122020_RID_2209_BuCaKA02.raw 7.1936E6 1 1 245 261 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.VASLARQDYALPVFVYARPFYA.Y Y 60.21 2516.3215 22 2.3 839.7831 3 75.70 1 52457 01122020_RID_2209_BuCaKA02.raw 2.2803E7 1 1 296 317 PEAKS DB
R.YKVDLDLK.T N 55.02 992.5542 8 1.5 497.2851 2 23.86 1 11231 01122020_RID_2209_BuCaKA02.raw 0 0 0 69 76 PEAKS DB
R.M(+15.99)IPLKTFHGLGVIDWENWRPQWDRNWGSK.N N 55.02 3581.7778 29 1.1 717.3636 5 64.61 1 43066 01122020_RID_2209_BuCaKA02.raw 2.3034E7 1 1 138 166 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
R.DSTALFPSIYLEIVLK.S Y 54.49 1807.9971 16 1.1 905.0068 2 106.33 1 77525 01122020_RID_2209_BuCaKA02.raw 4.1484E6 1 1 262 277 PEAKS DB
M.IPLKTFHGLGVIDWENWRPQWDRNWGSK.N N 52.42 3434.7424 28 0.1 687.9558 5 63.88 1 42447 01122020_RID_2209_BuCaKA02.raw 3.5454E7 1 1 139 166 PEAKS DB
K.KPEQYTGKC(+57.02)PSIEISRNDQLLWLWR.D Y 50.64 3116.5864 25 0.2 624.3247 5 52.91 1 33463 01122020_RID_2209_BuCaKA02.raw 0 0 0 237 261 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.MIPLKTFHGLGVIDWENWRPQWDRNWGSK.N N 50.45 3565.7830 29 1.2 714.1647 5 67.46 1 45659 01122020_RID_2209_BuCaKA02.raw 8.4748E8 1 1 138 166 PEAKS DB
G.VIDWENWRPQWDRNWGSK.N N 49.40 2371.1245 18 0.7 593.7888 4 57.43 1 37336 01122020_RID_2209_BuCaKA02.raw 2.1347E6 1 1 149 166 PEAKS DB
R.DSTALFPSIYL.E N 44.29 1225.6230 11 1.1 613.8195 2 107.65 1 78808 01122020_RID_2209_BuCaKA02.raw 3.2385E7 1 1 262 272 PEAKS DB
K.APMYPNEPFLVF.W N 42.07 1423.6846 12 0.5 712.8499 2 95.66 1 68548 01122020_RID_2209_BuCaKA02.raw 1.165E7 1 1 46 57 PEAKS DB
N.DQLLWLWR.D N 40.81 1128.6080 8 -0.1 565.3112 2 82.89 1 58160 01122020_RID_2209_BuCaKA02.raw 2.5117E6 1 1 254 261 PEAKS DB
total 34 peptides
T_113
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.44 2266.9624 20 -2.4 1134.4857 2 32.64 1 17782 01122020_RID_2209_BuCaKA02.raw 3.5219E7 2 2 6 25 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.01 2138.8674 19 0.4 1070.4414 2 44.33 1 26645 01122020_RID_2209_BuCaKA02.raw 9.6633E9 3 3 7 25 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 85.01 1975.8040 18 0.4 988.9097 2 38.86 1 23078 01122020_RID_2209_BuCaKA02.raw 3.3628E9 2 2 8 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGTGTPVDELDR.C N 82.21 1595.6886 15 1.6 798.8528 2 33.04 1 18122 01122020_RID_2209_BuCaKA02.raw 5.3035E8 3 3 11 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGTGTPVDELDR.C N 81.92 1758.7518 16 0.3 880.3834 2 37.99 1 22078 01122020_RID_2209_BuCaKA02.raw 4.9681E7 1 1 10 25 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 80.82 1846.8164 15 -0.1 924.4154 2 36.40 1 20993 01122020_RID_2209_BuCaKA02.raw 1.3034E10 13 13 71 85 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YDEAKKIHGC(+57.02)NPTTK.T N 80.25 2869.2041 23 1.4 574.8489 5 12.05 1 2027 01122020_RID_2209_BuCaKA02.raw 0 0 0 26 48 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 77.93 1918.7826 17 1.1 960.3996 2 38.92 1 22863 01122020_RID_2209_BuCaKA02.raw 7.0014E7 2 2 9 25 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 75.35 2233.9854 18 2.1 559.5048 4 29.81 1 15728 01122020_RID_2209_BuCaKA02.raw 1.7382E7 1 1 68 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIMISASTTC(+57.02)Q Y 71.09 1853.8651 17 0.2 927.9401 2 90.37 1 64665 01122020_RID_2209_BuCaKA02.raw 5.2022E10 56 56 86 102 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
Y.NIANIMISASTTC(+57.02)Q Y 70.20 1522.7120 14 0.1 762.3634 2 65.19 1 45027 01122020_RID_2209_BuCaKA02.raw 1.8917E9 20 20 89 102 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGTGTPVDELDR.C N 70.03 1435.6580 14 1.4 718.8373 2 31.57 1 17094 01122020_RID_2209_BuCaKA02.raw 9.8214E7 1 1 12 25 PEAKS DB
Y.LKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 69.19 2380.0464 21 0.9 794.3568 3 38.32 1 22508 01122020_RID_2209_BuCaKA02.raw 1.3586E8 1 1 5 25 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.YGGTGTPVDELDR.C N 68.14 1378.6365 13 1.7 690.3267 2 30.08 1 15917 01122020_RID_2209_BuCaKA02.raw 1.3749E8 1 1 13 25 PEAKS DB
R.TAALC(+57.02)FAKAPYNIANIMISASTTC(+57.02)Q Y 67.03 2716.3022 25 1.9 1359.1610 2 81.59 1 57212 01122020_RID_2209_BuCaKA02.raw 2.7288E9 2 2 78 102 Carbamidomethylation C5:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
P.YNIANIMISASTTC(+57.02)Q Y 66.30 1685.7753 15 0.3 843.8952 2 76.73 1 53487 01122020_RID_2209_BuCaKA02.raw 2.8365E9 16 16 88 102 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 66.01 3853.4846 32 0.6 1285.5029 3 41.35 1 24801 01122020_RID_2209_BuCaKA02.raw 3.1534E9 2 2 7 38 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02).Y N 63.90 2458.9287 21 1.8 1230.4739 2 48.28 1 29764 01122020_RID_2209_BuCaKA02.raw 8.9471E6 1 1 7 27 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNI.A N 62.47 1438.7278 13 3.0 720.3733 2 50.01 1 31149 01122020_RID_2209_BuCaKA02.raw 0 0 0 78 90 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIM(+15.99)ISASTTC(+57.02)Q Y 61.76 1869.8601 17 1.2 935.9385 2 68.64 1 46719 01122020_RID_2209_BuCaKA02.raw 3.2947E9 22 22 86 102 Oxidation (M); Carbamidomethylation M9:Oxidation (M):1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
F.LC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 61.05 1699.7480 14 2.4 567.5913 3 22.40 1 9949 01122020_RID_2209_BuCaKA02.raw 3.0159E7 2 2 72 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIMISAST.T Y 60.57 1464.7283 14 0.9 733.3721 2 80.16 1 55918 01122020_RID_2209_BuCaKA02.raw 8.0527E7 1 1 86 99 PEAKS DB
K.APYNIANIMISASTT.C Y 59.17 1565.7759 15 3.2 783.8977 2 83.51 1 58681 01122020_RID_2209_BuCaKA02.raw 2.8199E10 25 25 86 100 PEAKS DB
K.APYNIANIMISAS.T Y 58.01 1363.6805 13 0.7 682.8480 2 78.43 1 55075 01122020_RID_2209_BuCaKA02.raw 9.8289E9 25 25 86 98 PEAKS DB
A.YLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 57.42 2543.1096 22 0.4 848.7108 3 42.36 1 25537 01122020_RID_2209_BuCaKA02.raw 4.2549E7 1 1 4 25 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIM(+15.99)ISASTT.C Y 55.83 1581.7709 15 0.1 791.8928 2 64.90 1 43275 01122020_RID_2209_BuCaKA02.raw 1.7458E9 6 6 86 100 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
C.DRTAALC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 76 85 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.IMISASTTC(+57.02)Q Y 53.71 1110.5050 10 2.0 556.2609 2 35.69 1 18491 01122020_RID_2209_BuCaKA02.raw 5.185E8 2 2 93 102 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIMIS.A Y 52.39 1205.6115 11 1.6 603.8140 2 74.88 1 51398 01122020_RID_2209_BuCaKA02.raw 1.5322E9 1 1 86 96 PEAKS DB
N.IM(+15.99)ISASTTC(+57.02)Q Y 51.10 1126.4999 10 1.5 564.2581 2 33.67 1 19510 01122020_RID_2209_BuCaKA02.raw 4.0201E7 1 1 93 102 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIM(+15.99)ISAS.T Y 50.91 1379.6755 13 0.1 690.8451 2 63.85 1 42803 01122020_RID_2209_BuCaKA02.raw 3.1297E8 3 3 86 98 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAKK.I N 50.58 3981.5796 33 0.5 996.4027 4 34.30 1 19058 01122020_RID_2209_BuCaKA02.raw 1.957E9 2 2 7 39 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIMISA.S Y 48.93 1276.6486 12 0.6 639.3319 2 79.20 1 55126 01122020_RID_2209_BuCaKA02.raw 1.3383E9 1 1 86 97 PEAKS DB
R.TAALC(+57.02)FAKAPYNIANIMISASTT.C Y 47.57 2428.2131 23 -0.7 1215.1130 2 82.32 1 58215 01122020_RID_2209_BuCaKA02.raw 1.3783E9 1 1 78 100 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNIAN.I Y 47.27 1623.8079 15 1.2 812.9122 2 46.24 1 28443 01122020_RID_2209_BuCaKA02.raw 0 0 0 78 92 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAALC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 74 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNIANIMIS.A Y 45.99 2068.0486 19 0.2 1035.0317 2 76.57 1 52991 01122020_RID_2209_BuCaKA02.raw 8.6302E7 1 1 78 96 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNIANIMISA.S Y 45.88 2139.0857 20 -0.1 1070.5500 2 80.07 1 55915 01122020_RID_2209_BuCaKA02.raw 1.3369E8 1 1 78 97 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)F.A N 44.26 1647.6843 13 0.5 824.8499 2 55.77 1 35810 01122020_RID_2209_BuCaKA02.raw 2.2718E7 1 1 71 83 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GGTGTPVDELDR.C N 44.26 1215.5731 12 0.2 608.7939 2 24.73 1 11888 01122020_RID_2209_BuCaKA02.raw 2.8666E5 1 1 14 25 PEAKS DB
K.APYNIANIM(+15.99)IS.A Y 43.06 1221.6063 11 0.4 611.8107 2 63.18 1 41870 01122020_RID_2209_BuCaKA02.raw 7.4486E7 1 1 86 96 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
V.DELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 41.02 2360.9097 18 2.3 591.2360 4 16.87 1 5694 01122020_RID_2209_BuCaKA02.raw 3.8429E6 1 1 21 38 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
P.YNIANIM(+15.99)ISASTTC(+57.02)Q Y 40.64 1701.7703 15 3.6 851.8954 2 78.39 1 54570 01122020_RID_2209_BuCaKA02.raw 0 0 0 88 102 Oxidation (M); Carbamidomethylation M7:Oxidation (M):1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YDEAK.K N 40.59 3981.5796 33 1.7 797.3245 5 33.51 1 18445 01122020_RID_2209_BuCaKA02.raw 1.0219E8 2 2 6 38 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
WIAYLKYGC(+57.02)YC(+57.02)G.Y N 40.55 1552.6843 12 3.1 777.3518 2 53.53 1 33953 01122020_RID_2209_BuCaKA02.raw 2.1406E6 1 1 1 12 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIANIM(+15.99)I.S Y 40.31 1134.5743 10 3.4 568.2964 2 70.39 1 47785 01122020_RID_2209_BuCaKA02.raw 3.8935E6 1 1 86 95 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.APYNIANIM(+15.99)ISA.S Y 40.13 1292.6434 12 0.7 647.3295 2 66.34 1 44699 01122020_RID_2209_BuCaKA02.raw 5.0826E7 1 1 86 97 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
D.C(+57.02)DRTAALC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 48 peptides
T_115
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGEAEKIPDC(+57.02)NPK.T Y 90.47 2628.0500 21 0.9 877.0247 3 16.44 1 5430 01122020_RID_2209_BuCaKA02.raw 3.3956E8 3 3 26 46 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.44 2266.9624 20 -2.4 1134.4857 2 32.64 1 17782 01122020_RID_2209_BuCaKA02.raw 3.5219E7 2 2 6 25 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.01 2138.8674 19 0.4 1070.4414 2 44.33 1 26645 01122020_RID_2209_BuCaKA02.raw 9.6633E9 3 3 7 25 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 85.01 1975.8040 18 0.4 988.9097 2 38.86 1 23078 01122020_RID_2209_BuCaKA02.raw 3.3628E9 2 2 8 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGTGTPVDELDR.C N 82.21 1595.6886 15 1.6 798.8528 2 33.04 1 18122 01122020_RID_2209_BuCaKA02.raw 5.3035E8 3 3 11 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGTGTPVDELDR.C N 81.92 1758.7518 16 0.3 880.3834 2 37.99 1 22078 01122020_RID_2209_BuCaKA02.raw 4.9681E7 1 1 10 25 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 80.82 1846.8164 15 -0.1 924.4154 2 36.40 1 20993 01122020_RID_2209_BuCaKA02.raw 1.3034E10 13 13 71 85 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 77.93 1918.7826 17 1.1 960.3996 2 38.92 1 22863 01122020_RID_2209_BuCaKA02.raw 7.0014E7 2 2 9 25 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 75.35 2233.9854 18 2.1 559.5048 4 29.81 1 15728 01122020_RID_2209_BuCaKA02.raw 1.7382E7 1 1 68 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGTGTPVDELDR.C N 70.03 1435.6580 14 1.4 718.8373 2 31.57 1 17094 01122020_RID_2209_BuCaKA02.raw 9.8214E7 1 1 12 25 PEAKS DB
K.APYNIGNIMISASSAC(+57.02)Q Y 69.32 1795.8232 17 0.5 898.9193 2 71.54 1 48744 01122020_RID_2209_BuCaKA02.raw 1.1272E10 12 12 86 102 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
Y.LKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 69.19 2380.0464 21 0.9 794.3568 3 38.32 1 22508 01122020_RID_2209_BuCaKA02.raw 1.3586E8 1 1 5 25 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.YGGTGTPVDELDR.C N 68.14 1378.6365 13 1.7 690.3267 2 30.08 1 15917 01122020_RID_2209_BuCaKA02.raw 1.3749E8 1 1 13 25 PEAKS DB
R.TAALC(+57.02)FAKAPYNIGNIMISASSAC(+57.02)Q Y 65.01 2658.2605 25 0.8 887.0948 3 74.14 1 51081 01122020_RID_2209_BuCaKA02.raw 7.4105E8 2 2 78 102 Carbamidomethylation C5:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGEAEKIPDC(+57.02)NPKTK.T Y 64.36 2857.1929 23 1.1 715.3063 4 12.13 1 2099 01122020_RID_2209_BuCaKA02.raw 8.1534E5 1 1 26 48 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02).Y N 63.90 2458.9287 21 1.8 1230.4739 2 48.28 1 29764 01122020_RID_2209_BuCaKA02.raw 8.9471E6 1 1 7 27 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.NIGNIMISASSAC(+57.02)Q Y 63.31 1464.6700 14 1.1 733.3431 2 56.43 1 36685 01122020_RID_2209_BuCaKA02.raw 2.8731E8 3 3 89 102 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNI.G N 62.47 1438.7278 13 3.0 720.3733 2 50.01 1 31149 01122020_RID_2209_BuCaKA02.raw 0 0 0 78 90 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
F.LC(+57.02)DC(+57.02)DRTAALC(+57.02)FAK.A N 61.05 1699.7480 14 2.4 567.5913 3 22.40 1 9949 01122020_RID_2209_BuCaKA02.raw 3.0159E7 2 2 72 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIM(+15.99)ISASSAC(+57.02)Q Y 60.45 1811.8182 17 0.9 906.9172 2 59.67 1 39709 01122020_RID_2209_BuCaKA02.raw 4.2632E8 1 1 86 102 Oxidation (M); Carbamidomethylation M9:Oxidation (M):1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISASSA.C Y 57.48 1507.7340 15 -2.9 754.8721 2 51.18 1 31949 01122020_RID_2209_BuCaKA02.raw 1.0449E10 5 5 86 100 PEAKS DB
A.YLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 57.42 2543.1096 22 0.4 848.7108 3 42.36 1 25537 01122020_RID_2209_BuCaKA02.raw 4.2549E7 1 1 4 25 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISAS.S Y 55.54 1349.6649 13 0.0 675.8397 2 72.27 1 49682 01122020_RID_2209_BuCaKA02.raw 1.2205E9 2 2 86 98 PEAKS DB
C.DRTAALC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 76 85 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGEAEKIPDC(+57.02)NPKT.K Y 52.77 2729.0979 22 2.1 683.2832 4 17.55 1 6265 01122020_RID_2209_BuCaKA02.raw 1.0249E6 1 1 26 47 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)FAKAPYNIGNIMISASSAC(+57.02)Q Y 49.52 3624.6292 32 -0.8 1209.2161 3 76.04 1 52816 01122020_RID_2209_BuCaKA02.raw 1.4982E9 2 2 71 102 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C31:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIM(+15.99)ISAS.S Y 48.61 1365.6598 13 1.3 683.8381 2 61.42 1 40518 01122020_RID_2209_BuCaKA02.raw 0 0 0 86 98 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.APYNIGNIMIS.A N 48.60 1191.5958 11 0.9 596.8057 2 70.10 1 47633 01122020_RID_2209_BuCaKA02.raw 3.0202E8 1 1 86 96 PEAKS DB
D.ELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YGEAEKIPDC(+57.02)NPK.T Y 48.14 3141.3049 25 5.7 786.3380 4 19.41 1 7734 01122020_RID_2209_BuCaKA02.raw 1.9236E6 1 1 22 46 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAALC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 74 85 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
P.YNIGNIMISASSAC(+57.02)Q Y 46.66 1627.7334 15 0.1 814.8740 2 69.24 1 46840 01122020_RID_2209_BuCaKA02.raw 4.165E8 1 1 88 102 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISASS.A Y 46.05 1436.6969 14 0.5 719.3561 2 72.07 1 49113 01122020_RID_2209_BuCaKA02.raw 3.3983E7 1 1 86 99 PEAKS DB
V.DELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YGEAEKIPDC(+57.02)NPK.T Y 44.36 3256.3318 26 1.9 815.0917 4 23.64 1 11072 01122020_RID_2209_BuCaKA02.raw 8.0747E6 1 1 21 46 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAALC(+57.02)F.A N 44.26 1647.6843 13 0.5 824.8499 2 55.77 1 35810 01122020_RID_2209_BuCaKA02.raw 2.2718E7 1 1 71 83 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GGTGTPVDELDR.C N 44.26 1215.5731 12 0.2 608.7939 2 24.73 1 11888 01122020_RID_2209_BuCaKA02.raw 2.8666E5 1 1 14 25 PEAKS DB
K.APYNIGNIM(+15.99)ISASSA.C Y 41.40 1523.7290 15 0.9 762.8724 2 60.99 1 40159 01122020_RID_2209_BuCaKA02.raw 3.4723E8 2 2 86 100 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNIGNIMISAS.S Y 41.38 2212.1021 21 1.0 1107.0594 2 74.27 1 51209 01122020_RID_2209_BuCaKA02.raw 1.3388E8 1 1 78 98 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.APYNIGNIMISA.S Y 40.97 1262.6329 12 0.8 632.3242 2 74.12 1 51059 01122020_RID_2209_BuCaKA02.raw 7.7197E8 2 2 86 97 PEAKS DB
WIAYLKYGC(+57.02)YC(+57.02)G.Y N 40.55 1552.6843 12 3.1 777.3518 2 53.53 1 33953 01122020_RID_2209_BuCaKA02.raw 2.1406E6 1 1 1 12 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)DRTAALC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 40 peptides
T_18
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.44 2266.9624 20 -2.4 1134.4857 2 32.64 1 17782 01122020_RID_2209_BuCaKA02.raw 3.5219E7 2 2 77 96 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.01 2138.8674 19 0.4 1070.4414 2 44.33 1 26645 01122020_RID_2209_BuCaKA02.raw 9.6633E9 3 3 78 96 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRPWIAYLK.Y N 87.82 1920.9702 16 0.2 961.4926 2 50.49 1 31479 01122020_RID_2209_BuCaKA02.raw 6.2231E10 47 47 62 77 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYDC(+57.02)SEGKLTC(+57.02)KDTAGTC(+57.02)ER.I N 86.11 2601.0781 22 1.5 651.2778 4 12.08 1 2046 01122020_RID_2209_BuCaKA02.raw 0 0 0 120 141 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 85.01 1975.8040 18 0.4 988.9097 2 38.86 1 23078 01122020_RID_2209_BuCaKA02.raw 3.3628E9 2 2 79 96 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGTGTPVDELDR.C N 82.21 1595.6886 15 1.6 798.8528 2 33.04 1 18122 01122020_RID_2209_BuCaKA02.raw 5.3035E8 3 3 82 96 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGTGTPVDELDR.C N 81.92 1758.7518 16 0.3 880.3834 2 37.99 1 22078 01122020_RID_2209_BuCaKA02.raw 4.9681E7 1 1 81 96 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 77.93 1918.7826 17 1.1 960.3996 2 38.92 1 22863 01122020_RID_2209_BuCaKA02.raw 7.0014E7 2 2 80 96 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQLKNMIQC(+57.02)AGTRPWIAYLK.Y Y 77.59 2680.3982 22 0.9 894.4741 3 71.26 1 48913 01122020_RID_2209_BuCaKA02.raw 5.746E10 63 63 56 77 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEKLASC(+57.02)RPYYK.T N 77.20 2909.1990 23 0.8 728.3076 4 19.12 1 7427 01122020_RID_2209_BuCaKA02.raw 4.5345E7 2 2 97 119 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
P.LNLYQLKNMIQC(+57.02)AGTRPWIAYLK.Y Y 75.69 2793.4822 23 1.0 932.1689 3 77.16 1 53378 01122020_RID_2209_BuCaKA02.raw 2.4262E8 5 5 55 77 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.NM(+15.99)IQC(+57.02)AGTRPWIAYLK.Y N 74.51 1936.9651 16 1.2 969.4910 2 42.21 1 25397 01122020_RID_2209_BuCaKA02.raw 3.1572E9 14 14 62 77 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
N.MIQC(+57.02)AGTRPWIAYLK.Y N 71.95 1806.9272 15 1.1 904.4719 2 44.83 1 27096 01122020_RID_2209_BuCaKA02.raw 1.4268E9 2 2 63 77 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRPWIAY.L N 70.22 1679.7913 14 1.4 840.9041 2 52.63 1 32999 01122020_RID_2209_BuCaKA02.raw 1.9188E9 1 1 62 75 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
M.IQC(+57.02)AGTRPWIAYLK.Y N 70.19 1675.8868 14 0.6 838.9512 2 39.82 1 23719 01122020_RID_2209_BuCaKA02.raw 1.3909E9 2 2 64 77 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGTGTPVDELDR.C N 70.03 1435.6580 14 1.4 718.8373 2 31.57 1 17094 01122020_RID_2209_BuCaKA02.raw 9.8214E7 1 1 83 96 PEAKS DB
L.YQLKNMIQC(+57.02)AGTRPWIAYLK.Y Y 69.46 2453.2712 20 1.5 818.7656 3 55.12 1 35462 01122020_RID_2209_BuCaKA02.raw 6.0347E7 1 1 58 77 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
Y.LKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 69.19 2380.0464 21 0.9 794.3568 3 38.32 1 22508 01122020_RID_2209_BuCaKA02.raw 1.3586E8 1 1 76 96 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)AGTRPWIAYLK.Y N 68.16 1562.8027 13 0.8 782.4093 2 36.01 1 20489 01122020_RID_2209_BuCaKA02.raw 3.141E7 1 1 65 77 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.YGGTGTPVDELDR.C N 68.14 1378.6365 13 1.7 690.3267 2 30.08 1 15917 01122020_RID_2209_BuCaKA02.raw 1.3749E8 1 1 84 96 PEAKS DB
L.NLYQLKNM(+15.99)IQC(+57.02)AGTRPWIAYLK.Y Y 67.77 2696.3931 22 0.6 899.8055 3 62.34 1 41258 01122020_RID_2209_BuCaKA02.raw 2.2215E9 6 6 56 77 Oxidation (M); Carbamidomethylation M8:Oxidation (M):1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.KNMIQC(+57.02)AGTRPWIAYLK.Y N 67.22 2049.0652 17 1.1 684.0298 3 37.77 1 21937 01122020_RID_2209_BuCaKA02.raw 8.2939E7 1 1 61 77 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRPWIAYL.K N 65.66 1792.8752 15 0.5 897.4453 2 70.83 1 48151 01122020_RID_2209_BuCaKA02.raw 1.1174E9 2 2 62 76 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02).Q N 63.90 2458.9287 21 1.8 1230.4739 2 48.28 1 29764 01122020_RID_2209_BuCaKA02.raw 8.9471E6 1 1 78 98 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQLKNMIQC(+57.02)AGTRPWIAYLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C Y 57.62 4801.2549 41 2.1 961.2603 5 73.99 1 51011 01122020_RID_2209_BuCaKA02.raw 5.1197E9 2 2 56 96 Carbamidomethylation C11:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
A.YLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 57.42 2543.1096 22 0.4 848.7108 3 42.36 1 25537 01122020_RID_2209_BuCaKA02.raw 4.2549E7 1 1 75 96 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRPWIAYLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 54.44 4041.8269 35 0.5 1011.4645 4 65.21 1 43707 01122020_RID_2209_BuCaKA02.raw 4.1718E8 1 1 62 96 Carbamidomethylation C5:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRPWIA.Y N 53.98 1516.7279 13 0.1 759.3713 2 43.19 1 25942 01122020_RID_2209_BuCaKA02.raw 2.5319E7 1 1 62 74 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.GTRPWIAYLK.Y N 49.87 1203.6764 10 -0.2 602.8453 2 28.40 1 14933 01122020_RID_2209_BuCaKA02.raw 1.9541E8 2 2 68 77 PEAKS DB
K.NM(+15.99)IQC(+57.02)AGTRPWIAYL.K N 48.28 1808.8702 15 0.3 905.4426 2 63.61 1 42209 01122020_RID_2209_BuCaKA02.raw 4.458E7 1 1 62 76 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)AGTRPWIAYLK.Y N 45.87 1434.7441 12 1.2 718.3802 2 28.92 1 14936 01122020_RID_2209_BuCaKA02.raw 0 0 0 66 77 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Y.GGTGTPVDELDR.C N 44.26 1215.5731 12 0.2 608.7939 2 24.73 1 11888 01122020_RID_2209_BuCaKA02.raw 2.8666E5 1 1 85 96 PEAKS DB
K.LASC(+57.02)RPYYKTYSYDC(+57.02)SEGKLTC(+57.02)K.D N 41.20 2849.2822 23 1.6 713.3290 4 14.97 1 4367 01122020_RID_2209_BuCaKA02.raw 1.3525E6 1 1 111 133 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
total 33 peptides
T_24
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.YGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 91.39 2124.8516 19 0.2 1063.4332 2 41.66 1 24749 01122020_RID_2209_BuCaKA02.raw 2.5458E9 1 1 39 57 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.KIPGC(+57.02)NPIIKIYSYTC(+57.02)TKPNLTC(+57.02)K.D Y 88.60 2868.4700 24 0.4 574.7015 5 35.86 1 20864 01122020_RID_2209_BuCaKA02.raw 1.4414E10 4 4 71 94 Carbamidomethylation C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.TWVAYLKYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 84.57 2986.3264 26 0.8 996.4502 3 62.43 1 42011 01122020_RID_2209_BuCaKA02.raw 1.6892E9 19 19 32 57 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGSGTPVDELDR.C N 83.79 1581.6729 15 0.8 791.8444 2 29.21 1 14986 01122020_RID_2209_BuCaKA02.raw 1.287E8 1 1 43 57 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRTWVAYLK.Y N 82.79 1910.9495 16 1.4 956.4833 2 45.28 1 27489 01122020_RID_2209_BuCaKA02.raw 2.818E9 2 2 23 38 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 81.97 1961.7883 18 1.3 981.9027 2 36.23 1 20719 01122020_RID_2209_BuCaKA02.raw 1.0001E9 2 2 40 57 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFKNMIQC(+57.02)AGTRTWVAYLK.Y Y 75.59 2704.3618 22 0.9 902.4620 3 63.14 1 41909 01122020_RID_2209_BuCaKA02.raw 1.3687E10 5 5 17 38 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFKNMIQC(+57.02)AGTR.T Y 75.28 1842.8868 15 1.1 615.3036 3 39.54 1 23359 01122020_RID_2209_BuCaKA02.raw 2.9212E9 4 4 17 31 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGSGTPVDELDR.C N 74.25 1744.7362 16 1.7 873.3768 2 34.92 1 19611 01122020_RID_2209_BuCaKA02.raw 1.162E7 1 1 42 57 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 74.02 1904.7668 17 1.3 953.3920 2 36.10 1 20597 01122020_RID_2209_BuCaKA02.raw 8.7199E6 1 1 41 57 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
K.IPGC(+57.02)NPIIKIYSYTC(+57.02)TKPNLTC(+57.02)K.D Y 72.71 2740.3750 23 1.1 686.1018 4 43.76 1 26470 01122020_RID_2209_BuCaKA02.raw 7.1863E8 1 1 72 94 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGSGTPVDELDR.C N 70.31 1421.6422 14 2.0 711.8298 2 27.36 1 13794 01122020_RID_2209_BuCaKA02.raw 2.8856E7 1 1 44 57 PEAKS DB
K.IPGC(+57.02)NPIIKIYSYTC(+57.02)TKPNLTC(+57.02)KDVK.D Y 69.32 3082.5654 26 1.0 771.6494 4 38.33 1 22429 01122020_RID_2209_BuCaKA02.raw 2.5725E9 3 3 72 97 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 63.58 2252.9465 20 1.2 751.9904 3 29.85 1 15544 01122020_RID_2209_BuCaKA02.raw 8.0367E6 1 1 38 57 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFKNM(+15.99)IQC(+57.02)AGTR.T Y 61.62 1858.8818 15 1.2 620.6353 3 25.20 1 12451 01122020_RID_2209_BuCaKA02.raw 5.7286E7 3 3 17 31 Oxidation (M); Carbamidomethylation M8:Oxidation (M):1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.IPGC(+57.02)NPIIKIYS.Y Y 60.96 1373.7377 12 1.0 687.8768 2 48.28 1 29622 01122020_RID_2209_BuCaKA02.raw 4.5465E8 1 1 72 83 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
G.YGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDK.A Y 60.11 2902.1746 24 0.8 726.5515 4 23.42 1 10827 01122020_RID_2209_BuCaKA02.raw 8.9648E6 1 1 45 68 Carbamidomethylation C14:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.KIPGC(+57.02)NPIIKIYSYTC(+57.02)TKPNL.T Y 58.75 2479.2966 21 2.0 827.4412 3 44.40 1 26904 01122020_RID_2209_BuCaKA02.raw 4.7303E7 2 2 71 91 Carbamidomethylation C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
G.YGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDKAK.K Y 56.87 3101.3066 26 1.8 776.3353 4 18.74 1 7255 01122020_RID_2209_BuCaKA02.raw 5.3908E6 1 1 45 70 Carbamidomethylation C14:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDK.A Y 56.09 3662.4053 30 0.7 916.6093 4 32.67 1 17727 01122020_RID_2209_BuCaKA02.raw 2.7434E9 2 2 39 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.KIPGC(+57.02)NPIIKIYSYTC(+57.02)TKP.N Y 53.57 2252.1697 19 1.2 564.0504 4 37.55 1 21835 01122020_RID_2209_BuCaKA02.raw 2.8126E7 1 1 71 89 Carbamidomethylation C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
N.MIQC(+57.02)AGTRTWVAYLK.Y N 51.37 1796.9066 15 0.7 599.9766 3 39.91 1 23605 01122020_RID_2209_BuCaKA02.raw 2.6769E7 1 1 24 38 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.KIPGC(+57.02)NPIIKIYS.Y Y 49.49 1501.8326 13 0.9 751.9243 2 34.62 1 19408 01122020_RID_2209_BuCaKA02.raw 1.0011E9 1 1 71 83 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDKAK.K Y 47.54 3861.5374 32 0.4 966.3920 4 26.72 1 13539 01122020_RID_2209_BuCaKA02.raw 1.0723E9 3 3 39 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.IPGC(+57.02)NPIIKIYSYT.C Y 45.87 1637.8486 14 0.2 819.9318 2 58.87 1 38326 01122020_RID_2209_BuCaKA02.raw 2.7144E7 1 1 72 85 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFKNM(+15.99)IQC(+57.02)AGTRTWVAYLK.Y Y 45.66 2720.3567 22 2.0 907.7946 3 53.03 1 33500 01122020_RID_2209_BuCaKA02.raw 2.8614E8 1 1 17 38 Oxidation (M); Carbamidomethylation M8:Oxidation (M):1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.TWVAYLKYGC(+57.02)YC(+57.02)GYGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDK.A Y 43.28 4523.8804 37 0.8 1131.9783 4 49.89 1 30947 01122020_RID_2209_BuCaKA02.raw 1.1877E8 1 1 32 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
L.KYGC(+57.02)YC(+57.02)GYGGSGTPVDELDRC(+57.02)C(+57.02)YVHDHC(+57.02)YDK.A Y 40.69 3790.5002 31 1.7 948.6340 4 26.20 1 12963 01122020_RID_2209_BuCaKA02.raw 2.9172E6 1 1 38 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
K.KIPGC(+57.02)NPIIKIYSYT.C Y 39.24 1765.9436 15 1.6 589.6561 3 43.73 1 26294 01122020_RID_2209_BuCaKA02.raw 6.8151E7 1 1 71 85 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 29 peptides
Q8QFW4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.TAALC(+57.02)FGDSEYIEGHKRIDTK.R Y 95.89 2410.1587 21 2.1 603.5482 4 24.09 1 11675 01122020_RID_2209_BuCaKA02.raw 8.885E8 9 9 123 143 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHKR.I Y 89.24 2871.2737 24 1.2 718.8265 4 27.03 1 13592 01122020_RID_2209_BuCaKA02.raw 1.056E9 4 4 116 139 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHKR.I Y 87.19 1952.9050 17 1.2 651.9764 3 24.20 1 11332 01122020_RID_2209_BuCaKA02.raw 4.9017E8 7 7 123 139 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHK.R N 86.36 1796.8040 16 2.0 599.9431 3 35.10 1 20159 01122020_RID_2209_BuCaKA02.raw 1.9665E8 8 8 123 138 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.RTIIC(+57.02)YGAAGTC(+57.02)AR.I N 82.13 1568.7551 14 1.6 785.3861 2 12.20 1 2149 01122020_RID_2209_BuCaKA02.raw 1.5675E6 1 1 102 115 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHK.R Y 80.93 2715.1726 23 0.3 906.0651 3 35.89 1 20501 01122020_RID_2209_BuCaKA02.raw 1.0104E8 3 3 116 138 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.TWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 80.49 2840.1807 26 0.5 1421.0983 2 62.62 1 41742 01122020_RID_2209_BuCaKA02.raw 2.6262E9 20 20 45 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)AR.I N 74.77 1412.6541 13 1.2 707.3351 2 22.55 1 10267 01122020_RID_2209_BuCaKA02.raw 6.2731E7 1 1 103 115 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
I.VC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHKR.I Y 68.55 2758.1897 23 1.4 690.5557 4 24.21 1 11444 01122020_RID_2209_BuCaKA02.raw 1.9985E7 1 1 117 139 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNMIRYTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 67.98 4978.2280 43 1.1 1245.5657 4 87.25 1 61796 01122020_RID_2209_BuCaKA02.raw 1.3046E8 1 1 28 70 Carbamidomethylation C15:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNMIRYTIPC(+57.02)EK.T Y 66.20 2156.0581 17 3.1 1079.0397 2 78.89 1 54989 01122020_RID_2209_BuCaKA02.raw 9.0085E8 4 4 28 44 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIRYTIPC(+57.02)EK.T Y 64.25 2269.1421 18 7.9 757.3940 3 87.92 1 62471 01122020_RID_2209_BuCaKA02.raw 1.9439E7 2 2 27 44 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIR.Y Y 62.24 1377.7261 11 4.0 689.8730 2 85.73 1 60674 01122020_RID_2209_BuCaKA02.raw 6.1255E7 2 2 27 37 PEAKS DB
R.YTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 59.82 3731.5967 33 1.0 1244.8740 3 61.76 1 40700 01122020_RID_2209_BuCaKA02.raw 2.336E8 1 1 38 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.D N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 116 129 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIRYTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 58.41 5091.3120 44 1.1 1273.8367 4 92.87 1 66524 01122020_RID_2209_BuCaKA02.raw 2.7499E7 1 1 27 70 Carbamidomethylation C16:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMNMIR.Y Y 58.17 1150.5991 9 0.1 576.3069 2 68.89 1 46751 01122020_RID_2209_BuCaKA02.raw 7.3501E7 1 1 29 37 PEAKS DB
L.NLINFMNMIR.Y Y 57.74 1264.6421 10 -0.3 633.3281 2 75.88 1 52490 01122020_RID_2209_BuCaKA02.raw 1.7989E9 2 2 28 37 PEAKS DB
T.AALC(+57.02)FGDSEYIEGHK.R N 51.32 1695.7562 15 1.9 566.2604 3 33.81 1 18718 01122020_RID_2209_BuCaKA02.raw 6.276E6 1 1 124 138 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.TWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDRC(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.I Y 50.01 4611.8193 40 0.0 1153.9622 4 53.58 1 34082 01122020_RID_2209_BuCaKA02.raw 2.1039E8 1 1 45 84 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEY.I N 49.80 1232.5020 11 0.7 617.2587 2 56.34 1 36497 01122020_RID_2209_BuCaKA02.raw 8.7681E6 1 1 123 133 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.AALC(+57.02)FGDSEYIEGHKR.I Y 49.65 1851.8573 16 0.2 618.2932 3 22.81 1 10318 01122020_RID_2209_BuCaKA02.raw 3.7417E6 1 1 124 139 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEY.I N 47.92 2150.8706 18 -0.9 1076.4417 2 50.53 1 31724 01122020_RID_2209_BuCaKA02.raw 2.4211E8 2 2 116 133 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHKRIDT.K Y 46.42 2282.0637 20 -0.2 761.6951 3 32.62 1 17758 01122020_RID_2209_BuCaKA02.raw 6.7872E6 1 1 123 142 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNM(+15.99)IRYTIPC(+57.02)EK.T Y 41.14 2172.0530 17 1.5 725.0260 3 68.69 1 46519 01122020_RID_2209_BuCaKA02.raw 5.1906E5 1 1 28 44 Oxidation (M); Carbamidomethylation M8:Oxidation (M):10.42;C15:Carbamidomethylation:1000.00 PEAKS DB
total 25 peptides
AAL87003.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.TAALC(+57.02)FGDSEYIEGHKRIDTK.R Y 95.89 2410.1587 21 2.1 603.5482 4 24.09 1 11675 01122020_RID_2209_BuCaKA02.raw 8.885E8 9 9 123 143 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHKR.I Y 89.24 2871.2737 24 1.2 718.8265 4 27.03 1 13592 01122020_RID_2209_BuCaKA02.raw 1.056E9 4 4 116 139 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHKR.I Y 87.19 1952.9050 17 1.2 651.9764 3 24.20 1 11332 01122020_RID_2209_BuCaKA02.raw 4.9017E8 7 7 123 139 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHK.R N 86.36 1796.8040 16 2.0 599.9431 3 35.10 1 20159 01122020_RID_2209_BuCaKA02.raw 1.9665E8 8 8 123 138 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.RTIIC(+57.02)YGAAGTC(+57.02)AR.I N 82.13 1568.7551 14 1.6 785.3861 2 12.20 1 2149 01122020_RID_2209_BuCaKA02.raw 1.5675E6 1 1 102 115 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHK.R Y 80.93 2715.1726 23 0.3 906.0651 3 35.89 1 20501 01122020_RID_2209_BuCaKA02.raw 1.0104E8 3 3 116 138 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.TWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 80.49 2840.1807 26 0.5 1421.0983 2 62.62 1 41742 01122020_RID_2209_BuCaKA02.raw 2.6262E9 20 20 45 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)AR.I N 74.77 1412.6541 13 1.2 707.3351 2 22.55 1 10267 01122020_RID_2209_BuCaKA02.raw 6.2731E7 1 1 103 115 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
I.VC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIEGHKR.I Y 68.55 2758.1897 23 1.4 690.5557 4 24.21 1 11444 01122020_RID_2209_BuCaKA02.raw 1.9985E7 1 1 117 139 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNMIRYTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 67.98 4978.2280 43 1.1 1245.5657 4 87.25 1 61796 01122020_RID_2209_BuCaKA02.raw 1.3046E8 1 1 28 70 Carbamidomethylation C15:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNMIRYTIPC(+57.02)EK.T Y 66.20 2156.0581 17 3.1 1079.0397 2 78.89 1 54989 01122020_RID_2209_BuCaKA02.raw 9.0085E8 4 4 28 44 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIRYTIPC(+57.02)EK.T Y 64.25 2269.1421 18 7.9 757.3940 3 87.92 1 62471 01122020_RID_2209_BuCaKA02.raw 1.9439E7 2 2 27 44 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIR.Y Y 62.24 1377.7261 11 4.0 689.8730 2 85.73 1 60674 01122020_RID_2209_BuCaKA02.raw 6.1255E7 2 2 27 37 PEAKS DB
R.YTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 59.82 3731.5967 33 1.0 1244.8740 3 61.76 1 40700 01122020_RID_2209_BuCaKA02.raw 2.336E8 1 1 38 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.D N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 116 129 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMNMIRYTIPC(+57.02)EKTWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDR.C Y 58.41 5091.3120 44 1.1 1273.8367 4 92.87 1 66524 01122020_RID_2209_BuCaKA02.raw 2.7499E7 1 1 27 70 Carbamidomethylation C16:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMNMIR.Y Y 58.17 1150.5991 9 0.1 576.3069 2 68.89 1 46751 01122020_RID_2209_BuCaKA02.raw 7.3501E7 1 1 29 37 PEAKS DB
L.NLINFMNMIR.Y Y 57.74 1264.6421 10 -0.3 633.3281 2 75.88 1 52490 01122020_RID_2209_BuCaKA02.raw 1.7989E9 2 2 28 37 PEAKS DB
T.AALC(+57.02)FGDSEYIEGHK.R N 51.32 1695.7562 15 1.9 566.2604 3 33.81 1 18718 01122020_RID_2209_BuCaKA02.raw 6.276E6 1 1 124 138 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.TWGEYTNYGC(+57.02)YC(+57.02)GAGGSGTPIDALDRC(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.I Y 50.01 4611.8193 40 0.0 1153.9622 4 53.58 1 34082 01122020_RID_2209_BuCaKA02.raw 2.1039E8 1 1 45 84 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEY.I N 49.80 1232.5020 11 0.7 617.2587 2 56.34 1 36497 01122020_RID_2209_BuCaKA02.raw 8.7681E6 1 1 123 133 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.AALC(+57.02)FGDSEYIEGHKR.I Y 49.65 1851.8573 16 0.2 618.2932 3 22.81 1 10318 01122020_RID_2209_BuCaKA02.raw 3.7417E6 1 1 124 139 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEY.I N 47.92 2150.8706 18 -0.9 1076.4417 2 50.53 1 31724 01122020_RID_2209_BuCaKA02.raw 2.4211E8 2 2 116 133 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIEGHKRIDT.K Y 46.42 2282.0637 20 -0.2 761.6951 3 32.62 1 17758 01122020_RID_2209_BuCaKA02.raw 6.7872E6 1 1 123 142 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMNM(+15.99)IRYTIPC(+57.02)EK.T Y 41.14 2172.0530 17 1.5 725.0260 3 68.69 1 46519 01122020_RID_2209_BuCaKA02.raw 5.1906E5 1 1 28 44 Oxidation (M); Carbamidomethylation M8:Oxidation (M):10.42;C15:Carbamidomethylation:1000.00 PEAKS DB
total 25 peptides
T_148
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)GVSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YK.W Y 97.96 2506.0750 21 0.3 836.3658 3 26.68 1 13245 01122020_RID_2209_BuCaKA02.raw 7.5825E8 20 20 87 107 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.ITC(+57.02)SAEETFC(+57.02)YKWLNKISNER.W Y 91.10 2648.2363 21 0.8 883.7534 3 44.56 1 26919 01122020_RID_2209_BuCaKA02.raw 1.8933E9 4 4 96 116 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.ITC(+57.02)SAEETFC(+57.02)YKWLNK.I Y 86.32 2048.9336 16 0.9 1025.4750 2 41.55 1 24827 01122020_RID_2209_BuCaKA02.raw 1.6905E9 5 5 96 111 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.ITC(+57.02)SAEETFC(+57.02)YK.W Y 80.38 1507.6323 12 1.5 754.8246 2 29.61 1 17051 01122020_RID_2209_BuCaKA02.raw 3.931E9 12 12 96 107 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
V.SGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YK.W Y 75.61 2189.9543 18 2.0 730.9935 3 22.02 1 10045 01122020_RID_2209_BuCaKA02.raw 8.0458E7 1 1 90 107 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GVSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YKWLNK.I Y 72.94 3047.3762 25 1.9 762.8528 4 37.39 1 21834 01122020_RID_2209_BuCaKA02.raw 2.6744E8 7 7 87 111 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
C.SAEETFC(+57.02)YKWLNK.I Y 72.89 1674.7711 13 0.9 838.3936 2 36.08 1 20755 01122020_RID_2209_BuCaKA02.raw 6.994E7 2 2 99 111 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YKWLNK.I Y 72.52 1935.8495 15 1.7 646.2916 3 37.85 1 22124 01122020_RID_2209_BuCaKA02.raw 6.5668E8 1 1 97 111 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YK.W Y 68.26 1394.5482 11 1.6 698.2825 2 20.91 1 8803 01122020_RID_2209_BuCaKA02.raw 5.1144E8 3 3 97 107 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
L.KITC(+57.02)SAEETFC(+57.02)YK.W Y 66.22 1635.7273 13 1.9 818.8724 2 16.85 1 5761 01122020_RID_2209_BuCaKA02.raw 9.1507E5 1 1 95 107 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
S.AEETFC(+57.02)YKWLNK.I Y 65.79 1587.7391 12 1.1 794.8777 2 34.63 1 19380 01122020_RID_2209_BuCaKA02.raw 7.9532E6 1 1 100 111 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
V.SGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YKWLNK.I Y 63.54 2731.2556 22 1.0 683.8218 4 34.60 1 19346 01122020_RID_2209_BuCaKA02.raw 2.9994E7 2 2 90 111 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.DTWNVYNKC(+57.02)C(+57.02)TTNLC(+57.02)NT Y 62.80 2162.8821 17 0.8 1082.4492 2 40.48 1 24035 01122020_RID_2209_BuCaKA02.raw 5.4998E7 1 1 128 144 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YK.W Y 61.68 1293.5006 10 0.2 647.7577 2 19.26 1 7652 01122020_RID_2209_BuCaKA02.raw 7.591E7 1 1 98 107 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)TEKDTWNVYNK.C Y 61.64 1657.7406 13 1.3 829.8787 2 12.90 1 2674 01122020_RID_2209_BuCaKA02.raw 1.3091E5 1 1 123 135 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
Y.KC(+57.02)GVSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YK.W Y 61.19 2634.1699 22 1.0 659.5504 4 19.26 1 7623 01122020_RID_2209_BuCaKA02.raw 7.3883E6 2 2 86 107 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
G.VSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YKWLNK.I Y 59.80 2830.3240 23 0.8 708.5888 4 35.65 1 20294 01122020_RID_2209_BuCaKA02.raw 5.1954E6 1 1 89 111 Carbamidomethylation C4:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YKWLNK.I Y 59.08 1834.8018 14 0.3 612.6080 3 37.84 1 21964 01122020_RID_2209_BuCaKA02.raw 3.5177E7 1 1 98 111 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.SAEETFC(+57.02)YK.W Y 54.77 1133.4698 9 2.3 567.7435 2 17.03 1 5898 01122020_RID_2209_BuCaKA02.raw 2.3793E6 1 1 99 107 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
A.EETFC(+57.02)YKWLNK.I Y 50.81 1516.7020 11 2.7 759.3604 2 35.18 1 19885 01122020_RID_2209_BuCaKA02.raw 4.1897E6 1 1 101 111 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)YKC(+57.02)GVSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YK.W Y 49.85 2957.2639 24 0.9 740.3239 4 22.90 1 10592 01122020_RID_2209_BuCaKA02.raw 5.7982E6 1 1 84 107 Carbamidomethylation C1:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)TEKDTWNVYNKC(+57.02)C(+57.02)TTNLC(+57.02)NT Y 44.84 2782.1455 22 0.7 1392.0811 2 26.74 1 13356 01122020_RID_2209_BuCaKA02.raw 4.069E7 1 1 123 144 Carbamidomethylation C2:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
G.VSGC(+57.02)HLKITC(+57.02)SAEETFC(+57.02)YK.W Y 40.93 2289.0227 19 2.2 573.2642 4 23.61 1 10974 01122020_RID_2209_BuCaKA02.raw 6.558E6 1 1 89 107 Carbamidomethylation C4:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 23 peptides
ABG90492.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIER.H N 95.72 2549.0984 21 0.6 850.7073 3 45.80 1 27548 01122020_RID_2209_BuCaKA02.raw 2.6721E9 24 24 87 107 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIER.H N 82.91 1630.7297 14 1.0 816.3729 2 48.43 1 32715 01122020_RID_2209_BuCaKA02.raw 4.766E9 42 42 94 107 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIERHKNIDTK.R Y 79.76 2467.1802 21 2.0 617.8035 4 23.54 1 10850 01122020_RID_2209_BuCaKA02.raw 2.4407E8 3 3 94 114 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIERHK.N N 78.30 1895.8835 16 1.0 632.9691 3 24.86 1 11918 01122020_RID_2209_BuCaKA02.raw 1.8408E7 1 1 94 109 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GR.I N 78.18 1554.7395 14 1.6 778.3783 2 12.18 1 2117 01122020_RID_2209_BuCaKA02.raw 5.9802E6 1 1 73 86 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 76.28 1811.7566 18 1.3 906.8867 2 29.21 1 15083 01122020_RID_2209_BuCaKA02.raw 5.769E6 1 1 24 41 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
N.YGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 75.35 1974.8199 19 1.8 988.4191 2 35.54 1 20103 01122020_RID_2209_BuCaKA02.raw 4.3649E7 1 1 23 41 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
I.VC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIER.H N 74.30 2436.0144 20 1.1 813.0129 3 44.94 1 27302 01122020_RID_2209_BuCaKA02.raw 4.4364E7 5 5 88 107 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
T.AALC(+57.02)FGDSEYIER.H N 74.12 1529.6820 13 1.4 765.8494 2 45.78 1 27956 01122020_RID_2209_BuCaKA02.raw 1.7529E8 1 1 95 107 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GR.I N 70.35 1398.6384 13 1.6 700.3276 2 22.35 1 11385 01122020_RID_2209_BuCaKA02.raw 4.4986E8 7 7 74 86 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 70.23 2317.0071 20 0.8 1159.5117 2 29.20 1 15032 01122020_RID_2209_BuCaKA02.raw 1.3733E8 2 2 74 93 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
A.ALC(+57.02)FGDSEYIER.H N 69.32 1458.6449 12 1.2 730.3306 2 42.66 1 25737 01122020_RID_2209_BuCaKA02.raw 6.9107E8 2 2 96 107 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.LC(+57.02)FGDSEYIER.H N 67.09 1387.6078 11 0.4 694.8115 2 40.28 1 24144 01122020_RID_2209_BuCaKA02.raw 2.7802E8 1 1 97 107 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEYIERH.K N 65.19 1767.7886 15 1.2 590.2708 3 36.47 1 21210 01122020_RID_2209_BuCaKA02.raw 1.8861E7 6 6 94 108 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.D N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 87 100 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIERHK.N N 57.48 2814.2524 23 0.0 704.5704 4 28.24 1 14581 01122020_RID_2209_BuCaKA02.raw 0 0 0 87 109 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEYIERH.K N 56.25 2686.1575 22 0.1 896.3932 3 36.81 1 21217 01122020_RID_2209_BuCaKA02.raw 1.8955E7 3 3 87 108 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FGDSEY.I N 49.80 1232.5020 11 0.7 617.2587 2 56.34 1 36497 01122020_RID_2209_BuCaKA02.raw 8.7681E6 1 1 94 104 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 49.55 2473.1084 21 2.0 825.3784 3 21.10 1 8964 01122020_RID_2209_BuCaKA02.raw 0 0 0 73 93 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
D.RTAALC(+57.02)FGDSEYIER.H N 48.72 1786.8308 15 1.1 596.6182 3 37.20 1 21533 01122020_RID_2209_BuCaKA02.raw 3.313E6 1 1 93 107 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEY.I N 47.92 2150.8706 18 -0.9 1076.4417 2 50.53 1 31724 01122020_RID_2209_BuCaKA02.raw 2.4211E8 2 2 87 104 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 21 peptides
T_26
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.KYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.44 2266.9624 20 -2.4 1134.4857 2 32.64 1 17782 01122020_RID_2209_BuCaKA02.raw 3.5219E7 2 2 77 96 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 88.01 2138.8674 19 0.4 1070.4414 2 44.33 1 26645 01122020_RID_2209_BuCaKA02.raw 9.6633E9 3 3 78 96 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 85.01 1975.8040 18 0.4 988.9097 2 38.86 1 23078 01122020_RID_2209_BuCaKA02.raw 3.3628E9 2 2 79 96 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRTWVAYLK.Y N 82.79 1910.9495 16 1.4 956.4833 2 45.28 1 27489 01122020_RID_2209_BuCaKA02.raw 2.818E9 2 2 62 77 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGTGTPVDELDR.C N 82.21 1595.6886 15 1.6 798.8528 2 33.04 1 18122 01122020_RID_2209_BuCaKA02.raw 5.3035E8 3 3 82 96 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGTGTPVDELDR.C N 81.92 1758.7518 16 0.3 880.3834 2 37.99 1 22078 01122020_RID_2209_BuCaKA02.raw 4.9681E7 1 1 81 96 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 77.93 1918.7826 17 1.1 960.3996 2 38.92 1 22863 01122020_RID_2209_BuCaKA02.raw 7.0014E7 2 2 80 96 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQLKNMIQC(+57.02)AGTR.T Y 73.00 1808.9026 15 0.1 905.4586 2 40.35 1 23983 01122020_RID_2209_BuCaKA02.raw 1.0949E9 2 2 56 70 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGTGTPVDELDR.C N 70.03 1435.6580 14 1.4 718.8373 2 31.57 1 17094 01122020_RID_2209_BuCaKA02.raw 9.8214E7 1 1 83 96 PEAKS DB
Y.LKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 69.19 2380.0464 21 0.9 794.3568 3 38.32 1 22508 01122020_RID_2209_BuCaKA02.raw 1.3586E8 1 1 76 96 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.YGGTGTPVDELDR.C N 68.14 1378.6365 13 1.7 690.3267 2 30.08 1 15917 01122020_RID_2209_BuCaKA02.raw 1.3749E8 1 1 84 96 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02).Y N 63.90 2458.9287 21 1.8 1230.4739 2 48.28 1 29764 01122020_RID_2209_BuCaKA02.raw 8.9471E6 1 1 78 98 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.YGC(+57.02)YC(+57.02)GYGGTGTPVDELDRC(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.I N 59.99 3910.5061 33 1.2 978.6350 4 40.50 1 24038 01122020_RID_2209_BuCaKA02.raw 6.1915E7 1 1 78 110 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
A.YLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C N 57.42 2543.1096 22 0.4 848.7108 3 42.36 1 25537 01122020_RID_2209_BuCaKA02.raw 4.2549E7 1 1 75 96 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)AGTRTWVAYLKYGC(+57.02)YC(+57.02)GYGGTGTPVDELDR.C Y 56.62 3545.5803 31 -7.7 1182.8583 3 44.18 1 26637 01122020_RID_2209_BuCaKA02.raw 3.4648E8 1 1 66 96 Carbamidomethylation C1:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
N.MIQC(+57.02)AGTRTWVAYLK.Y N 51.37 1796.9066 15 0.7 599.9766 3 39.91 1 23605 01122020_RID_2209_BuCaKA02.raw 2.6769E7 1 1 63 77 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQLKNM(+15.99)IQC(+57.02)AGTR.T Y 50.36 1824.8975 15 1.9 913.4578 2 26.50 1 13225 01122020_RID_2209_BuCaKA02.raw 1.0085E7 3 3 56 70 Oxidation (M); Carbamidomethylation M8:Oxidation (M):1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
Y.GGTGTPVDELDR.C N 44.26 1215.5731 12 0.2 608.7939 2 24.73 1 11888 01122020_RID_2209_BuCaKA02.raw 2.8666E5 1 1 85 96 PEAKS DB
total 18 peptides
T_1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.RLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 91.79 1951.9027 16 0.5 976.9591 2 26.94 1 13450 01122020_RID_2209_BuCaKA02.raw 8.8567E9 19 19 74 89 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.EC(+57.02)AATC(+57.02)PPKRLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 85.25 2966.3289 25 0.7 989.7843 3 28.71 1 14858 01122020_RID_2209_BuCaKA02.raw 5.5167E10 15 15 65 89 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.LGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 84.71 1795.8015 15 0.7 898.9087 2 41.35 1 24790 01122020_RID_2209_BuCaKA02.raw 3.7267E10 18 18 75 89 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
L.TC(+57.02)ETC(+57.02)RFYTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)VK.L Y 82.26 3096.2869 25 1.2 775.0800 4 20.11 1 8332 01122020_RID_2209_BuCaKA02.raw 1.5911E8 2 2 23 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.EC(+57.02)AATC(+57.02)PPKRLGVTIL.C Y 72.50 1784.9277 16 1.1 893.4721 2 34.19 1 19114 01122020_RID_2209_BuCaKA02.raw 2.8125E8 1 1 65 80 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.C(+57.02)AATC(+57.02)PPKRLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 72.24 2837.2864 24 0.3 946.7697 3 25.27 1 12190 01122020_RID_2209_BuCaKA02.raw 1.7954E8 2 2 66 89 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
R.FYTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)VK.L Y 72.05 2288.9863 19 -0.4 1145.5000 2 20.41 1 8383 01122020_RID_2209_BuCaKA02.raw 1.8912E7 1 1 29 47 Carbamidomethylation C4:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
L.GVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 71.42 1682.7175 14 2.1 842.3678 2 25.97 1 12849 01122020_RID_2209_BuCaKA02.raw 2.9952E8 3 3 76 89 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
C.AATC(+57.02)PPKRLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 70.18 2677.2556 23 1.7 893.4274 3 23.87 1 11330 01122020_RID_2209_BuCaKA02.raw 1.5716E8 2 2 67 89 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.FYTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)VKLSWTVMR.G Y 67.12 3162.4395 26 1.5 791.6183 4 48.80 1 30169 01122020_RID_2209_BuCaKA02.raw 4.5506E7 3 3 29 54 Carbamidomethylation C4:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
A.ATC(+57.02)PPKRLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 66.55 2606.2185 22 1.4 869.7480 3 23.11 1 10513 01122020_RID_2209_BuCaKA02.raw 7.1636E7 2 2 68 89 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)PPKRLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)NR Y 65.38 2434.1338 20 -0.3 609.5405 4 20.85 1 8796 01122020_RID_2209_BuCaKA02.raw 4.0023E6 1 1 70 89 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.EC(+57.02)AATC(+57.02)PPKRLGVTILC(+57.02).C Y 61.42 1944.9584 17 0.0 973.4865 2 34.61 1 19362 01122020_RID_2209_BuCaKA02.raw 1.8188E8 2 2 65 81 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
T.LTC(+57.02)ETC(+57.02)RFYTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)VK.L Y 56.88 3209.3708 26 1.0 1070.7986 3 23.46 1 10881 01122020_RID_2209_BuCaKA02.raw 3.4967E6 1 1 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.RLGVTILC(+57.02)C(+57.02)TTDNC(+57.02)N.R Y 56.15 1795.8015 15 2.2 898.9100 2 40.43 1 24075 01122020_RID_2209_BuCaKA02.raw 0 0 0 74 88 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.FYTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)V.K Y 42.06 2160.8914 18 0.8 1081.4539 2 34.70 1 19646 01122020_RID_2209_BuCaKA02.raw 3.2555E7 1 1 29 46 Carbamidomethylation C4:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
Q8QFW3.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 85.34 2805.1548 26 0.7 936.0596 3 46.88 1 29158 01122020_RID_2209_BuCaKA02.raw 5.7132E8 3 3 45 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIRYTIPC(+57.02)DK.T Y 84.13 2157.0420 17 2.0 1079.5304 2 84.10 1 59349 01122020_RID_2209_BuCaKA02.raw 2.5457E8 5 5 28 44 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
I.RYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 78.45 3838.6562 34 0.6 960.6719 4 44.03 1 26582 01122020_RID_2209_BuCaKA02.raw 1.7456E8 3 3 37 70 Carbamidomethylation C6:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GR.I N 78.18 1554.7395 14 1.6 778.3783 2 12.18 1 2117 01122020_RID_2209_BuCaKA02.raw 5.9802E6 1 1 102 115 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 76.28 1811.7566 18 1.3 906.8867 2 29.21 1 15083 01122020_RID_2209_BuCaKA02.raw 5.769E6 1 1 53 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 75.35 1974.8199 19 1.8 988.4191 2 35.54 1 20103 01122020_RID_2209_BuCaKA02.raw 4.3649E7 1 1 52 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 73.43 4944.1860 43 0.7 1237.0547 4 83.34 1 58549 01122020_RID_2209_BuCaKA02.raw 1.1437E9 2 2 28 70 Carbamidomethylation C15:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
M.IRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 71.00 3951.7402 35 0.9 988.9432 4 47.91 1 29528 01122020_RID_2209_BuCaKA02.raw 5.3528E7 1 1 36 70 Carbamidomethylation C7:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GR.I N 70.35 1398.6384 13 1.6 700.3276 2 22.35 1 11385 01122020_RID_2209_BuCaKA02.raw 4.4986E8 7 7 103 115 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 70.23 2317.0071 20 0.8 1159.5117 2 29.20 1 15032 01122020_RID_2209_BuCaKA02.raw 1.3733E8 2 2 103 122 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIR.Y N 70.13 1279.6417 10 0.6 640.8285 2 78.90 1 54806 01122020_RID_2209_BuCaKA02.raw 2.8606E8 1 1 28 37 PEAKS DB
R.YTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 65.10 3682.5552 33 0.6 921.6466 4 51.29 1 31798 01122020_RID_2209_BuCaKA02.raw 1.1272E10 2 2 38 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.D N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 116 129 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
F.MEMIRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 58.39 4342.8638 38 1.3 1086.7246 4 55.97 1 36026 01122020_RID_2209_BuCaKA02.raw 1.6697E7 1 1 33 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMEMIR.Y N 57.43 1165.5988 9 -0.2 583.8065 2 73.46 1 50593 01122020_RID_2209_BuCaKA02.raw 5.7582E7 1 1 29 37 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.16 1181.5936 9 0.5 591.8044 2 56.54 1 36487 01122020_RID_2209_BuCaKA02.raw 3.0018E6 1 1 29 37 Oxidation (M) M5:Oxidation (M):30.83 PEAKS DB
L.NLINFMEM(+15.99)IR.Y N 54.09 1295.6366 10 2.9 648.8275 2 69.38 1 47058 01122020_RID_2209_BuCaKA02.raw 0 0 0 28 37 Oxidation (M) M8:Oxidation (M):15.73 PEAKS DB
R.TAALC(+57.02)FGDSEY.I N 49.80 1232.5020 11 0.7 617.2587 2 56.34 1 36497 01122020_RID_2209_BuCaKA02.raw 8.7681E6 1 1 123 133 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 49.55 2473.1084 21 2.0 825.3784 3 21.10 1 8964 01122020_RID_2209_BuCaKA02.raw 0 0 0 102 122 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEY.I N 47.92 2150.8706 18 -0.9 1076.4417 2 50.53 1 31724 01122020_RID_2209_BuCaKA02.raw 2.4211E8 2 2 116 133 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 20 peptides
AAL87004.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 85.34 2805.1548 26 0.7 936.0596 3 46.88 1 29158 01122020_RID_2209_BuCaKA02.raw 5.7132E8 3 3 45 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIRYTIPC(+57.02)DK.T Y 84.13 2157.0420 17 2.0 1079.5304 2 84.10 1 59349 01122020_RID_2209_BuCaKA02.raw 2.5457E8 5 5 28 44 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
I.RYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 78.45 3838.6562 34 0.6 960.6719 4 44.03 1 26582 01122020_RID_2209_BuCaKA02.raw 1.7456E8 3 3 37 70 Carbamidomethylation C6:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GR.I N 78.18 1554.7395 14 1.6 778.3783 2 12.18 1 2117 01122020_RID_2209_BuCaKA02.raw 5.9802E6 1 1 102 115 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 76.28 1811.7566 18 1.3 906.8867 2 29.21 1 15083 01122020_RID_2209_BuCaKA02.raw 5.769E6 1 1 53 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 75.35 1974.8199 19 1.8 988.4191 2 35.54 1 20103 01122020_RID_2209_BuCaKA02.raw 4.3649E7 1 1 52 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 73.43 4944.1860 43 0.7 1237.0547 4 83.34 1 58549 01122020_RID_2209_BuCaKA02.raw 1.1437E9 2 2 28 70 Carbamidomethylation C15:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
M.IRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 71.00 3951.7402 35 0.9 988.9432 4 47.91 1 29528 01122020_RID_2209_BuCaKA02.raw 5.3528E7 1 1 36 70 Carbamidomethylation C7:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GR.I N 70.35 1398.6384 13 1.6 700.3276 2 22.35 1 11385 01122020_RID_2209_BuCaKA02.raw 4.4986E8 7 7 103 115 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 70.23 2317.0071 20 0.8 1159.5117 2 29.20 1 15032 01122020_RID_2209_BuCaKA02.raw 1.3733E8 2 2 103 122 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEMIR.Y N 70.13 1279.6417 10 0.6 640.8285 2 78.90 1 54806 01122020_RID_2209_BuCaKA02.raw 2.8606E8 1 1 28 37 PEAKS DB
R.YTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 65.10 3682.5552 33 0.6 921.6466 4 51.29 1 31798 01122020_RID_2209_BuCaKA02.raw 1.1272E10 2 2 38 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.D N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 116 129 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
F.MEMIRYTIPC(+57.02)DKTWGHYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 58.39 4342.8638 38 1.3 1086.7246 4 55.97 1 36026 01122020_RID_2209_BuCaKA02.raw 1.6697E7 1 1 33 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMEMIR.Y N 57.43 1165.5988 9 -0.2 583.8065 2 73.46 1 50593 01122020_RID_2209_BuCaKA02.raw 5.7582E7 1 1 29 37 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.16 1181.5936 9 0.5 591.8044 2 56.54 1 36487 01122020_RID_2209_BuCaKA02.raw 3.0018E6 1 1 29 37 Oxidation (M) M5:Oxidation (M):30.83 PEAKS DB
L.NLINFMEM(+15.99)IR.Y N 54.09 1295.6366 10 2.9 648.8275 2 69.38 1 47058 01122020_RID_2209_BuCaKA02.raw 0 0 0 28 37 Oxidation (M) M8:Oxidation (M):15.73 PEAKS DB
R.TAALC(+57.02)FGDSEY.I N 49.80 1232.5020 11 0.7 617.2587 2 56.34 1 36497 01122020_RID_2209_BuCaKA02.raw 8.7681E6 1 1 123 133 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)GRIVC(+57.02)DC(+57.02)DR.T N 49.55 2473.1084 21 2.0 825.3784 3 21.10 1 8964 01122020_RID_2209_BuCaKA02.raw 0 0 0 102 122 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FGDSEY.I N 47.92 2150.8706 18 -0.9 1076.4417 2 50.53 1 31724 01122020_RID_2209_BuCaKA02.raw 2.4211E8 2 2 116 133 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 20 peptides
JAA74736.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.AILQSGGPNAPWATVTPAESR.R N 95.10 2122.0806 21 -0.9 1062.0466 2 52.50 1 33145 01122020_RID_2209_BuCaKA02.raw 1.3371E9 2 2 245 265 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAKR.N N 93.08 2957.4341 26 0.1 740.3659 4 70.15 1 47677 01122020_RID_2209_BuCaKA02.raw 1.6502E7 3 3 412 437 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 88.62 2801.3330 25 1.0 1401.6752 2 77.11 1 53666 01122020_RID_2209_BuCaKA02.raw 7.8726E8 2 2 412 436 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
S.AVTIFGESAGAASVGMHLLSTQSR.A N 85.30 2389.2061 24 0.3 797.4095 3 65.27 1 44229 01122020_RID_2209_BuCaKA02.raw 4.1007E8 3 3 216 239 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 82.20 3071.4771 27 0.7 768.8771 4 65.86 1 44085 01122020_RID_2209_BuCaKA02.raw 2.8252E8 1 1 410 436 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
D.DIVGDHNVIC(+57.02)PVVQFANDYAK.R N 70.32 2373.1423 21 1.2 792.0557 3 67.35 1 45397 01122020_RID_2209_BuCaKA02.raw 3.7367E7 1 1 416 436 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.AILQSGGPNAPWATVTPAESRR.R N 67.72 2278.1819 22 1.4 760.4023 3 39.81 1 23723 01122020_RID_2209_BuCaKA02.raw 7.6056E7 1 1 245 266 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 54 65 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 53 65 PEAKS DB
K.SIFRFPFVPVIDG.D N 58.74 1492.8077 13 2.3 747.4128 2 91.00 1 65018 01122020_RID_2209_BuCaKA02.raw 9.7066E6 1 1 309 321 PEAKS DB
R.GLSLPVLDGHVSAFLGIPFAEPPVGR.M Y 55.48 2644.4375 26 -1.8 1323.2236 2 94.08 1 67445 01122020_RID_2209_BuCaKA02.raw 4.0747E6 1 1 40 65 PEAKS DB
S.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.A N 45.59 2405.2009 24 3.4 802.7437 3 54.96 1 35227 01122020_RID_2209_BuCaKA02.raw 8.7978E6 1 1 216 239 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
total 12 peptides
T_84
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IEPDVDATLKSFAKWR.E Y 83.40 1874.9890 16 1.8 626.0048 3 53.89 1 34389 01122020_RID_2209_BuCaKA02.raw 2.1471E7 1 1 141 156 PEAKS DB
K.IKIEPDVDATLKSFAK.W Y 75.86 1773.9875 16 0.8 592.3369 3 43.82 1 26512 01122020_RID_2209_BuCaKA02.raw 3.6216E8 2 2 139 154 PEAKS DB
K.IEPDVDATLKSFAK.W Y 74.96 1532.8086 14 1.1 767.4124 2 44.40 1 26876 01122020_RID_2209_BuCaKA02.raw 0 0 0 141 154 PEAKS DB
K.VYGLVNHLNMIYK.S Y 72.88 1562.8279 13 1.1 782.4221 2 42.26 1 25359 01122020_RID_2209_BuCaKA02.raw 1.7514E6 1 1 107 119 PEAKS DB
K.YIELYVAVDNR.M Y 69.86 1353.6929 11 1.2 677.8545 2 56.57 1 36531 01122020_RID_2209_BuCaKA02.raw 4.5074E6 4 4 81 91 PEAKS DB
L.IGLEIWSKEDK.I Y 67.84 1316.6975 11 0.8 659.3566 2 35.97 1 20532 01122020_RID_2209_BuCaKA02.raw 1.6806E7 1 1 128 138 PEAKS DB
L.IALIGLEIWSKEDK.I Y 67.63 1613.9028 14 2.0 807.9603 2 63.43 1 42108 01122020_RID_2209_BuCaKA02.raw 5.4921E6 1 1 125 138 PEAKS DB
I.ALIGLEIWSK.E N 61.16 1128.6543 10 0.6 565.3348 2 67.13 1 45199 01122020_RID_2209_BuCaKA02.raw 2.8404E6 1 1 126 135 PEAKS DB
L.IALIGLEIWSK.E N 61.01 1241.7383 11 4.0 621.8789 2 77.42 1 53834 01122020_RID_2209_BuCaKA02.raw 2.4633E7 1 1 125 135 PEAKS DB
R.KVYGLVNHLNMIYKSLNFL.I Y 57.51 2265.2344 19 1.8 567.3169 4 71.75 1 49030 01122020_RID_2209_BuCaKA02.raw 3.4388E7 1 1 106 124 PEAKS DB
K.VYGLVNHLNMIYKSLNFL.I Y 57.01 2137.1394 18 1.9 713.3884 3 81.86 1 57396 01122020_RID_2209_BuCaKA02.raw 3.681E7 2 2 107 124 PEAKS DB
R.KVYGLVNHLNMIYK.S Y 55.55 1690.9229 14 1.5 564.6490 3 31.24 1 16739 01122020_RID_2209_BuCaKA02.raw 5.1752E6 1 1 106 119 PEAKS DB
R.KVYGLVNHLNMIYKSLNF.L Y 51.86 2152.1504 18 2.0 718.3922 3 62.40 1 41280 01122020_RID_2209_BuCaKA02.raw 0 0 0 106 123 PEAKS DB
R.YLQIKKYIEL.Y Y 43.34 1309.7645 10 0.4 655.8898 2 42.54 1 25559 01122020_RID_2209_BuCaKA02.raw 1.6512E7 1 1 75 84 PEAKS DB
L.IALIGLEIWSKEDKIK.I Y 42.41 1855.0818 16 1.4 619.3687 3 55.31 1 35484 01122020_RID_2209_BuCaKA02.raw 6.0952E6 1 1 125 140 PEAKS DB
total 15 peptides
ABN72539.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.IYFAGEYTARVHGWLDSTIKSGLTAAR.D Y 85.73 2982.5352 27 2.2 746.6427 4 62.50 1 41757 01122020_RID_2209_BuCaKA02.raw 1.0441E8 5 5 471 497 PEAKS DB
R.VHGWLDSTIKSGLTAAR.D Y 85.19 1810.9690 17 1.5 604.6645 3 36.01 1 20499 01122020_RID_2209_BuCaKA02.raw 1.1031E8 3 3 481 497 PEAKS DB
K.WSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 77.95 3628.7183 32 -1.3 1210.5785 3 86.56 1 61367 01122020_RID_2209_BuCaKA02.raw 7.9367E7 1 1 439 470 PEAKS DB
A.DIVINDLSLIHQLPK.N N 74.80 1716.9774 15 0.7 859.4966 2 66.71 1 45159 01122020_RID_2209_BuCaKA02.raw 1.2111E9 3 3 410 424 PEAKS DB
R.IYFAGEYTAR.V N 69.43 1189.5768 10 1.3 595.7964 2 33.46 1 18735 01122020_RID_2209_BuCaKA02.raw 8.9761E7 3 3 471 480 PEAKS DB
R.VAYQTPAKTLSYVTADYVIVC(+57.02)ATSR.A N 64.46 2776.4106 25 0.4 926.4779 3 63.60 1 42220 01122020_RID_2209_BuCaKA02.raw 2.3369E7 1 1 292 316 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
L.TSFTPYQFQDYSETVAAPVGR.I N 61.49 2363.1069 21 0.5 1182.5613 2 62.44 1 41443 01122020_RID_2209_BuCaKA02.raw 4.6986E7 1 1 450 470 PEAKS DB
F.GLKLNEFFQENENAWYFIR.N N 48.64 2417.1804 19 2.0 806.7357 3 77.91 1 54188 01122020_RID_2209_BuCaKA02.raw 1.6173E6 1 1 125 143 PEAKS DB
K.KWSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 45.61 3756.8132 33 5.2 940.2155 4 77.17 1 53620 01122020_RID_2209_BuCaKA02.raw 3.1936E6 1 1 438 470 PEAKS DB
K.WSLDKYTMGALTSFTPYQF.Q N 43.76 2255.0608 19 0.4 1128.5381 2 94.20 1 67517 01122020_RID_2209_BuCaKA02.raw 1.3712E7 1 1 439 457 PEAKS DB
K.FGLKLNEFFQENENAWYFIRNIR.K N 43.46 2947.4768 23 1.5 737.8776 4 82.38 1 57872 01122020_RID_2209_BuCaKA02.raw 3.2121E6 1 1 124 146 PEAKS DB
K.FGLKLNEFFQENENAWYFIR.N N 43.42 2564.2488 20 4.2 855.7604 3 85.11 1 60048 01122020_RID_2209_BuCaKA02.raw 1.0085E7 1 1 124 143 PEAKS DB
total 12 peptides
A8QL51.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.IYFAGEYTARVHGWLDSTIKSGLTAAR.D Y 85.73 2982.5352 27 2.2 746.6427 4 62.50 1 41757 01122020_RID_2209_BuCaKA02.raw 1.0441E8 5 5 471 497 PEAKS DB
R.VHGWLDSTIKSGLTAAR.D Y 85.19 1810.9690 17 1.5 604.6645 3 36.01 1 20499 01122020_RID_2209_BuCaKA02.raw 1.1031E8 3 3 481 497 PEAKS DB
K.WSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 77.95 3628.7183 32 -1.3 1210.5785 3 86.56 1 61367 01122020_RID_2209_BuCaKA02.raw 7.9367E7 1 1 439 470 PEAKS DB
A.DIVINDLSLIHQLPK.N N 74.80 1716.9774 15 0.7 859.4966 2 66.71 1 45159 01122020_RID_2209_BuCaKA02.raw 1.2111E9 3 3 410 424 PEAKS DB
R.IYFAGEYTAR.V N 69.43 1189.5768 10 1.3 595.7964 2 33.46 1 18735 01122020_RID_2209_BuCaKA02.raw 8.9761E7 3 3 471 480 PEAKS DB
R.VAYQTPAKTLSYVTADYVIVC(+57.02)ATSR.A N 64.46 2776.4106 25 0.4 926.4779 3 63.60 1 42220 01122020_RID_2209_BuCaKA02.raw 2.3369E7 1 1 292 316 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
L.TSFTPYQFQDYSETVAAPVGR.I N 61.49 2363.1069 21 0.5 1182.5613 2 62.44 1 41443 01122020_RID_2209_BuCaKA02.raw 4.6986E7 1 1 450 470 PEAKS DB
F.GLKLNEFFQENENAWYFIR.N N 48.64 2417.1804 19 2.0 806.7357 3 77.91 1 54188 01122020_RID_2209_BuCaKA02.raw 1.6173E6 1 1 125 143 PEAKS DB
K.KWSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 45.61 3756.8132 33 5.2 940.2155 4 77.17 1 53620 01122020_RID_2209_BuCaKA02.raw 3.1936E6 1 1 438 470 PEAKS DB
K.WSLDKYTMGALTSFTPYQF.Q N 43.76 2255.0608 19 0.4 1128.5381 2 94.20 1 67517 01122020_RID_2209_BuCaKA02.raw 1.3712E7 1 1 439 457 PEAKS DB
K.FGLKLNEFFQENENAWYFIRNIR.K N 43.46 2947.4768 23 1.5 737.8776 4 82.38 1 57872 01122020_RID_2209_BuCaKA02.raw 3.2121E6 1 1 124 146 PEAKS DB
K.FGLKLNEFFQENENAWYFIR.N N 43.42 2564.2488 20 4.2 855.7604 3 85.11 1 60048 01122020_RID_2209_BuCaKA02.raw 1.0085E7 1 1 124 143 PEAKS DB
total 12 peptides
ABU63164.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.YGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 91.39 2124.8516 19 0.2 1063.4332 2 41.66 1 24749 01122020_RID_2209_BuCaKA02.raw 2.5458E9 1 1 50 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGSGTPVDELDR.C N 83.79 1581.6729 15 0.8 791.8444 2 29.21 1 14986 01122020_RID_2209_BuCaKA02.raw 1.287E8 1 1 54 68 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 81.97 1961.7883 18 1.3 981.9027 2 36.23 1 20719 01122020_RID_2209_BuCaKA02.raw 1.0001E9 2 2 51 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
Y.VSYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 81.93 2310.9521 21 -0.2 1156.4832 2 46.14 1 28319 01122020_RID_2209_BuCaKA02.raw 5.5639E8 1 1 48 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGSGTPVDELDR.C N 74.25 1744.7362 16 1.7 873.3768 2 34.92 1 19611 01122020_RID_2209_BuCaKA02.raw 1.162E7 1 1 53 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 74.02 1904.7668 17 1.3 953.3920 2 36.10 1 20597 01122020_RID_2209_BuCaKA02.raw 8.7199E6 1 1 52 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGSGTPVDELDR.C N 70.31 1421.6422 14 2.0 711.8298 2 27.36 1 13794 01122020_RID_2209_BuCaKA02.raw 2.8856E7 1 1 55 68 PEAKS DB
H.YVSYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 65.44 2474.0154 22 0.7 1238.0159 2 50.09 1 31225 01122020_RID_2209_BuCaKA02.raw 6.6427E6 2 2 47 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
ABU63166.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.YGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 91.39 2124.8516 19 0.2 1063.4332 2 41.66 1 24749 01122020_RID_2209_BuCaKA02.raw 2.5458E9 1 1 50 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GYGGSGTPVDELDR.C N 83.79 1581.6729 15 0.8 791.8444 2 29.21 1 14986 01122020_RID_2209_BuCaKA02.raw 1.287E8 1 1 54 68 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 81.97 1961.7883 18 1.3 981.9027 2 36.23 1 20719 01122020_RID_2209_BuCaKA02.raw 1.0001E9 2 2 51 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
Y.VSYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 81.93 2310.9521 21 -0.2 1156.4832 2 46.14 1 28319 01122020_RID_2209_BuCaKA02.raw 5.5639E8 1 1 48 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGSGTPVDELDR.C N 74.25 1744.7362 16 1.7 873.3768 2 34.92 1 19611 01122020_RID_2209_BuCaKA02.raw 1.162E7 1 1 53 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GYGGSGTPVDELDR.C N 74.02 1904.7668 17 1.3 953.3920 2 36.10 1 20597 01122020_RID_2209_BuCaKA02.raw 8.7199E6 1 1 52 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
C.GYGGSGTPVDELDR.C N 70.31 1421.6422 14 2.0 711.8298 2 27.36 1 13794 01122020_RID_2209_BuCaKA02.raw 2.8856E7 1 1 55 68 PEAKS DB
H.YVSYGC(+57.02)YC(+57.02)GYGGSGTPVDELDR.C Y 65.44 2474.0154 22 0.7 1238.0159 2 50.09 1 31225 01122020_RID_2209_BuCaKA02.raw 6.6427E6 2 2 47 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
T_134
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.WSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 77.95 3628.7183 32 -1.3 1210.5785 3 86.56 1 61367 01122020_RID_2209_BuCaKA02.raw 7.9367E7 1 1 335 366 PEAKS DB
A.DIVINDLSLIHQLPK.N N 74.80 1716.9774 15 0.7 859.4966 2 66.71 1 45159 01122020_RID_2209_BuCaKA02.raw 1.2111E9 3 3 306 320 PEAKS DB
K.SATKIFLTC(+57.02)TNKFWEADGIHGGK.S Y 73.77 2580.2795 23 0.7 646.0776 4 37.57 1 21836 01122020_RID_2209_BuCaKA02.raw 2.796E7 1 1 238 260 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.DLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 71.41 2864.5469 24 0.9 717.1447 4 57.89 1 37618 01122020_RID_2209_BuCaKA02.raw 9.7766E6 1 1 311 334 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.IYFAGEYTAR.L N 69.43 1189.5768 10 1.3 595.7964 2 33.46 1 18735 01122020_RID_2209_BuCaKA02.raw 8.9761E7 3 3 367 376 PEAKS DB
A.DIVINDLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 64.59 3418.8533 29 1.6 855.7219 4 70.46 1 48074 01122020_RID_2209_BuCaKA02.raw 1.3475E9 3 3 306 334 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
R.VAYQTPAKTLSYVTADYVIVC(+57.02)ATSR.A N 64.46 2776.4106 25 0.4 926.4779 3 63.60 1 42220 01122020_RID_2209_BuCaKA02.raw 2.3369E7 1 1 188 212 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
L.TSFTPYQFQDYSETVAAPVGR.I N 61.49 2363.1069 21 0.5 1182.5613 2 62.44 1 41443 01122020_RID_2209_BuCaKA02.raw 4.6986E7 1 1 346 366 PEAKS DB
F.GLKLNEFFQENENAWYFIR.N N 48.64 2417.1804 19 2.0 806.7357 3 77.91 1 54188 01122020_RID_2209_BuCaKA02.raw 1.6173E6 1 1 21 39 PEAKS DB
K.KWSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 45.61 3756.8132 33 5.2 940.2155 4 77.17 1 53620 01122020_RID_2209_BuCaKA02.raw 3.1936E6 1 1 334 366 PEAKS DB
K.WSLDKYTMGALTSFTPYQF.Q N 43.76 2255.0608 19 0.4 1128.5381 2 94.20 1 67517 01122020_RID_2209_BuCaKA02.raw 1.3712E7 1 1 335 353 PEAKS DB
K.FGLKLNEFFQENENAWYFIRNIR.K N 43.46 2947.4768 23 1.5 737.8776 4 82.38 1 57872 01122020_RID_2209_BuCaKA02.raw 3.2121E6 1 1 20 42 PEAKS DB
K.FGLKLNEFFQENENAWYFIR.N N 43.42 2564.2488 20 4.2 855.7604 3 85.11 1 60048 01122020_RID_2209_BuCaKA02.raw 1.0085E7 1 1 20 39 PEAKS DB
total 13 peptides
T_137
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.WSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 77.95 3628.7183 32 -1.3 1210.5785 3 86.56 1 61367 01122020_RID_2209_BuCaKA02.raw 7.9367E7 1 1 335 366 PEAKS DB
A.DIVINDLSLIHQLPK.N N 74.80 1716.9774 15 0.7 859.4966 2 66.71 1 45159 01122020_RID_2209_BuCaKA02.raw 1.2111E9 3 3 306 320 PEAKS DB
K.SATKIFLTC(+57.02)TNKFWEADGIHGGK.S Y 73.77 2580.2795 23 0.7 646.0776 4 37.57 1 21836 01122020_RID_2209_BuCaKA02.raw 2.796E7 1 1 238 260 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.DLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 71.41 2864.5469 24 0.9 717.1447 4 57.89 1 37618 01122020_RID_2209_BuCaKA02.raw 9.7766E6 1 1 311 334 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.IYFAGEYTAR.L N 69.43 1189.5768 10 1.3 595.7964 2 33.46 1 18735 01122020_RID_2209_BuCaKA02.raw 8.9761E7 3 3 367 376 PEAKS DB
A.DIVINDLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 64.59 3418.8533 29 1.6 855.7219 4 70.46 1 48074 01122020_RID_2209_BuCaKA02.raw 1.3475E9 3 3 306 334 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
R.VAYQTPAKTLSYVTADYVIVC(+57.02)ATSR.A N 64.46 2776.4106 25 0.4 926.4779 3 63.60 1 42220 01122020_RID_2209_BuCaKA02.raw 2.3369E7 1 1 188 212 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
L.TSFTPYQFQDYSETVAAPVGR.I N 61.49 2363.1069 21 0.5 1182.5613 2 62.44 1 41443 01122020_RID_2209_BuCaKA02.raw 4.6986E7 1 1 346 366 PEAKS DB
F.GLKLNEFFQENENAWYFIR.N N 48.64 2417.1804 19 2.0 806.7357 3 77.91 1 54188 01122020_RID_2209_BuCaKA02.raw 1.6173E6 1 1 21 39 PEAKS DB
K.KWSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 45.61 3756.8132 33 5.2 940.2155 4 77.17 1 53620 01122020_RID_2209_BuCaKA02.raw 3.1936E6 1 1 334 366 PEAKS DB
K.WSLDKYTMGALTSFTPYQF.Q N 43.76 2255.0608 19 0.4 1128.5381 2 94.20 1 67517 01122020_RID_2209_BuCaKA02.raw 1.3712E7 1 1 335 353 PEAKS DB
K.FGLKLNEFFQENENAWYFIRNIR.K N 43.46 2947.4768 23 1.5 737.8776 4 82.38 1 57872 01122020_RID_2209_BuCaKA02.raw 3.2121E6 1 1 20 42 PEAKS DB
K.FGLKLNEFFQENENAWYFIR.N N 43.42 2564.2488 20 4.2 855.7604 3 85.11 1 60048 01122020_RID_2209_BuCaKA02.raw 1.0085E7 1 1 20 39 PEAKS DB
total 13 peptides
T_130
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.WSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 77.95 3628.7183 32 -1.3 1210.5785 3 86.56 1 61367 01122020_RID_2209_BuCaKA02.raw 7.9367E7 1 1 335 366 PEAKS DB
A.DIVINDLSLIHQLPK.N N 74.80 1716.9774 15 0.7 859.4966 2 66.71 1 45159 01122020_RID_2209_BuCaKA02.raw 1.2111E9 3 3 306 320 PEAKS DB
K.SATKIFLTC(+57.02)TNKFWEADGIHGGK.S Y 73.77 2580.2795 23 0.7 646.0776 4 37.57 1 21836 01122020_RID_2209_BuCaKA02.raw 2.796E7 1 1 238 260 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.DLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 71.41 2864.5469 24 0.9 717.1447 4 57.89 1 37618 01122020_RID_2209_BuCaKA02.raw 9.7766E6 1 1 311 334 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.IYFAGEYTAR.L N 69.43 1189.5768 10 1.3 595.7964 2 33.46 1 18735 01122020_RID_2209_BuCaKA02.raw 8.9761E7 3 3 367 376 PEAKS DB
A.DIVINDLSLIHQLPKNEIQDLC(+57.02)YPSLIKK.W Y 64.59 3418.8533 29 1.6 855.7219 4 70.46 1 48074 01122020_RID_2209_BuCaKA02.raw 1.3475E9 3 3 306 334 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
R.VAYQTPAKTLSYVTADYVIVC(+57.02)ATSR.A N 64.46 2776.4106 25 0.4 926.4779 3 63.60 1 42220 01122020_RID_2209_BuCaKA02.raw 2.3369E7 1 1 188 212 Carbamidomethylation C21:Carbamidomethylation:1000.00 PEAKS DB
L.TSFTPYQFQDYSETVAAPVGR.I N 61.49 2363.1069 21 0.5 1182.5613 2 62.44 1 41443 01122020_RID_2209_BuCaKA02.raw 4.6986E7 1 1 346 366 PEAKS DB
F.GLKLNEFFQENENAWYFIR.N N 48.64 2417.1804 19 2.0 806.7357 3 77.91 1 54188 01122020_RID_2209_BuCaKA02.raw 1.6173E6 1 1 21 39 PEAKS DB
K.KWSLDKYTMGALTSFTPYQFQDYSETVAAPVGR.I N 45.61 3756.8132 33 5.2 940.2155 4 77.17 1 53620 01122020_RID_2209_BuCaKA02.raw 3.1936E6 1 1 334 366 PEAKS DB
K.WSLDKYTMGALTSFTPYQF.Q N 43.76 2255.0608 19 0.4 1128.5381 2 94.20 1 67517 01122020_RID_2209_BuCaKA02.raw 1.3712E7 1 1 335 353 PEAKS DB
K.FGLKLNEFFQENENAWYFIRNIR.K N 43.46 2947.4768 23 1.5 737.8776 4 82.38 1 57872 01122020_RID_2209_BuCaKA02.raw 3.2121E6 1 1 20 42 PEAKS DB
K.FGLKLNEFFQENENAWYFIR.N N 43.42 2564.2488 20 4.2 855.7604 3 85.11 1 60048 01122020_RID_2209_BuCaKA02.raw 1.0085E7 1 1 20 39 PEAKS DB
total 13 peptides
T_22
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TYSYDC(+57.02)SEGKLTC(+57.02)KDTAGTC(+57.02)ER.I N 86.11 2601.0781 22 1.5 651.2778 4 12.08 1 2046 01122020_RID_2209_BuCaKA02.raw 0 0 0 122 143 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
L.NLIQFSNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 81.64 3785.7039 31 0.4 947.4336 4 50.56 1 31551 01122020_RID_2209_BuCaKA02.raw 3.9844E10 5 5 56 86 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEKLASC(+57.02)RPYYK.T N 77.20 2909.1990 23 0.8 728.3076 4 19.12 1 7427 01122020_RID_2209_BuCaKA02.raw 4.5345E7 2 2 99 121 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDRC(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEK.L Y 65.25 2910.1604 26 1.4 728.5484 4 16.22 1 5286 01122020_RID_2209_BuCaKA02.raw 2.7443E6 1 1 87 112 Carbamidomethylation C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
F.SNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 61.40 3170.3657 26 1.0 793.5995 4 22.40 1 9966 01122020_RID_2209_BuCaKA02.raw 1.1467E7 1 1 61 86 Carbamidomethylation C6:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GKGGGGTPVDDLDR.C Y 57.05 3754.5847 33 2.2 751.9259 5 21.02 1 8863 01122020_RID_2209_BuCaKA02.raw 2.1904E6 1 1 66 98 Carbamidomethylation C1:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
P.LNLIQFSNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 56.67 3898.7878 32 0.5 780.7653 5 58.45 1 37992 01122020_RID_2209_BuCaKA02.raw 9.8639E7 1 1 55 86 Carbamidomethylation C12:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDRC(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEKLASC(+57.02)RPYYK.T Y 46.28 4048.7197 35 1.1 1013.1884 4 29.89 1 15633 01122020_RID_2209_BuCaKA02.raw 5.2559E6 1 1 87 121 Carbamidomethylation C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
K.LASC(+57.02)RPYYKTYSYDC(+57.02)SEGKLTC(+57.02)K.D N 41.20 2849.2822 23 1.6 713.3290 4 14.97 1 4367 01122020_RID_2209_BuCaKA02.raw 1.3525E6 1 1 113 135 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_23
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TYSYDC(+57.02)SEGKLTC(+57.02)KDTAGTC(+57.02)ER.I N 86.11 2601.0781 22 1.5 651.2778 4 12.08 1 2046 01122020_RID_2209_BuCaKA02.raw 0 0 0 122 143 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
L.NLIQFSNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 81.64 3785.7039 31 0.4 947.4336 4 50.56 1 31551 01122020_RID_2209_BuCaKA02.raw 3.9844E10 5 5 56 86 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEKLASC(+57.02)RPYYK.T N 77.20 2909.1990 23 0.8 728.3076 4 19.12 1 7427 01122020_RID_2209_BuCaKA02.raw 4.5345E7 2 2 99 121 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDRC(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEK.L Y 65.25 2910.1604 26 1.4 728.5484 4 16.22 1 5286 01122020_RID_2209_BuCaKA02.raw 2.7443E6 1 1 87 112 Carbamidomethylation C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
F.SNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 61.40 3170.3657 26 1.0 793.5995 4 22.40 1 9966 01122020_RID_2209_BuCaKA02.raw 1.1467E7 1 1 61 86 Carbamidomethylation C6:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GKGGGGTPVDDLDR.C Y 57.05 3754.5847 33 2.2 751.9259 5 21.02 1 8863 01122020_RID_2209_BuCaKA02.raw 2.1904E6 1 1 66 98 Carbamidomethylation C1:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
P.LNLIQFSNLIQC(+57.02)ANHNSRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 56.67 3898.7878 32 0.5 780.7653 5 58.45 1 37992 01122020_RID_2209_BuCaKA02.raw 9.8639E7 1 1 55 86 Carbamidomethylation C12:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDRC(+57.02)C(+57.02)QTHDNC(+57.02)YGEAEKLASC(+57.02)RPYYK.T Y 46.28 4048.7197 35 1.1 1013.1884 4 29.89 1 15633 01122020_RID_2209_BuCaKA02.raw 5.2559E6 1 1 87 121 Carbamidomethylation C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
K.LASC(+57.02)RPYYKTYSYDC(+57.02)SEGKLTC(+57.02)K.D N 41.20 2849.2822 23 1.6 713.3290 4 14.97 1 4367 01122020_RID_2209_BuCaKA02.raw 1.3525E6 1 1 113 135 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
XP_026570824.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.KVIDALTEAVNNLDDVAGALSK.L Y 92.53 2255.2009 22 1.9 752.7423 3 86.19 1 61055 01122020_RID_2209_BuCaKA02.raw 3.3221E8 5 5 62 83 PEAKS DB
K.VIDALTEAVNNLDDVAGALSK.L Y 88.22 2127.1060 21 0.5 1064.5608 2 94.31 1 67756 01122020_RID_2209_BuCaKA02.raw 6.027E8 6 6 63 83 PEAKS DB
K.VIDALTEAVNNLDDVAGALSKLSDLHAQKLR.V Y 82.13 3288.7676 31 7.2 658.7655 5 87.94 1 62442 01122020_RID_2209_BuCaKA02.raw 1.4563E6 1 1 63 93 PEAKS DB
K.VIDALTEAVNNLDDVAGALSKLSDLHAQK.L Y 80.42 3019.5825 29 1.9 755.9044 4 94.03 1 67418 01122020_RID_2209_BuCaKA02.raw 3.117E7 2 2 63 91 PEAKS DB
K.KVIDALTEAVNNLDDVAGALSKLSDLHAQK.L Y 79.44 3147.6775 30 2.2 787.9283 4 88.58 1 62958 01122020_RID_2209_BuCaKA02.raw 5.7103E6 1 1 62 91 PEAKS DB
V.IDALTEAVNNLDDVAGALSK.L Y 69.06 2028.0375 20 7.2 1015.0333 2 93.27 1 66932 01122020_RID_2209_BuCaKA02.raw 7.2996E6 1 1 64 83 PEAKS DB
K.NAELYGAETLTRLFSAHPTTK.T Y 64.98 2319.1858 21 1.1 774.0701 3 50.12 1 31206 01122020_RID_2209_BuCaKA02.raw 1.9726E7 1 1 21 41 PEAKS DB
total 7 peptides
T_3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)AATC(+57.02)PSEILSVK.I Y 80.44 1434.6847 13 2.2 718.3512 2 33.56 1 18621 01122020_RID_2209_BuCaKA02.raw 1.5875E8 1 1 66 78 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PFHTC(+57.02)PDSETC(+57.02)PDGKNIC(+57.02)VKLSWLAVR.G Y 79.58 3447.5833 29 0.8 862.9038 4 46.60 1 28650 01122020_RID_2209_BuCaKA02.raw 4.1614E8 3 3 26 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
K.LSWLAVRGDGIKHEIR.R Y 66.87 1849.0322 16 0.9 617.3519 3 25.62 1 12391 01122020_RID_2209_BuCaKA02.raw 1.4394E8 1 1 48 63 PEAKS DB
K.C(+57.02)AATC(+57.02)PSEILSVKIF.C Y 65.31 1694.8372 15 1.2 848.4269 2 71.09 1 48488 01122020_RID_2209_BuCaKA02.raw 9.8971E8 2 2 66 80 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.KC(+57.02)AATC(+57.02)PSEILSVKIF.C Y 62.65 1822.9321 16 0.9 912.4741 2 54.81 1 35125 01122020_RID_2209_BuCaKA02.raw 3.7928E8 2 2 65 80 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.NIC(+57.02)VKLSWLAVR.G Y 56.86 1457.8176 12 1.2 729.9170 2 52.74 1 33325 01122020_RID_2209_BuCaKA02.raw 1.4089E7 2 2 43 54 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PFHTC(+57.02)PDSETC(+57.02)PDGKNIC(+57.02)VK.L Y 48.95 2622.0972 22 2.2 875.0416 3 16.13 1 5233 01122020_RID_2209_BuCaKA02.raw 4.1051E5 1 1 26 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)AATC(+57.02)PSEILSVKI.F Y 47.99 1547.7687 14 2.8 774.8938 2 54.68 1 34941 01122020_RID_2209_BuCaKA02.raw 0 0 0 66 79 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.KC(+57.02)AATC(+57.02)PSEILSVKIFC(+57.02)C(+57.02)TTDNC(+57.02)ND Y 45.26 2963.2593 25 0.9 988.7612 3 56.20 1 36392 01122020_RID_2209_BuCaKA02.raw 2.0137E9 2 2 65 89 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
XP_026548868.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FFTNFGNLSNAAAIQSNAQVK.A Y 74.30 2241.1177 21 1.0 748.0472 3 56.57 1 36662 01122020_RID_2209_BuCaKA02.raw 1.7745E8 2 2 42 62 PEAKS DB
F.FTNFGNLSNAAAIQSNAQVK.A Y 66.04 2094.0493 20 1.4 1048.0334 2 45.00 1 27292 01122020_RID_2209_BuCaKA02.raw 2.4851E7 1 1 43 62 PEAKS DB
R.LLIVYPWTQR.F N 63.20 1287.7339 10 1.2 644.8750 2 65.18 1 43507 01122020_RID_2209_BuCaKA02.raw 2.7712E7 1 1 32 41 PEAKS DB
F.FTNFGNLSNAAAIQSNAQVKAHGKK.V Y 61.51 2615.3567 25 -1.8 654.8453 4 20.67 1 8650 01122020_RID_2209_BuCaKA02.raw 0 0 0 43 67 PEAKS DB
R.FFTNFGNLSNAAAIQSNAQVKAHGKK.V Y 61.31 2762.4253 26 2.2 691.6151 4 29.68 1 15412 01122020_RID_2209_BuCaKA02.raw 5.2857E7 1 1 42 67 PEAKS DB
F.FTNFGNLSNAAAIQSNAQVKAHGK.K Y 60.58 2487.2617 24 0.5 622.8230 4 26.88 1 13510 01122020_RID_2209_BuCaKA02.raw 8.3516E6 1 1 43 66 PEAKS DB
R.FFTNFGNLSNAAAIQSNAQVKAHGK.K Y 58.51 2634.3303 25 3.0 879.1200 3 37.01 1 21359 01122020_RID_2209_BuCaKA02.raw 2.9147E7 2 2 42 66 PEAKS DB
K.LHVDPVNFKLLGDIL.L N 58.44 1691.9609 15 1.1 846.9886 2 78.56 1 54664 01122020_RID_2209_BuCaKA02.raw 1.1278E7 2 2 97 111 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDILL.T N 55.08 2787.4993 24 1.2 697.8829 4 73.38 1 50333 01122020_RID_2209_BuCaKA02.raw 6.3167E7 1 1 89 112 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDILLTVL.A N 53.46 3100.6995 27 0.8 776.1828 4 94.78 1 68135 01122020_RID_2209_BuCaKA02.raw 1.4117E7 1 1 89 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.LLIVYPWTQRF.F N 51.09 1434.8024 11 1.2 718.4093 2 76.20 1 52645 01122020_RID_2209_BuCaKA02.raw 7.6335E7 1 1 32 42 PEAKS DB
K.LHVDPVNFKLLGDILL.T N 48.69 1805.0450 16 3.5 602.6910 3 85.50 1 60357 01122020_RID_2209_BuCaKA02.raw 3.6866E6 2 2 97 112 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDIL.L N 40.85 2674.4153 23 -0.1 1338.2148 2 67.54 1 45571 01122020_RID_2209_BuCaKA02.raw 3.3985E6 1 1 89 111 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 13 peptides
T_141
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 84.43 4348.0386 38 0.6 1088.0176 4 76.30 1 52783 01122020_RID_2209_BuCaKA02.raw 1.838E9 4 4 54 91 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPR.D N 72.30 1639.6606 14 1.0 820.8384 2 21.06 1 9089 01122020_RID_2209_BuCaKA02.raw 1.1383E8 1 1 78 91 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 60.01 4893.3711 42 1.5 979.6830 5 71.03 1 48311 01122020_RID_2209_BuCaKA02.raw 4.4886E8 4 4 50 91 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNY.F Y 59.20 2726.3884 24 0.5 909.8039 3 71.13 1 48508 01122020_RID_2209_BuCaKA02.raw 2.4764E10 3 3 54 77 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S Y 54.72 5324.5298 45 3.7 888.4322 6 66.13 1 44381 01122020_RID_2209_BuCaKA02.raw 2.1209E8 2 2 50 94 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00;C44:Carbamidomethylation:1000.00 PEAKS DB
T.DIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D N 54.18 2813.2095 25 0.1 938.7439 3 77.95 1 54032 01122020_RID_2209_BuCaKA02.raw 1.7917E7 3 3 67 91 Carbamidomethylation C8:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S N 50.32 2070.8193 17 1.2 691.2812 3 12.90 1 3067 01122020_RID_2209_BuCaKA02.raw 3.9576E6 1 1 78 94 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)G.N Y 48.98 2449.2820 22 2.4 817.4365 3 66.80 1 44948 01122020_RID_2209_BuCaKA02.raw 6.3297E7 1 1 54 75 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNY.F Y 42.83 3271.7209 28 1.2 818.9385 4 65.27 1 43526 01122020_RID_2209_BuCaKA02.raw 2.736E9 1 1 50 77 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYF.V Y 40.33 2873.4568 25 0.9 958.8270 3 80.23 1 56127 01122020_RID_2209_BuCaKA02.raw 1.0367E9 1 1 54 78 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S Y 39.70 4779.1973 41 2.1 1195.8091 4 70.29 1 47545 01122020_RID_2209_BuCaKA02.raw 2.5647E8 1 1 54 94 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00;C40:Carbamidomethylation:1000.00 PEAKS DB
total 11 peptides
T_140
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 84.43 4348.0386 38 0.6 1088.0176 4 76.30 1 52783 01122020_RID_2209_BuCaKA02.raw 1.838E9 4 4 54 91 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPR.D N 72.30 1639.6606 14 1.0 820.8384 2 21.06 1 9089 01122020_RID_2209_BuCaKA02.raw 1.1383E8 1 1 78 91 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 60.01 4893.3711 42 1.5 979.6830 5 71.03 1 48311 01122020_RID_2209_BuCaKA02.raw 4.4886E8 4 4 50 91 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNY.F Y 59.20 2726.3884 24 0.5 909.8039 3 71.13 1 48508 01122020_RID_2209_BuCaKA02.raw 2.4764E10 3 3 54 77 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S Y 54.72 5324.5298 45 3.7 888.4322 6 66.13 1 44381 01122020_RID_2209_BuCaKA02.raw 2.1209E8 2 2 50 94 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00;C44:Carbamidomethylation:1000.00 PEAKS DB
T.DIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D N 54.18 2813.2095 25 0.1 938.7439 3 77.95 1 54032 01122020_RID_2209_BuCaKA02.raw 1.7917E7 3 3 67 91 Carbamidomethylation C8:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S N 50.32 2070.8193 17 1.2 691.2812 3 12.90 1 3067 01122020_RID_2209_BuCaKA02.raw 3.9576E6 1 1 78 94 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)G.N Y 48.98 2449.2820 22 2.4 817.4365 3 66.80 1 44948 01122020_RID_2209_BuCaKA02.raw 6.3297E7 1 1 54 75 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.YLLRDRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNY.F Y 42.83 3271.7209 28 1.2 818.9385 4 65.27 1 43526 01122020_RID_2209_BuCaKA02.raw 2.736E9 1 1 50 77 Carbamidomethylation C9:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYF.V Y 40.33 2873.4568 25 0.9 958.8270 3 80.23 1 56127 01122020_RID_2209_BuCaKA02.raw 1.0367E9 1 1 54 78 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPVITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPRDC(+57.02)R.S Y 39.70 4779.1973 41 2.1 1195.8091 4 70.29 1 47545 01122020_RID_2209_BuCaKA02.raw 2.5647E8 1 1 54 94 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00;C40:Carbamidomethylation:1000.00 PEAKS DB
total 11 peptides
1PO8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 90.11 1832.8008 15 0.5 917.4081 2 29.11 1 14827 01122020_RID_2209_BuCaKA02.raw 3.5728E10 21 21 87 101 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 73.89 2219.9697 18 0.9 740.9979 3 24.07 1 11297 01122020_RID_2209_BuCaKA02.raw 4.6498E7 2 2 84 101 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.VC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 62.00 1685.7324 14 0.3 843.8738 2 19.27 1 7662 01122020_RID_2209_BuCaKA02.raw 9.2148E6 1 1 88 101 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAKAPYN.T Y 57.69 2277.9968 19 1.0 760.3403 3 39.34 1 23331 01122020_RID_2209_BuCaKA02.raw 1.219E8 1 1 87 105 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.RFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 57.32 1988.9019 16 1.4 663.9755 3 21.50 1 9222 01122020_RID_2209_BuCaKA02.raw 1.2424E7 1 1 86 101 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAAIC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 92 101 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAAIC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 90 101 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.79 1633.6687 13 0.9 817.8423 2 47.45 1 29276 01122020_RID_2209_BuCaKA02.raw 0 0 0 87 99 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)DRTAAIC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 91 101 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
1TC8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 90.11 1832.8008 15 0.5 917.4081 2 29.11 1 14827 01122020_RID_2209_BuCaKA02.raw 3.5728E10 21 21 87 101 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 73.89 2219.9697 18 0.9 740.9979 3 24.07 1 11297 01122020_RID_2209_BuCaKA02.raw 4.6498E7 2 2 84 101 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.VC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 62.00 1685.7324 14 0.3 843.8738 2 19.27 1 7662 01122020_RID_2209_BuCaKA02.raw 9.2148E6 1 1 88 101 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAKAPYN.T Y 57.69 2277.9968 19 1.0 760.3403 3 39.34 1 23331 01122020_RID_2209_BuCaKA02.raw 1.219E8 1 1 87 105 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.RFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 57.32 1988.9019 16 1.4 663.9755 3 21.50 1 9222 01122020_RID_2209_BuCaKA02.raw 1.2424E7 1 1 86 101 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAAIC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 92 101 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAAIC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 90 101 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.79 1633.6687 13 0.9 817.8423 2 47.45 1 29276 01122020_RID_2209_BuCaKA02.raw 0 0 0 87 99 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)DRTAAIC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 91 101 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
AAS20530.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 90.11 1832.8008 15 0.5 917.4081 2 29.11 1 14827 01122020_RID_2209_BuCaKA02.raw 3.5728E10 21 21 106 120 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 73.89 2219.9697 18 0.9 740.9979 3 24.07 1 11297 01122020_RID_2209_BuCaKA02.raw 4.6498E7 2 2 103 120 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.VC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 62.00 1685.7324 14 0.3 843.8738 2 19.27 1 7662 01122020_RID_2209_BuCaKA02.raw 9.2148E6 1 1 107 120 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAKAPYN.T Y 57.69 2277.9968 19 1.0 760.3403 3 39.34 1 23331 01122020_RID_2209_BuCaKA02.raw 1.219E8 1 1 106 124 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.RFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 57.32 1988.9019 16 1.4 663.9755 3 21.50 1 9222 01122020_RID_2209_BuCaKA02.raw 1.2424E7 1 1 105 120 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAAIC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 111 120 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAAIC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 109 120 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.79 1633.6687 13 0.9 817.8423 2 47.45 1 29276 01122020_RID_2209_BuCaKA02.raw 0 0 0 106 118 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)DRTAAIC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 110 120 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
Q6SLM2.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 90.11 1832.8008 15 0.5 917.4081 2 29.11 1 14827 01122020_RID_2209_BuCaKA02.raw 3.5728E10 21 21 106 120 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)ARFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 73.89 2219.9697 18 0.9 740.9979 3 24.07 1 11297 01122020_RID_2209_BuCaKA02.raw 4.6498E7 2 2 103 120 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.VC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 62.00 1685.7324 14 0.3 843.8738 2 19.27 1 7662 01122020_RID_2209_BuCaKA02.raw 9.2148E6 1 1 107 120 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAKAPYN.T Y 57.69 2277.9968 19 1.0 760.3403 3 39.34 1 23331 01122020_RID_2209_BuCaKA02.raw 1.219E8 1 1 106 124 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.RFVC(+57.02)DC(+57.02)DRTAAIC(+57.02)FAK.A Y 57.32 1988.9019 16 1.4 663.9755 3 21.50 1 9222 01122020_RID_2209_BuCaKA02.raw 1.2424E7 1 1 105 120 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAAIC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 111 120 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
C.DC(+57.02)DRTAAIC(+57.02)FAK.A N 47.16 1426.6333 12 -2.2 714.3224 2 20.22 1 8374 01122020_RID_2209_BuCaKA02.raw 1.7388E6 1 1 109 120 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.FVC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.79 1633.6687 13 0.9 817.8423 2 47.45 1 29276 01122020_RID_2209_BuCaKA02.raw 0 0 0 106 118 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)DRTAAIC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 110 120 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
XP_026555558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
I.VGGSSALPGSHPWLASINVGRNFC(+57.02)AGSLIR.S Y 70.14 3079.5774 30 1.8 770.9030 4 58.82 1 38294 01122020_RID_2209_BuCaKA02.raw 1.5721E8 2 2 305 334 Carbamidomethylation C24:Carbamidomethylation:1000.00 PEAKS DB
R.YSNVVQEALIPIIPDYK.C Y 69.71 1961.0509 17 2.3 654.6924 3 78.09 1 54253 01122020_RID_2209_BuCaKA02.raw 3.9803E6 1 1 446 462 PEAKS DB
I.VGGSSALPGSHPWLASINVGR.N Y 69.67 2061.0754 21 0.1 688.0325 3 46.61 1 28663 01122020_RID_2209_BuCaKA02.raw 2.7368E7 2 2 305 325 PEAKS DB
V.GGSSALPGSHPWLASINVGR.N Y 69.36 1962.0071 20 1.5 982.0123 2 44.48 1 26921 01122020_RID_2209_BuCaKA02.raw 1.8764E8 2 2 306 325 PEAKS DB
R.YSNVVQEALIPIIPDYKC(+57.02).Q Y 56.27 2121.0815 18 0.6 1061.5487 2 80.57 1 56341 01122020_RID_2209_BuCaKA02.raw 9.3841E6 1 1 446 463 Carbamidomethylation C18:Carbamidomethylation:1000.00 PEAKS DB
Y.SNVVQEALIPIIPDYK.C Y 51.03 1797.9875 16 1.5 900.0024 2 74.60 1 51396 01122020_RID_2209_BuCaKA02.raw 1.0953E7 1 1 447 462 PEAKS DB
V.GGSSALPGSHPWLASINVGRNFC(+57.02)AGSLIR.S Y 49.29 2980.5090 29 0.5 994.5107 3 57.92 1 37598 01122020_RID_2209_BuCaKA02.raw 3.5364E8 2 2 306 334 Carbamidomethylation C23:Carbamidomethylation:1000.00 PEAKS DB
G.GSSALPGSHPWLASINVGRNFC(+57.02)AGSLIR.S Y 47.12 2923.4875 28 0.7 731.8796 4 57.89 1 37725 01122020_RID_2209_BuCaKA02.raw 1.8196E6 1 1 307 334 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
D.EQPWC(+57.02)YFIK.D Y 46.80 1269.5852 9 1.3 635.8007 2 63.01 1 41765 01122020_RID_2209_BuCaKA02.raw 5.3369E6 1 1 240 248 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_15
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.TWIAYVNYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 80.17 2880.2483 26 1.2 1441.1332 2 81.40 1 57598 01122020_RID_2209_BuCaKA02.raw 3.0391E10 84 84 44 69 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.YVNYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 78.56 2409.0000 22 0.9 1205.5083 2 44.29 1 26760 01122020_RID_2209_BuCaKA02.raw 1.5762E7 1 1 48 69 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.YGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C N 72.32 2032.8254 19 1.0 1017.4210 2 34.88 1 19734 01122020_RID_2209_BuCaKA02.raw 4.869E7 1 1 51 69 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
W.IAYVNYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 64.10 2593.1213 24 1.3 1297.5696 2 53.06 1 33535 01122020_RID_2209_BuCaKA02.raw 3.38E7 1 1 46 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRTWIAYVNYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 62.46 3911.7124 35 1.3 1304.9131 3 66.88 1 45267 01122020_RID_2209_BuCaKA02.raw 3.3126E8 1 1 35 69 Carbamidomethylation C5:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRTWIAYVN.Y Y 56.33 1896.8975 16 0.3 949.4563 2 55.71 1 35868 01122020_RID_2209_BuCaKA02.raw 1.9157E8 1 1 35 50 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.NMIQC(+57.02)AGTRTWIAY.V Y 46.69 1683.7861 14 0.6 842.9009 2 50.60 1 31529 01122020_RID_2209_BuCaKA02.raw 1.0506E8 1 1 35 48 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 7 peptides
T_19
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.TAALC(+57.02)FAEAPYK.R Y 76.83 1340.6434 12 1.3 671.3298 2 38.98 1 22921 01122020_RID_2209_BuCaKA02.raw 1.849E8 1 1 156 167 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)SSLLNVPYVK.Q N 73.15 1278.6642 11 0.7 640.3398 2 45.36 1 27666 01122020_RID_2209_BuCaKA02.raw 5.5427E7 1 1 116 126 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.EHDDC(+57.02)YAQIKENPKC(+57.02)SSLLNVPYVK.Q N 66.45 3006.4214 25 2.6 602.2931 5 34.70 1 19488 01122020_RID_2209_BuCaKA02.raw 7.9325E6 1 1 102 126 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
T.AALC(+57.02)FAEAPYK.R Y 61.21 1239.5957 11 1.4 620.8060 2 36.73 1 21078 01122020_RID_2209_BuCaKA02.raw 1.5003E7 1 1 157 167 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.QYSFTC(+57.02)SEGDLTC(+57.02)SADNDEC(+57.02)GAFIC(+57.02)NC(+57.02)DR.T N 51.60 3451.2793 29 0.5 1151.4343 3 56.19 1 36495 01122020_RID_2209_BuCaKA02.raw 1.8306E8 1 1 127 155 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)SSLLNVPYVKQYSFTC(+57.02)SEGDLTC(+57.02)SADNDEC(+57.02)GAFIC(+57.02)NC(+57.02)DR.T N 51.13 4711.9326 40 0.9 1571.6528 3 68.65 1 46436 01122020_RID_2209_BuCaKA02.raw 7.4401E8 2 2 116 155 Carbamidomethylation C1:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00;C31:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00 PEAKS DB
R.NFKIDYNTRC(+57.02)Q Y 48.95 1457.6721 11 1.1 729.8441 2 17.18 1 5959 01122020_RID_2209_BuCaKA02.raw 4.6367E6 1 1 170 180 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.NFKIDYNTR.C Y 47.78 1169.5829 9 2.1 585.7999 2 16.80 1 5611 01122020_RID_2209_BuCaKA02.raw 3.6424E7 1 1 170 178 PEAKS DB
total 8 peptides
XP_034286707.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 63 74 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 62 74 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GMRM(+15.99)PVLGGHVSAFLGIPFAEPPVGR.M Y 44.49 2707.4089 26 9.6 1354.7247 2 93.89 1 67344 01122020_RID_2209_BuCaKA02.raw 0 0 0 49 74 Oxidation (M) M4:Oxidation (M):0.00 PEAKS DB
total 8 peptides
XP_034286706.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 548 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 62 73 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 61 73 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 548 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 550 560 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 549 560 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 548 559 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GMRM(+15.99)PVLGGHVSAFLGIPFAEPPVGR.M Y 44.49 2707.4089 26 9.6 1354.7247 2 93.89 1 67344 01122020_RID_2209_BuCaKA02.raw 0 0 0 48 73 Oxidation (M) M4:Oxidation (M):0.00 PEAKS DB
total 8 peptides
XP_034286705.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 81.68 1630.8079 13 0.4 816.4115 2 60.34 1 39698 01122020_RID_2209_BuCaKA02.raw 3.6259E8 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
F.LGIPFAEPPVGR.M N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 63 74 PEAKS DB
A.FLGIPFAEPPVGR.M N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 62 74 PEAKS DB
R.AQIC(+57.02)AFWNHFLPKL.L N 59.24 1743.8918 14 1.7 872.9547 2 72.95 1 49964 01122020_RID_2209_BuCaKA02.raw 1.5107E8 2 2 549 562 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 56.19 1431.7122 11 1.5 716.8644 2 55.11 1 35292 01122020_RID_2209_BuCaKA02.raw 7.8377E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 49.55 1559.7708 12 1.5 780.8938 2 57.48 1 37350 01122020_RID_2209_BuCaKA02.raw 2.0913E7 1 1 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.AQIC(+57.02)AFWNHFLP.K N 44.50 1502.7129 12 0.9 752.3644 2 78.17 1 54427 01122020_RID_2209_BuCaKA02.raw 5.0431E8 1 1 549 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GMRM(+15.99)PVLGGHVSAFLGIPFAEPPVGR.M Y 44.49 2707.4089 26 9.6 1354.7247 2 93.89 1 67344 01122020_RID_2209_BuCaKA02.raw 0 0 0 49 74 Oxidation (M) M4:Oxidation (M):0.00 PEAKS DB
total 8 peptides
T_2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.DLGYTLTC(+57.02)LIC(+57.02)PEKYC(+57.02)QKVHTC(+57.02)R.N Y 81.82 2914.3599 23 2.1 583.8805 5 50.92 1 31813 01122020_RID_2209_BuCaKA02.raw 3.3951E8 2 2 17 39 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
L.DLGYTLTC(+57.02)LIC(+57.02)PEKYC(+57.02)QK.V Y 78.01 2261.0530 18 1.5 754.6927 3 69.18 1 46873 01122020_RID_2209_BuCaKA02.raw 5.9501E8 2 2 17 34 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
L.DLGYTLTC(+57.02)LIC(+57.02)PEK.Y Y 71.97 1681.8055 14 -0.5 841.9097 2 80.10 1 56039 01122020_RID_2209_BuCaKA02.raw 3.9167E7 4 4 17 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.TC(+57.02)LIC(+57.02)PEKYC(+57.02)QKVHTC(+57.02)R.N Y 65.54 2252.0322 17 1.4 564.0161 4 12.15 1 2111 01122020_RID_2209_BuCaKA02.raw 9.6274E5 1 1 23 39 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.FYDKKLFGWR.A Y 60.98 1358.7135 10 2.1 680.3655 2 29.42 1 15297 01122020_RID_2209_BuCaKA02.raw 1.1379E6 1 1 49 58 PEAKS DB
T.LTC(+57.02)LIC(+57.02)PEKYC(+57.02)QKVHTC(+57.02)R.N Y 56.89 2365.1162 18 -0.1 592.2863 4 17.42 1 6172 01122020_RID_2209_BuCaKA02.raw 1.016E6 1 1 22 39 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
T_21
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)SSLLNVPYVK.Q N 73.15 1278.6642 11 0.7 640.3398 2 45.36 1 27666 01122020_RID_2209_BuCaKA02.raw 5.5427E7 1 1 116 126 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FAKAPYNVENK.E N 70.51 1795.8927 16 0.3 599.6384 3 29.16 1 15058 01122020_RID_2209_BuCaKA02.raw 2.7541E6 1 1 156 171 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.EHDDC(+57.02)YAQIKENPKC(+57.02)SSLLNVPYVK.Q N 66.45 3006.4214 25 2.6 602.2931 5 34.70 1 19488 01122020_RID_2209_BuCaKA02.raw 7.9325E6 1 1 102 126 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
L.SFYRYTQMIQC(+57.02)TIR.G Y 65.79 1865.8916 14 0.9 622.9717 3 43.20 1 26002 01122020_RID_2209_BuCaKA02.raw 0 0 0 56 69 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAALC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 154 163 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.QYSFTC(+57.02)SEGDLTC(+57.02)SADNDEC(+57.02)GAFIC(+57.02)NC(+57.02)DR.T N 51.60 3451.2793 29 0.5 1151.4343 3 56.19 1 36495 01122020_RID_2209_BuCaKA02.raw 1.8306E8 1 1 127 155 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)SSLLNVPYVKQYSFTC(+57.02)SEGDLTC(+57.02)SADNDEC(+57.02)GAFIC(+57.02)NC(+57.02)DR.T N 51.13 4711.9326 40 0.9 1571.6528 3 68.65 1 46436 01122020_RID_2209_BuCaKA02.raw 7.4401E8 2 2 116 155 Carbamidomethylation C1:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00;C31:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C38:Carbamidomethylation:1000.00 PEAKS DB
N.C(+57.02)DRTAALC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 153 163 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
LAA65154.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.VFTAFGDAVKNPEAVKDTFAK.L Y 83.18 2254.1633 21 1.7 564.5491 4 43.11 1 25944 01122020_RID_2209_BuCaKA02.raw 0 0 0 36 56 PEAKS DB
K.DTFAKLSELHC(+57.02)DKLHVDPVNFK.L N 69.84 2612.3057 22 1.4 654.0846 4 40.63 1 24218 01122020_RID_2209_BuCaKA02.raw 3.9252E7 2 2 52 73 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
K.LHVDPVNFKLLGDIL.L N 58.44 1691.9609 15 1.1 846.9886 2 78.56 1 54664 01122020_RID_2209_BuCaKA02.raw 1.1278E7 2 2 65 79 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDILL.T N 55.08 2787.4993 24 1.2 697.8829 4 73.38 1 50333 01122020_RID_2209_BuCaKA02.raw 6.3167E7 1 1 57 80 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDILLTVL.A N 53.46 3100.6995 27 0.8 776.1828 4 94.78 1 68135 01122020_RID_2209_BuCaKA02.raw 1.4117E7 1 1 57 83 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLGDILLTVLAAQFGK.E N 51.46 1670.9971 16 0.4 836.5061 2 118.03 1 86948 01122020_RID_2209_BuCaKA02.raw 3.4672E5 3 3 74 89 PEAKS DB
K.LHVDPVNFKLLGDILL.T N 48.69 1805.0450 16 3.5 602.6910 3 85.50 1 60357 01122020_RID_2209_BuCaKA02.raw 3.6866E6 2 2 65 80 PEAKS DB
K.LSELHC(+57.02)DKLHVDPVNFKLLGDIL.L N 40.85 2674.4153 23 -0.1 1338.2148 2 67.54 1 45571 01122020_RID_2209_BuCaKA02.raw 3.3985E6 1 1 57 79 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
T_43
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.AAKDDC(+57.02)DLPEIC(+57.02)TGQSAEC(+57.02)PTDSFQR.N Y 78.94 2970.2429 26 1.3 1486.1306 2 37.85 1 22059 01122020_RID_2209_BuCaKA02.raw 5.3722E8 2 2 197 222 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.ESSYEC(+57.02)FLLNHISQGC(+57.02)GFC(+57.02)R.M Y 76.58 2463.0405 20 1.0 1232.5288 2 59.84 1 39318 01122020_RID_2209_BuCaKA02.raw 2.0922E9 2 2 256 275 Carbamidomethylation C6:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
E.SSYEC(+57.02)FLLNHISQGC(+57.02)GFC(+57.02)R.M Y 67.12 2333.9980 19 0.9 779.0073 3 55.70 1 35802 01122020_RID_2209_BuCaKA02.raw 8.2656E7 2 2 257 275 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPEIC(+57.02)TGQSAEC(+57.02)PTDSFQR.N Y 60.15 2700.0737 23 1.6 1351.0463 2 54.15 1 34364 01122020_RID_2209_BuCaKA02.raw 7.3423E7 2 2 200 222 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.SVAVVQDYSER.T N 52.51 1251.6095 11 1.1 626.8127 2 19.77 1 7950 01122020_RID_2209_BuCaKA02.raw 1.1175E6 1 1 49 59 PEAKS DB
K.SISDEPHSEFSSC(+57.02)SVQEHQRYLLK.D N 51.51 2862.3242 24 0.8 716.5889 4 22.77 1 10269 01122020_RID_2209_BuCaKA02.raw 4.272E6 1 1 96 119 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.NGLPC(+57.02)QNNQSYC(+57.02)YNGKC(+57.02)PTLTNQC(+57.02)IDHWGPGAK.E Y 48.08 3851.6660 33 0.9 963.9247 4 34.93 1 19835 01122020_RID_2209_BuCaKA02.raw 6.9543E7 2 2 223 255 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
total 7 peptides
T_142
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.RDEPLYEFSFC(+57.02)SVQEHRR.Y Y 74.77 2354.0862 18 1.4 589.5297 4 31.51 1 16795 01122020_RID_2209_BuCaKA02.raw 1.3168E8 2 2 32 49 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.DEPLYEFSFC(+57.02)SVQEHRR.Y Y 69.34 2197.9851 17 0.8 733.6696 3 44.18 1 26756 01122020_RID_2209_BuCaKA02.raw 2.3911E8 1 1 33 49 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPQDC(+57.02)QSAC(+57.02)C(+57.02)NAATC(+57.02)K.L Y 59.03 3138.1553 27 0.3 1047.0593 3 25.62 1 12335 01122020_RID_2209_BuCaKA02.raw 2.3381E8 2 2 78 104 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C26:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLSTNIVAPPVC(+57.02)GNYF.V Y 46.96 2872.4363 25 0.4 958.4865 3 67.15 1 45213 01122020_RID_2209_BuCaKA02.raw 1.4843E8 1 1 54 78 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPQDC(+57.02)QSAC(+57.02)C(+57.02)NAATC(+57.02)KLK.H Y 46.83 3379.3342 29 0.3 1127.4524 3 24.74 1 11999 01122020_RID_2209_BuCaKA02.raw 3.9844E7 1 1 78 106 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C26:Carbamidomethylation:1000.00 PEAKS DB
R.DEPLYEFSFC(+57.02)SVQEHRRYLLR.D Y 46.11 2743.3176 21 0.6 686.8371 4 51.44 1 32277 01122020_RID_2209_BuCaKA02.raw 0 0 0 33 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.DEPLYEFSF.C Y 44.00 1145.4917 9 0.1 573.7532 2 96.87 1 69802 01122020_RID_2209_BuCaKA02.raw 1.4735E7 1 1 33 41 PEAKS DB
R.DRPQC(+57.02)ILNKPLSTNIVAPPVC(+57.02)GNY.F Y 40.70 2725.3679 24 2.2 682.3508 4 56.28 1 36302 01122020_RID_2209_BuCaKA02.raw 5.1758E6 1 1 54 77 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
T_64
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_65
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_68
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_66
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_63
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
T_67
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLLMK.C Y 68.94 3976.8970 33 0.9 995.2324 4 89.72 1 63987 01122020_RID_2209_BuCaKA02.raw 2.1165E8 2 2 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
Q.LDEVIPFMTVFER.S Y 66.78 1594.8065 13 -0.2 798.4104 2 90.46 1 64339 01122020_RID_2209_BuCaKA02.raw 6.6157E7 2 2 37 49 PEAKS DB
E.VIPFMTVFER.S Y 62.85 1237.6528 10 0.7 619.8341 2 74.75 1 51579 01122020_RID_2209_BuCaKA02.raw 4.4464E7 1 1 40 49 PEAKS DB
D.EVIPFMTVFER.S Y 61.58 1366.6954 11 1.2 684.3558 2 81.04 1 56653 01122020_RID_2209_BuCaKA02.raw 3.6832E7 1 1 39 49 PEAKS DB
L.DEVIPFMTVFER.S Y 60.02 1481.7224 12 0.1 741.8686 2 91.23 1 65381 01122020_RID_2209_BuCaKA02.raw 6.4416E7 2 2 38 49 PEAKS DB
K.QLDEVIPFMTVFER.S Y 59.60 1722.8650 14 2.3 862.4418 2 123.75 1 91422 01122020_RID_2209_BuCaKA02.raw 2.4991E6 2 2 36 49 PEAKS DB
V.IPFMTVFER.S Y 52.77 1138.5845 9 1.3 570.3002 2 64.88 1 43530 01122020_RID_2209_BuCaKA02.raw 3.5105E7 1 1 41 49 PEAKS DB
E.DGEKQLDEVIPFMTVFER.S Y 48.29 2152.0510 18 0.6 718.3580 3 88.46 1 62759 01122020_RID_2209_BuCaKA02.raw 2.4515E6 1 1 32 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVESLFKPSC(+57.02)VLL.M Y 41.86 3717.7615 31 2.3 1240.2639 3 98.11 1 70779 01122020_RID_2209_BuCaKA02.raw 2.0864E7 1 1 50 80 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
ETE71045.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GTLSQLSDLHAYNLRVDPVNFK.A Y 74.02 2486.2917 22 2.3 622.5817 4 55.60 1 35705 01122020_RID_2209_BuCaKA02.raw 2.0098E6 1 1 79 100 PEAKS DB
K.TYFSHFNLSPGSKDIIHQGEK.V Y 70.86 2404.1812 21 1.6 602.0535 4 29.87 1 15610 01122020_RID_2209_BuCaKA02.raw 8.4614E6 1 1 42 62 PEAKS DB
K.HLDDIRGTLSQLSDLHAYNLR.V Y 67.40 2436.2510 21 2.1 610.0713 4 55.54 1 35664 01122020_RID_2209_BuCaKA02.raw 0 0 0 73 93 PEAKS DB
K.LGC(+57.02)RLEDIGADALNRL.L Y 66.09 1784.9203 16 1.0 595.9813 3 56.45 1 36444 01122020_RID_2209_BuCaKA02.raw 1.0986E6 1 1 18 33 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.LEDIGADALNRL.L Y 58.49 1298.6830 12 2.0 650.3500 2 54.63 1 34912 01122020_RID_2209_BuCaKA02.raw 4.9377E6 1 1 22 33 PEAKS DB
K.TYFSHFNLSPGSKDIIHQGEKVGK.A Y 47.47 2688.3660 24 1.1 673.0995 4 26.80 1 13460 01122020_RID_2209_BuCaKA02.raw 4.8782E6 1 1 42 65 PEAKS DB
total 6 peptides
XP_026559591.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TGSAVHAYPSFDPSADVVALNKAITAK.G Y 81.71 2729.4023 27 -1.2 683.3571 4 56.43 1 36441 01122020_RID_2209_BuCaKA02.raw 3.0444E6 1 1 27 53 PEAKS DB
K.GVDEAGIIEILTKR.T Y 72.18 1512.8511 14 0.5 757.4332 2 62.94 1 41628 01122020_RID_2209_BuCaKA02.raw 1.9504E7 1 1 54 67 PEAKS DB
K.GVDEAGIIEILTK.R Y 69.25 1356.7500 13 0.7 679.3828 2 74.01 1 50817 01122020_RID_2209_BuCaKA02.raw 9.3039E6 1 1 54 66 PEAKS DB
K.SNLEDVVVAMLKTPAEFDADELR.Y Y 52.56 2561.2683 23 3.1 854.7660 3 95.73 1 68804 01122020_RID_2209_BuCaKA02.raw 5.652E5 1 1 97 119 PEAKS DB
K.YGVSLC(+57.02)QAILDETKGDYEKIL.V Y 46.97 2414.2039 21 3.7 805.7449 3 74.27 1 51066 01122020_RID_2209_BuCaKA02.raw 1.9423E7 1 1 314 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026559592.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.TGSAVHAYPSFDPSADVVALNKAITAK.G Y 81.71 2729.4023 27 -1.2 683.3571 4 56.43 1 36441 01122020_RID_2209_BuCaKA02.raw 3.0444E6 1 1 27 53 PEAKS DB
K.GVDEAGIIEILTKR.T Y 72.18 1512.8511 14 0.5 757.4332 2 62.94 1 41628 01122020_RID_2209_BuCaKA02.raw 1.9504E7 1 1 54 67 PEAKS DB
K.GVDEAGIIEILTK.R Y 69.25 1356.7500 13 0.7 679.3828 2 74.01 1 50817 01122020_RID_2209_BuCaKA02.raw 9.3039E6 1 1 54 66 PEAKS DB
K.SNLEDVVVAMLKTPAEFDADELR.Y Y 52.56 2561.2683 23 3.1 854.7660 3 95.73 1 68804 01122020_RID_2209_BuCaKA02.raw 5.652E5 1 1 97 119 PEAKS DB
K.YGVSLC(+57.02)QAILDETKGDYEKIL.V Y 46.97 2414.2039 21 3.7 805.7449 3 74.27 1 51066 01122020_RID_2209_BuCaKA02.raw 1.9423E7 1 1 314 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
0412250A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
NLINFMEMIR.Y N 70.13 1279.6417 10 0.6 640.8285 2 78.90 1 54806 01122020_RID_2209_BuCaKA02.raw 2.8606E8 1 1 1 10 PEAKS DB
K.RTIIC(+57.02)YGAAGGTC(+57.02)RIVC(+57.02)DC(+57.02)DR.T Y 61.54 2473.1084 21 3.3 619.2864 4 21.16 1 9009 01122020_RID_2209_BuCaKA02.raw 0 0 0 75 95 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.Q N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 89 102 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMEMIR.Y N 57.43 1165.5988 9 -0.2 583.8065 2 73.46 1 50593 01122020_RID_2209_BuCaKA02.raw 5.7582E7 1 1 2 10 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.16 1181.5936 9 0.5 591.8044 2 56.54 1 36487 01122020_RID_2209_BuCaKA02.raw 3.0018E6 1 1 2 10 Oxidation (M) M5:Oxidation (M):30.83 PEAKS DB
NLINFMEM(+15.99)IR.Y N 54.09 1295.6366 10 2.9 648.8275 2 69.38 1 47058 01122020_RID_2209_BuCaKA02.raw 0 0 0 1 10 Oxidation (M) M8:Oxidation (M):15.73 PEAKS DB
total 6 peptides
0402253A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
NLINFMEMIR.Y N 70.13 1279.6417 10 0.6 640.8285 2 78.90 1 54806 01122020_RID_2209_BuCaKA02.raw 2.8606E8 1 1 1 10 PEAKS DB
K.RTIIC(+57.02)YGAAGGTC(+57.02)RIVC(+57.02)DC(+57.02)DR.T Y 61.54 2473.1084 21 3.3 619.2864 4 21.16 1 9009 01122020_RID_2209_BuCaKA02.raw 0 0 0 75 95 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.IVC(+57.02)DC(+57.02)DRTAALC(+57.02)FG.Q N 58.90 1656.7058 14 1.9 829.3618 2 40.45 1 24023 01122020_RID_2209_BuCaKA02.raw 6.5443E7 1 1 89 102 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMEMIR.Y N 57.43 1165.5988 9 -0.2 583.8065 2 73.46 1 50593 01122020_RID_2209_BuCaKA02.raw 5.7582E7 1 1 2 10 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.16 1181.5936 9 0.5 591.8044 2 56.54 1 36487 01122020_RID_2209_BuCaKA02.raw 3.0018E6 1 1 2 10 Oxidation (M) M5:Oxidation (M):30.83 PEAKS DB
NLINFMEM(+15.99)IR.Y N 54.09 1295.6366 10 2.9 648.8275 2 69.38 1 47058 01122020_RID_2209_BuCaKA02.raw 0 0 0 1 10 Oxidation (M) M8:Oxidation (M):15.73 PEAKS DB
total 6 peptides
T_105
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.TAALC(+57.02)FAKAPYNVENK N 70.51 1795.8927 16 0.3 599.6384 3 29.16 1 15058 01122020_RID_2209_BuCaKA02.raw 2.7541E6 1 1 87 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.GTPVDELDRC(+57.02)C(+57.02)QTHDNC(+57.02)YAEAEEHPK.C Y 67.95 3130.2815 26 1.4 783.5787 4 17.15 1 5960 01122020_RID_2209_BuCaKA02.raw 3.8676E6 2 2 21 46 Carbamidomethylation C10:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
C.DRTAALC(+57.02)FAK.A N 55.24 1151.5757 10 2.7 576.7967 2 15.19 1 4454 01122020_RID_2209_BuCaKA02.raw 3.7655E5 1 1 85 94 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.C(+57.02)DRTAALC(+57.02)FAK.A N 39.74 1311.6063 11 1.6 656.8115 2 12.51 1 2398 01122020_RID_2209_BuCaKA02.raw 5.3941E5 1 1 84 94 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
T_33
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.YSQANESSKTC(+57.02)PSGQLLC(+57.02)FK.K Y 85.25 2304.0515 20 1.9 769.0259 3 26.68 1 13350 01122020_RID_2209_BuCaKA02.raw 6.6621E7 2 2 44 63 Carbamidomethylation C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PSGQLLC(+57.02)FKKWEIGNPSGK.D Y 81.95 2406.1824 21 2.0 602.5541 4 41.30 1 24642 01122020_RID_2209_BuCaKA02.raw 1.172E8 3 3 53 73 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
T_79
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNKC(+57.02)FLKGER.F Y 63.54 2285.0061 18 0.5 572.2591 4 19.42 1 7724 01122020_RID_2209_BuCaKA02.raw 0 0 0 228 245 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NKLLPSSC(+57.02)GFNKEFDEEK.C Y 62.69 2141.0098 18 2.0 714.6786 3 23.75 1 11092 01122020_RID_2209_BuCaKA02.raw 2.2348E6 1 1 191 208 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.EVTVDVGKESGATTNIFFKPPC(+57.02)VSVYR.C Y 58.76 2999.5061 27 1.4 750.8848 4 55.13 1 35441 01122020_RID_2209_BuCaKA02.raw 3.7355E7 1 1 4 30 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
K.KRC(+57.02)DSGFYYSEEVC(+57.02)R.C Y 55.86 1954.8301 15 1.9 652.6185 3 13.67 1 3155 01122020_RID_2209_BuCaKA02.raw 1.6065E6 1 1 263 277 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.SGFYYSEEVC(+57.02)R.C Y 45.73 1395.5765 11 1.3 698.7964 2 29.28 1 15193 01122020_RID_2209_BuCaKA02.raw 1.1668E7 1 1 267 277 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
T_75
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNKC(+57.02)FLKGER.F Y 63.54 2285.0061 18 0.5 572.2591 4 19.42 1 7724 01122020_RID_2209_BuCaKA02.raw 0 0 0 360 377 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NKLLPSSC(+57.02)GFNKEFDEEK.C Y 62.69 2141.0098 18 2.0 714.6786 3 23.75 1 11092 01122020_RID_2209_BuCaKA02.raw 2.2348E6 1 1 323 340 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.EVTVDVGKESGATTNIFFKPPC(+57.02)VSVYR.C Y 58.76 2999.5061 27 1.4 750.8848 4 55.13 1 35441 01122020_RID_2209_BuCaKA02.raw 3.7355E7 1 1 136 162 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
K.KRC(+57.02)DSGFYYSEEVC(+57.02)R.C Y 55.86 1954.8301 15 1.9 652.6185 3 13.67 1 3155 01122020_RID_2209_BuCaKA02.raw 1.6065E6 1 1 395 409 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.SGFYYSEEVC(+57.02)R.C Y 45.73 1395.5765 11 1.3 698.7964 2 29.28 1 15193 01122020_RID_2209_BuCaKA02.raw 1.1668E7 1 1 399 409 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
T_76
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNKC(+57.02)FLKGER.F Y 63.54 2285.0061 18 0.5 572.2591 4 19.42 1 7724 01122020_RID_2209_BuCaKA02.raw 0 0 0 360 377 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NKLLPSSC(+57.02)GFNKEFDEEK.C Y 62.69 2141.0098 18 2.0 714.6786 3 23.75 1 11092 01122020_RID_2209_BuCaKA02.raw 2.2348E6 1 1 323 340 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.EVTVDVGKESGATTNIFFKPPC(+57.02)VSVYR.C Y 58.76 2999.5061 27 1.4 750.8848 4 55.13 1 35441 01122020_RID_2209_BuCaKA02.raw 3.7355E7 1 1 136 162 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
K.KRC(+57.02)DSGFYYSEEVC(+57.02)R.C Y 55.86 1954.8301 15 1.9 652.6185 3 13.67 1 3155 01122020_RID_2209_BuCaKA02.raw 1.6065E6 1 1 395 409 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.SGFYYSEEVC(+57.02)R.C Y 45.73 1395.5765 11 1.3 698.7964 2 29.28 1 15193 01122020_RID_2209_BuCaKA02.raw 1.1668E7 1 1 399 409 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026542555.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.SLGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 63.45 2674.4517 26 0.8 892.4919 3 92.10 1 66045 01122020_RID_2209_BuCaKA02.raw 6.0985E7 2 2 57 82 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
L.GPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 62.47 2474.3354 24 0.3 825.7860 3 86.70 1 61488 01122020_RID_2209_BuCaKA02.raw 1.7738E7 2 2 59 82 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.DPLSLGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 59.13 2999.6152 29 2.8 1000.8818 3 106.13 1 77439 01122020_RID_2209_BuCaKA02.raw 4.0835E6 1 1 54 82 Carbamidomethylation C19:Carbamidomethylation:1000.00 PEAKS DB
S.LGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 56.61 2587.4194 25 0.9 863.4812 3 91.75 1 65524 01122020_RID_2209_BuCaKA02.raw 2.9947E6 1 1 58 82 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026542553.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
L.SLGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 63.45 2674.4517 26 0.8 892.4919 3 92.10 1 66045 01122020_RID_2209_BuCaKA02.raw 6.0985E7 2 2 57 82 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
L.GPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 62.47 2474.3354 24 0.3 825.7860 3 86.70 1 61488 01122020_RID_2209_BuCaKA02.raw 1.7738E7 2 2 59 82 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.DPLSLGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 59.13 2999.6152 29 2.8 1000.8818 3 106.13 1 77439 01122020_RID_2209_BuCaKA02.raw 4.0835E6 1 1 54 82 Carbamidomethylation C19:Carbamidomethylation:1000.00 PEAKS DB
S.LGPPLSGFPLPPASC(+57.02)TPLQLSAVLR.H Y 56.61 2587.4194 25 0.9 863.4812 3 91.75 1 65524 01122020_RID_2209_BuCaKA02.raw 2.9947E6 1 1 58 82 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
ETE60521.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 69 79 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 59 79 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 70 79 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 59 83 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026580631.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 15 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 5 25 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 16 25 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 5 29 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026580634.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 15 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 5 25 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 16 25 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 5 29 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
JAB53385.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 15 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 5 25 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 16 25 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 5 29 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026580630.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 15 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 5 25 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 16 25 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 5 29 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026580635.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.C(+57.02)IESLLAVFQR.Y Y 71.56 1334.7017 11 0.3 668.3583 2 75.75 1 52262 01122020_RID_2209_BuCaKA02.raw 1.3754E7 1 1 15 25 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQR.Y Y 69.47 2468.2368 21 1.2 823.7538 3 86.96 1 61629 01122020_RID_2209_BuCaKA02.raw 3.6849E6 1 1 5 25 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.IESLLAVFQR.Y Y 53.59 1174.6710 10 1.2 588.3435 2 68.88 1 46588 01122020_RID_2209_BuCaKA02.raw 4.3068E6 1 1 16 25 PEAKS DB
R.YTVGPTETERC(+57.02)IESLLAVFQRYAGK.E Y 40.61 2887.4539 25 6.3 722.8753 4 87.50 1 62078 01122020_RID_2209_BuCaKA02.raw 0 0 0 5 29 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026555793.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GTTEHLLEIVLGR.C Y 82.40 1436.7987 13 3.0 719.4088 2 62.71 1 41582 01122020_RID_2209_BuCaKA02.raw 1.9671E8 1 1 56 68 PEAKS DB
K.SSIFGSVEIVNLNPEKVSK.M Y 73.26 2046.0996 19 -0.7 1024.0564 2 58.26 1 37931 01122020_RID_2209_BuCaKA02.raw 3.4484E7 2 2 222 240 PEAKS DB
K.MQIWLMHDIGGPQRETC(+57.02)TGHSIAQLR.E Y 45.24 3034.4688 26 2.8 607.9027 5 42.43 1 25469 01122020_RID_2209_BuCaKA02.raw 9.0361E5 1 1 241 266 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_032087784.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SKPISSPVIIQFGHAETLQPLLSLMGYFKDKVPLNASNYR.H Y 72.41 4458.3774 40 5.4 744.0742 6 83.24 1 58555 01122020_RID_2209_BuCaKA02.raw 1.5375E6 1 1 350 389 PEAKS DB
R.SKPISSPVIIQFGHAETLQPLLSLMGYFK.D N 64.44 3200.7307 29 2.9 801.1923 4 88.51 1 62877 01122020_RID_2209_BuCaKA02.raw 4.2933E6 1 1 350 378 PEAKS DB
R.SKPISSPVIIQFGHAETLQPLLSL.M N 41.27 2574.4421 24 2.4 859.1567 3 77.36 1 53499 01122020_RID_2209_BuCaKA02.raw 1.8791E8 1 1 350 373 PEAKS DB
total 3 peptides
XP_013925207.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SKPISSPVIIQFGHAETLQPLLSLMGYFKDKVPLNASNYR.H Y 72.41 4458.3774 40 5.4 744.0742 6 83.24 1 58555 01122020_RID_2209_BuCaKA02.raw 1.5375E6 1 1 226 265 PEAKS DB
R.SKPISSPVIIQFGHAETLQPLLSLMGYFK.D N 64.44 3200.7307 29 2.9 801.1923 4 88.51 1 62877 01122020_RID_2209_BuCaKA02.raw 4.2933E6 1 1 226 254 PEAKS DB
R.SKPISSPVIIQFGHAETLQPLLSL.M N 41.27 2574.4421 24 2.4 859.1567 3 77.36 1 53499 01122020_RID_2209_BuCaKA02.raw 1.8791E8 1 1 226 249 PEAKS DB
total 3 peptides
XP_025032622.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
F.LGIPFAEPPVGR.R N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 57 68 PEAKS DB
A.FLGIPFAEPPVGR.R N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 56 68 PEAKS DB
L.DGHISAFLGIPFAEPPVGR.R Y 56.95 1979.0264 19 1.1 660.6835 3 74.66 1 51410 01122020_RID_2209_BuCaKA02.raw 6.7052E6 1 1 50 68 PEAKS DB
total 3 peptides
XP_025032620.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
F.LGIPFAEPPVGR.R N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 57 68 PEAKS DB
A.FLGIPFAEPPVGR.R N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 56 68 PEAKS DB
L.DGHISAFLGIPFAEPPVGR.R Y 56.95 1979.0264 19 1.1 660.6835 3 74.66 1 51410 01122020_RID_2209_BuCaKA02.raw 6.7052E6 1 1 50 68 PEAKS DB
total 3 peptides
XP_025032621.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
F.LGIPFAEPPVGR.R N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 57 68 PEAKS DB
A.FLGIPFAEPPVGR.R N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 56 68 PEAKS DB
L.DGHISAFLGIPFAEPPVGR.R Y 56.95 1979.0264 19 1.1 660.6835 3 74.66 1 51410 01122020_RID_2209_BuCaKA02.raw 6.7052E6 1 1 50 68 PEAKS DB
total 3 peptides
JAC94932.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
F.LGIPFAEPPVGR.L N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 65 76 PEAKS DB
A.FLGIPFAEPPVGR.L N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 64 76 PEAKS DB
L.DGHISAFLGIPFAEPPVGR.L Y 56.95 1979.0264 19 1.1 660.6835 3 74.66 1 51410 01122020_RID_2209_BuCaKA02.raw 6.7052E6 1 1 58 76 PEAKS DB
total 3 peptides
XP_025032619.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
F.LGIPFAEPPVGR.R N 65.37 1251.6975 12 1.1 626.8567 2 56.11 1 36154 01122020_RID_2209_BuCaKA02.raw 4.6223E8 1 1 97 108 PEAKS DB
A.FLGIPFAEPPVGR.R N 62.09 1398.7659 13 0.0 700.3902 2 73.18 1 50153 01122020_RID_2209_BuCaKA02.raw 1.8064E7 1 1 96 108 PEAKS DB
L.DGHISAFLGIPFAEPPVGR.R Y 56.95 1979.0264 19 1.1 660.6835 3 74.66 1 51410 01122020_RID_2209_BuCaKA02.raw 6.7052E6 1 1 90 108 PEAKS DB
total 3 peptides
ETE64512.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 213 228 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 252 267 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_015667558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 213 228 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 252 267 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_032086218.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 335 350 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 374 389 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_034281438.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 340 355 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 379 394 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
LAB62693.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 13 28 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 52 67 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
LAB62690.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 240 255 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 279 294 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026570202.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 345 360 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 384 399 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026535930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 341 356 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 380 395 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_025027126.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 137 152 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 176 191 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
LAB18302.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 31 46 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.V Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 70 85 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_015686495.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 101 116 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.V Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 140 155 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
LAB18300.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.QKLIAQDYKVSYSLAK.S Y 74.11 1854.0250 16 1.4 619.0165 3 23.97 1 11320 01122020_RID_2209_BuCaKA02.raw 3.243E6 1 1 31 46 PEAKS DB
R.LSYLLMC(+57.02)LESAVHRGR.Q Y 70.22 1903.9761 16 1.1 635.6667 3 54.54 1 34825 01122020_RID_2209_BuCaKA02.raw 6.4413E6 1 1 70 85 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026547933.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.DPWWYVDLGR.Q Y 74.51 1305.6141 10 1.0 653.8150 2 81.69 1 57247 01122020_RID_2209_BuCaKA02.raw 3.5002E6 1 1 60 69 PEAKS DB
R.GRPAFQSSTIESQFNSVAR.K Y 68.79 2081.0291 19 0.8 694.6842 3 34.62 1 19412 01122020_RID_2209_BuCaKA02.raw 1.1597E7 1 1 17 35 PEAKS DB
total 2 peptides
XP_026578807.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.DPWWYVDLGR.Q Y 74.51 1305.6141 10 1.0 653.8150 2 81.69 1 57247 01122020_RID_2209_BuCaKA02.raw 3.5002E6 1 1 463 472 PEAKS DB
R.GRPAFQSSTIESQFNSVAR.K Y 68.79 2081.0291 19 0.8 694.6842 3 34.62 1 19412 01122020_RID_2209_BuCaKA02.raw 1.1597E7 1 1 420 438 PEAKS DB
total 2 peptides
LAB57810.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.FVLDPLITHTLPFEKINEGFDLLR.S Y 78.40 2826.5320 24 2.2 707.6418 4 87.54 1 62075 01122020_RID_2209_BuCaKA02.raw 1.504E7 2 2 287 310 PEAKS DB
K.KFVLDPLITHTLPFEKINEGFDLLR.S Y 55.68 2954.6270 25 0.0 739.6640 4 78.56 1 54771 01122020_RID_2209_BuCaKA02.raw 1.3431E6 1 1 286 310 PEAKS DB
total 2 peptides
P80512.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.FVLDPLITHTLPFEKINEGFDLLR.S Y 78.40 2826.5320 24 2.2 707.6418 4 87.54 1 62075 01122020_RID_2209_BuCaKA02.raw 1.504E7 2 2 341 364 PEAKS DB
K.KFVLDPLITHTLPFEKINEGFDLLR.S Y 55.68 2954.6270 25 0.0 739.6640 4 78.56 1 54771 01122020_RID_2209_BuCaKA02.raw 1.3431E6 1 1 340 364 PEAKS DB
total 2 peptides
XP_026528465.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.FVLDPLITHTLPFEKINEGFDLLR.S Y 78.40 2826.5320 24 2.2 707.6418 4 87.54 1 62075 01122020_RID_2209_BuCaKA02.raw 1.504E7 2 2 342 365 PEAKS DB
K.KFVLDPLITHTLPFEKINEGFDLLR.S Y 55.68 2954.6270 25 0.0 739.6640 4 78.56 1 54771 01122020_RID_2209_BuCaKA02.raw 1.3431E6 1 1 341 365 PEAKS DB
total 2 peptides
LAA59635.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.FVLDPLITHTLPFEKINEGFDLLR.S Y 78.40 2826.5320 24 2.2 707.6418 4 87.54 1 62075 01122020_RID_2209_BuCaKA02.raw 1.504E7 2 2 342 365 PEAKS DB
K.KFVLDPLITHTLPFEKINEGFDLLR.S Y 55.68 2954.6270 25 0.0 739.6640 4 78.56 1 54771 01122020_RID_2209_BuCaKA02.raw 1.3431E6 1 1 341 365 PEAKS DB
total 2 peptides
XP_026554078.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.FVLDPLITHTLPFEKINEGFDLLR.S Y 78.40 2826.5320 24 2.2 707.6418 4 87.54 1 62075 01122020_RID_2209_BuCaKA02.raw 1.504E7 2 2 342 365 PEAKS DB
K.KFVLDPLITHTLPFEKINEGFDLLR.S Y 55.68 2954.6270 25 0.0 739.6640 4 78.56 1 54771 01122020_RID_2209_BuCaKA02.raw 1.3431E6 1 1 341 365 PEAKS DB
total 2 peptides
T_81
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SIEDGTLYIIEQVPNLVEYSDQTTVLR.K Y 77.14 3094.5710 27 0.5 1032.5315 3 103.50 1 75181 01122020_RID_2209_BuCaKA02.raw 2.7796E7 2 2 373 399 PEAKS DB
R.SIEDGTLYIIEQVPNLVEYSDQTTVLRK.G Y 55.51 3222.6660 28 1.4 1075.2308 3 90.50 1 64666 01122020_RID_2209_BuCaKA02.raw 1.5805E7 1 1 373 400 PEAKS DB
total 2 peptides
T_83
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.SIEDGTLYIIEQVPNLVEYSDQTTVLR.K Y 77.14 3094.5710 27 0.5 1032.5315 3 103.50 1 75181 01122020_RID_2209_BuCaKA02.raw 2.7796E7 2 2 373 399 PEAKS DB
R.SIEDGTLYIIEQVPNLVEYSDQTTVLRK.G Y 55.51 3222.6660 28 1.4 1075.2308 3 90.50 1 64666 01122020_RID_2209_BuCaKA02.raw 1.5805E7 1 1 373 400 PEAKS DB
total 2 peptides
XP_026545897.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FFAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 67.83 2247.0894 21 0.8 750.0377 3 45.80 1 28096 01122020_RID_2209_BuCaKA02.raw 7.6599E7 1 1 42 62 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
F.FAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 47.26 2100.0210 20 2.3 701.0159 3 35.51 1 20138 01122020_RID_2209_BuCaKA02.raw 7.0889E6 1 1 43 62 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG67762.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FFAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 67.83 2247.0894 21 0.8 750.0377 3 45.80 1 28096 01122020_RID_2209_BuCaKA02.raw 7.6599E7 1 1 42 62 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
F.FAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 47.26 2100.0210 20 2.3 701.0159 3 35.51 1 20138 01122020_RID_2209_BuCaKA02.raw 7.0889E6 1 1 43 62 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG67761.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.FFAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 67.83 2247.0894 21 0.8 750.0377 3 45.80 1 28096 01122020_RID_2209_BuCaKA02.raw 7.6599E7 1 1 42 62 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
F.FAHFGNLSGPSAIC(+57.02)GNPQVK.A Y 47.26 2100.0210 20 2.3 701.0159 3 35.51 1 20138 01122020_RID_2209_BuCaKA02.raw 7.0889E6 1 1 43 62 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ETE73401.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 126 141 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 151 174 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026580326.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 60 75 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 85 108 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAS05177.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 135 150 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 160 183 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAI09074.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 135 150 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 160 183 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAS05063.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 135 150 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 160 183 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAB54462.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 135 150 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 160 183 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026548111.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NGNC(+57.02)EQFC(+57.02)VDSPTTLR.Q Y 72.67 1896.8094 16 1.7 949.4136 2 34.34 1 19139 01122020_RID_2209_BuCaKA02.raw 1.3762E7 1 1 106 121 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LASDQVSC(+57.02)IAEVDYPC(+57.02)GKIPVLAK.R Y 55.92 2632.3240 24 0.8 878.4493 3 55.90 1 35985 01122020_RID_2209_BuCaKA02.raw 1.2309E6 1 1 131 154 Carbamidomethylation C8:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AAB20783.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C N 72.32 2032.8254 19 1.0 1017.4210 2 34.88 1 19734 01122020_RID_2209_BuCaKA02.raw 4.869E7 1 1 25 43 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
NLYQFGNMIQC(+57.02)ANHGRRPTLAYADYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 48.76 4824.1323 43 7.8 965.8413 5 106.07 1 76568 01122020_RID_2209_BuCaKA02.raw 3.4561E6 4 4 1 43 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
P08873.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C N 72.32 2032.8254 19 1.0 1017.4210 2 34.88 1 19734 01122020_RID_2209_BuCaKA02.raw 4.869E7 1 1 52 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFGNMIQC(+57.02)ANHGRRPTLAYADYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 48.76 4824.1323 43 7.8 965.8413 5 106.07 1 76568 01122020_RID_2209_BuCaKA02.raw 3.4561E6 4 4 28 70 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
CAA31125.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C N 72.32 2032.8254 19 1.0 1017.4210 2 34.88 1 19734 01122020_RID_2209_BuCaKA02.raw 4.869E7 1 1 52 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFGNMIQC(+57.02)ANHGRRPTLAYADYGC(+57.02)YC(+57.02)GAGGSGTPVDELDR.C Y 48.76 4824.1323 43 7.8 965.8413 5 106.07 1 76568 01122020_RID_2209_BuCaKA02.raw 3.4561E6 4 4 28 70 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AFJ49950.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAA97186.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAI13488.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAC95701.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAC95700.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAI10049.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAG46923.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
XP_015672964.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAG44960.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAV50678.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
JAB54325.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.THINIVVIGHVDSGKSTTTGHLIYK.C Y 61.01 2689.4551 25 1.5 673.3721 4 24.93 1 12000 01122020_RID_2209_BuCaKA02.raw 6.5029E5 1 1 6 30 PEAKS DB
K.DGSASGTTLLEALDSILPPTRPTDKPLRLPLQ.D Y 47.78 3371.8298 32 0.9 843.9655 4 92.02 1 65767 01122020_RID_2209_BuCaKA02.raw 1.7507E7 1 1 220 251 PEAKS DB
total 2 peptides
XP_015682720.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.VLTSFGEAIKHLDNIK.E Y 76.91 1783.9832 16 0.4 595.6686 3 43.88 1 26464 01122020_RID_2209_BuCaKA02.raw 8.7682E6 1 1 68 83 PEAKS DB
total 1 peptides
XP_026542227.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 64 81 PEAKS DB
total 1 peptides
JAI12109.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
JAG46036.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
XP_032087395.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
XP_015676923.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
AFJ50914.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
JAB53691.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
JAV51398.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
XP_034294750.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
LAA63155.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 119 136 PEAKS DB
total 1 peptides
JAG68880.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 77 94 PEAKS DB
total 1 peptides
LAB46151.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.AGSAVDDFINKLVPLLSR.G Y 75.36 1914.0574 18 2.0 639.0276 3 89.85 1 64053 01122020_RID_2209_BuCaKA02.raw 5.3043E5 1 1 112 129 PEAKS DB
total 1 peptides
Q9DF52.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NM(+15.99)IQC(+57.02)AGTRPWTAYVNYGC(+57.02)YC(+57.02)GKGGSGTPVDELDR.C Y 49.01 3968.7339 35 -0.4 993.1903 4 52.51 1 32922 01122020_RID_2209_BuCaKA02.raw 1.7513E9 1 1 34 68 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.26 1647.6843 13 0.5 824.8499 2 55.77 1 35810 01122020_RID_2209_BuCaKA02.raw 2.2718E7 1 1 114 126 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AAG13412.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NM(+15.99)IQC(+57.02)AGTRPWTAYVNYGC(+57.02)YC(+57.02)GKGGSGTPVDELDR.C Y 49.01 3968.7339 35 -0.4 993.1903 4 52.51 1 32922 01122020_RID_2209_BuCaKA02.raw 1.7513E9 1 1 34 68 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.FLC(+57.02)DC(+57.02)DRTAAIC(+57.02)F.A N 44.26 1647.6843 13 0.5 824.8499 2 55.77 1 35810 01122020_RID_2209_BuCaKA02.raw 2.2718E7 1 1 114 126 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
P15816.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S Y 70.87 1790.8080 16 0.7 896.4119 2 30.48 1 16118 01122020_RID_2209_BuCaKA02.raw 1.7586E6 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA35774.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S Y 70.87 1790.8080 16 0.7 896.4119 2 30.48 1 16118 01122020_RID_2209_BuCaKA02.raw 1.7586E6 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
O12962.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S Y 70.87 1790.8080 16 0.7 896.4119 2 30.48 1 16118 01122020_RID_2209_BuCaKA02.raw 1.7586E6 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA72940.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S Y 70.87 1790.8080 16 0.7 896.4119 2 30.48 1 16118 01122020_RID_2209_BuCaKA02.raw 1.7586E6 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACE73577.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
ACE73578.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
T_89
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
T_93
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
T_92
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
T_95
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
T_91
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 65 81 PEAKS DB
total 1 peptides
T_94
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 96 112 PEAKS DB
total 1 peptides
P81993.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.F Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 29 45 PEAKS DB
total 1 peptides
T_96
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 65 81 PEAKS DB
total 1 peptides
ACN93671.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 53 69 PEAKS DB
total 1 peptides
ACH73168.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
AAP20603.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
Q7ZZN8.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
P84808.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
AHZ08822.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
XP_032069593.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
JAC94992.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 54 70 PEAKS DB
total 1 peptides
ETE62137.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NMLQMEWNSNAAQNAKR.W Y 69.57 2004.9258 17 0.1 669.3159 3 29.96 1 15691 01122020_RID_2209_BuCaKA02.raw 1.3601E7 1 1 60 76 PEAKS DB
total 1 peptides
XP_034292109.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.RKEC(+57.02)PLGSHAC(+57.02)GPC(+57.02)LPQFVEDR.E Y 69.56 2612.2046 22 1.5 654.0594 4 24.85 1 11957 01122020_RID_2209_BuCaKA02.raw 1.5314E7 1 1 54 75 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9PRL9.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NAELYGSETLTR.M Y 68.46 1352.6572 12 1.3 677.3368 2 25.94 1 12572 01122020_RID_2209_BuCaKA02.raw 8.8287E6 2 2 20 31 PEAKS DB
total 1 peptides
AAB34003.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NAELYGSETLTR.M Y 68.46 1352.6572 12 1.3 677.3368 2 25.94 1 12572 01122020_RID_2209_BuCaKA02.raw 8.8287E6 2 2 20 31 PEAKS DB
total 1 peptides
XP_034287104.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 3 18 PEAKS DB
total 1 peptides
LAB37887.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
JAG68721.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
XP_026532239.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
XP_013926160.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
XP_026574715.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
XP_032080318.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
JAC96259.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.GLGTDETTVIEILTGR.S Y 68.09 1673.8835 16 2.0 837.9507 2 84.83 1 59810 01122020_RID_2209_BuCaKA02.raw 8.9964E5 1 1 33 48 PEAKS DB
total 1 peptides
AAL30054.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.RTC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 67.87 2793.3247 24 -0.6 932.1150 3 42.73 1 25636 01122020_RID_2209_BuCaKA02.raw 1.3114E8 1 1 22 45 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q8AY56.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.RTC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 67.87 2793.3247 24 -0.6 932.1150 3 42.73 1 25636 01122020_RID_2209_BuCaKA02.raw 1.3114E8 1 1 22 45 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA33342.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.LGAINTISC(+57.02)KGQVGRYVIVTVPGR.T Y 67.24 2557.4163 24 -0.8 640.3608 4 39.99 1 23763 01122020_RID_2209_BuCaKA02.raw 0 0 0 127 150 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAB47895.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.LGAINTISC(+57.02)KGQVGRYVIVTVPGR.T Y 67.24 2557.4163 24 -0.8 640.3608 4 39.99 1 23763 01122020_RID_2209_BuCaKA02.raw 0 0 0 191 214 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
T_74
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GAVIEQGC(+57.02)VATC(+57.02)PQFR.S Y 66.13 1791.8396 16 2.6 896.9294 2 33.04 1 18066 01122020_RID_2209_BuCaKA02.raw 1.8424E6 1 1 60 75 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026528620.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
XP_026569354.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
XP_026528619.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
XP_026569353.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
XP_015669101.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
AFJ51008.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
BAN82088.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
ETE61271.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 366 378 PEAKS DB
total 1 peptides
XP_013923763.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
XP_013923762.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
XP_007441356.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SIIDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 227 239 PEAKS DB
total 1 peptides
XP_032088229.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 362 374 PEAKS DB
total 1 peptides
XP_034291658.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
XP_032088228.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 365 377 PEAKS DB
total 1 peptides
XP_034291656.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 367 379 PEAKS DB
total 1 peptides
XP_034291657.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 368 380 PEAKS DB
total 1 peptides
XP_034291655.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 61.92 1416.7534 13 1.3 709.3849 2 99.16 1 71510 01122020_RID_2209_BuCaKA02.raw 2.5269E5 1 1 368 380 PEAKS DB
total 1 peptides
XP_034265676.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
XP_032082279.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAI09679.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
AFJ50899.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAB53717.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
XP_026524951.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAG67074.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
LAB58410.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAA96187.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAV49687.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
XP_015687493.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
JAI12121.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
XP_026559154.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
G.DSWGILFSHPR.D Y 60.31 1313.6516 11 -0.3 657.8329 2 52.38 1 33030 01122020_RID_2209_BuCaKA02.raw 3.5037E6 1 1 30 40 PEAKS DB
total 1 peptides
ETE73981.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.NLLSVAYKNVVGC(+57.02)QR.S Y 58.22 1719.9091 15 1.1 574.3109 3 42.31 1 25383 01122020_RID_2209_BuCaKA02.raw 0 0 0 21 35 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83997.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83990.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P01385.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 25 33 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
0512217A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 25 33 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83992.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1HAJ
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1IDH
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
2BTX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1IK8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1BXP
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1ABT
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1IKC
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83994.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83991.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1IDL
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
1HOY
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83993.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
720920A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
2ABX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 28 36 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11311.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ADN67593.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11305.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11309.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAD92407.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11312.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11307.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11310.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11304.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11302.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
D2N116.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11303.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAM11306.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 30 38 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q8UW29.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAL54892.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
A3FM53.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 47 55 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABN54806.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
S.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 47 55 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74770.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P01384.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABK63537.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74654.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
T.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 46 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAC83981.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 49 57 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAL30056.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
M.WC(+57.02)DAFC(+57.02)SSR.G Y 56.12 1187.4489 9 0.5 594.7320 2 25.21 1 12147 01122020_RID_2209_BuCaKA02.raw 1.1946E7 1 1 49 57 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA32179.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 82 94 PEAKS DB
total 1 peptides
XP_026524224.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026568672.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026524225.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026568674.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_015667825.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026524226.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_034288350.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_007435816.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026568671.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026568673.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
XP_026524223.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 85 97 PEAKS DB
total 1 peptides
ETE70626.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
LAB55207.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 95 107 PEAKS DB
total 1 peptides
LAA32175.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 95 107 PEAKS DB
total 1 peptides
JAV48583.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
XP_015667816.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
XP_034288348.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
XP_007435815.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
XP_026524222.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
XP_026568670.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 96 108 PEAKS DB
total 1 peptides
LAA32177.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GIPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 97 109 PEAKS DB
total 1 peptides
XP_025027268.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.GLPDSIASVLNKL.V Y 55.14 1325.7554 13 1.6 663.8860 2 85.74 1 60595 01122020_RID_2209_BuCaKA02.raw 3.3012E5 1 1 124 136 PEAKS DB
total 1 peptides
P02010.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.VIDALDNAVEGLDDAVATLSKLSDLHAQK.L Y 54.82 3020.5664 29 9.3 756.1559 4 94.00 1 67406 01122020_RID_2209_BuCaKA02.raw 0 0 0 62 90 PEAKS DB
total 1 peptides
XP_032076462.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_032076461.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 183 197 PEAKS DB
total 1 peptides
ETE56723.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 51 65 PEAKS DB
total 1 peptides
XP_026546198.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026546199.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026546197.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
JAB54304.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026579206.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026579205.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026579207.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 154 168 PEAKS DB
total 1 peptides
XP_026546196.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 168 182 PEAKS DB
total 1 peptides
ETE59939.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.SSTFTLTNIVPQFIK.L Y 52.14 1694.9243 15 0.3 848.4697 2 79.49 1 55463 01122020_RID_2209_BuCaKA02.raw 1.1705E6 1 1 134 148 PEAKS DB
total 1 peptides
LAA72691.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
LAA72685.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
ETE73165.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
LAA72697.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
XP_026519973.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
XP_026556356.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
XP_026556355.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
XP_034291632.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.IGLVVIGPEVPLAAGIVDDLAAAGVR.C Y 51.18 2484.4314 26 0.6 829.1516 3 107.41 1 78285 01122020_RID_2209_BuCaKA02.raw 4.5855E5 1 1 67 92 PEAKS DB
total 1 peptides
XP_013931233.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.LLVVYPWTQRFFAHFGNLSGASAIC(+57.02)GNPQVK.A Y 45.93 3476.7815 31 3.4 696.3659 5 59.19 1 38711 01122020_RID_2209_BuCaKA02.raw 3.3751E7 1 1 32 62 Carbamidomethylation C25:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032075324.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.LLVVYPWTQRFFAHFGNLSGASAIC(+57.02)GNPQVK.A Y 45.93 3476.7815 31 3.4 696.3659 5 59.19 1 38711 01122020_RID_2209_BuCaKA02.raw 3.3751E7 1 1 32 62 Carbamidomethylation C25:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026561289.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
R.VRDVELLTGLDF.Y Y 41.50 1375.7347 12 2.1 688.8761 2 74.92 1 51748 01122020_RID_2209_BuCaKA02.raw 2.615E6 1 1 816 827 PEAKS DB
total 1 peptides
XP_007429085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
LAA86986.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 234 246 PEAKS DB
total 1 peptides
LAB57337.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 252 264 PEAKS DB
total 1 peptides
XP_013923615.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
XP_026520312.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
XP_034273852.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
LAB44384.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
XP_026566518.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 523 535 PEAKS DB
total 1 peptides
XP_032069561.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
E.FTGLEQIVPNIVR.A Y 40.86 1484.8351 13 4.1 743.4279 2 69.07 1 46817 01122020_RID_2209_BuCaKA02.raw 1.1454E6 1 1 542 554 PEAKS DB
total 1 peptides
XP_026526467.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
K.NVHISSNGIAEAR.N Y 40.42 1366.6953 13 -2.6 684.3531 2 72.27 1 49381 01122020_RID_2209_BuCaKA02.raw 1.7947E7 1 1 237 249 PEAKS DB
total 1 peptides
ABW24182.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
P.TKHYMDYSC(+57.02)YC(+57.02)GKGGSGTPVDELDR.C Y 40.08 2895.2261 25 0.9 966.0835 3 85.70 1 60609 01122020_RID_2209_BuCaKA02.raw 1.8079E5 2 2 46 70 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013931090.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 427 437 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032091032.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAB54294.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_007441409.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAG68757.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CBN61477.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAD41646.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026571534.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026582136.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 95 105 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013923835.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 109 119 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013916893.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 136 146 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA54352.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 220 230 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA72706.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 244 254 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA54354.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 306 316 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA54356.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 324 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA78451.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 327 337 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA78455.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 327 337 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI10301.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAG47510.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAG45884.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026569147.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA97809.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026542044.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AFJ49385.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026544503.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAC96284.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAB54295.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI14387.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_007420481.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAV51289.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 384 394 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE72098.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
D.LVVGLC(+57.02)TGQIK.T Y 39.69 1186.6743 11 1.1 594.3451 2 36.12 1 20687 01122020_RID_2209_BuCaKA02.raw 0 0 0 422 432 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P81236.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BRom #Feature #Feature BRom Start End PTM AScore Found By
DLFQFGGMIGC(+57.02)ANKGARSWLSYVNYGC(+57.02)YC(+57.02)GWGGSGTPVDELDR.C Y 39.20 4820.1304 43 8.4 1206.0500 4 61.66 1 40689 01122020_RID_2209_BuCaKA02.raw 0 0 0 1 43 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Peptide List


 


Prepared with PEAKS ™ (bioinfor.com)