Summary

1. Notes


2. Result Statistics

Figure 1. False discovery rate (FDR) curve. X axis is the number of peptide-spectrum matches (PSM) being kept. Y axis is the corresponding FDR.



Figure 2. PSM score distribution. (a) Distribution of PEAKS peptide score; (b) Scatterplot of PEAKS peptide score versus precursor mass error.

(a)
(b)
Table 1. Statistics of data.
#Scans#FeaturesIdentified#Peptides#Sequences#Proteins*
MS1MS2#PSMs#Scans#FeaturesGroupsAllTop
Total122716480995736158115601199353450672418247
BuCaMH03_B17122716480995736158115601199353450672418247
* proteins with significant peptides are used in counts.

Figure 3. Sample overlap for Proteins and Peptides (up to 8 samples). (a) All Proteins; (b) Top Proteins; (c) Peptides;

(a)
Not applicable to only one sample
(b)
Not applicable to only one sample
(c)
Not applicable to only one sample

Figure 4. Distribution of peptide feature detection. (a) Feature m/z distribution; (b) Feature RT distribution.

(a)
(b)

Figure 5. Distribution of identified peptide features. (a) Feature abundance distribution; (b) De novo sequencing validation.

(a)
(b)
Table 2. Result filtration parameters.
Peptide -10lgP≥53
PTM Ascore≥0
Protein -10lgP≥20
Proteins unique peptides≥1
De novo score(%)≥50%
Table 3. Statistics of filtered result.
FDR (Peptide-Spectrum Matches)0.1%
FDR (Peptide Sequences)0.2%
FDR (Protein Group)1.4%
De Novo Only Spectra17288
Table 4. PTM profile.
Name ∆Mass Position #PSM -10lgP Abundance AScore
Carbamidomethyl57.02C941122.667.29E81000.00
Oxidation15.99M12197.351.42E791.37

3. Experiment Control

Figure 6. Precursor mass error of peptide-spectrum matches (PSM) in filtered result. (a) Distribution of precursor mass error in ppm; (b) Scatterplot of precursor m/z versus precursor mass error in ppm.

(a)
(b)

Table 5. Number of identified peptides in each sample by the number of missed cleavages.

Missed Cleavages01234+
BuCaMH03_B1745671700

4. Other Information

Table 6. Search parameters.
Search Engine Name: PEAKS
Parent Mass Error Tolerance: 10.0 ppm
Fragment Mass Error Tolerance: 0.6 Da
Precursor Mass Search Type: monoisotopic
Enzyme: Trypsin
Max Missed Cleavages: 2
Digest Mode: Semispecific
Fixed Modifications:
  Carbamidomethylation: 57.02
Variable Modifications:
  Oxidation (M): 15.99
Max Variable PTM Per Peptide: 3
Database: NCBI_Serpentes_BuCaMH03
Taxon: All
Contaminant Database: cRAP_contaminants
Searched Entry: 410252
FDR Estimation: Enabled
Merge Options: no merge
Precursor Options: corrected
Charge Options: no correction
Filter Charge: 2 - 8
Process: true
Associate chimera: yes
Table 7. Instrument parameters.
Fractions: BuCaMH03.raw
Ion Source: ESI(nano-spray)
Fragmentation Mode: CID, CAD(y and b ions)
MS Scan Mode: FT-ICR/Orbitrap
MS/MS Scan Mode: FT-ICR/Orbitrap

Protein List

Protein Accession Contains:
Protein Description Contains:
Protein Sample Area >=
Protein PTM Contains:
Protein Group Protein ID Accession -10lgP Coverage (%) Coverage (%) BuCaMH03_B17 Area BuCaMH03_B17 #Peptides #Unique #Spec BuCaMH03_B17 PTM Avg. Mass Description
10 1 T_169 452.57 64 64 1.082E8 52 6 117 Y 64765 T_169
10 2 T_163 452.57 60 60 1.082E8 52 6 117 Y 69045 T_163
10 10 T_161 452.57 55 55 1.082E8 52 6 117 Y 74793 T_161
10 11 T_167 452.57 54 54 1.082E8 52 6 117 Y 77947 T_167
11 3 T_170 448.54 59 59 1.3777E8 49 3 114 Y 67886 T_170
11 5 T_168 448.54 59 59 1.3777E8 49 3 114 Y 68170 T_168
11 7 T_171 448.54 59 59 1.3777E8 49 3 114 Y 68170 T_171
11 8 T_166 448.54 60 60 1.3777E8 49 3 114 Y 67340 T_166
5 32 T_48 429.30 69 69 3.9741E9 34 10 154 Y 26263 T_48
5 33 T_44 429.30 58 58 3.9741E9 34 10 154 Y 31189 T_44
4 138 T_42 421.05 69 69 1.2985E10 38 37 178 Y 17261 T_42
15 109 ACE73578.1 377.32 44 44 3.6678E7 19 1 106 Y 26443 cysteine-rich seceretory protein Bc-CRPa [Bungarus candidus]
8 270 T_127 361.32 51 51 9.6016E9 24 10 117 Y 15485 T_127
3 232 T_32 343.33 54 54 6.0057E8 21 3 179 Y 14900 T_32
7 153 T_39 338.21 73 73 7.6555E9 24 23 91 Y 16664 T_39
27 13 T_130 336.02 41 41 3.506E6 23 2 31 Y 62867 T_130
27 14 T_131 336.02 41 41 3.506E6 23 2 31 Y 62867 T_131
28 15 T_128 330.74 41 41 9.3511E5 22 1 30 Y 62831 T_128
28 16 T_129 330.74 41 41 9.3511E5 22 1 30 Y 62831 T_129
14 26 T_6 311.20 22 22 1.915E7 21 2 99 Y 68837 T_6
23 290 T_33 310.13 87 87 1.0325E9 14 7 35 Y 9799 T_33
24 28 ABN72537.1 304.60 32 32 1.2597E8 21 3 26 Y 68988 metalloproteinase [Bungarus multicinctus]
24 29 A8QL49.1 304.60 32 32 1.2597E8 21 3 26 Y 68988 RecName: Full=Zinc metalloproteinase-disintegrin-like BmMP; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
33 125 T_11 301.36 27 27 7.5173E6 12 2 19 Y 31495 T_11
19 686 T_81 300.23 42 42 2.4212E10 19 14 59 Y 11656 T_81
26 412 P15816.1 297.69 43 43 1.6077E9 10 1 29 Y 9517 RecName: Full=Kappa-2-bungarotoxin; AltName: Full=Kappa-neurotoxin CB1; Flags: Precursor
26 413 CAA35774.1 297.69 43 43 1.6077E9 10 1 29 Y 9517 unnamed protein product [Bungarus multicinctus]
29 36 T_111 287.68 26 26 1.1285E7 16 5 25 Y 54560 T_111
32 21 T_144 281.36 30 30 8.5108E6 13 3 14 Y 64593 T_144
32 22 T_146 281.36 30 30 8.5108E6 13 3 14 Y 64593 T_146
32 23 T_147 281.36 30 30 8.5108E6 13 3 14 Y 64593 T_147
32 24 T_143 281.36 30 30 8.5108E6 13 3 14 Y 64593 T_143
9 261 0402253A 256.44 38 38 0 10 1 116 Y 13561 toxin RCM A,beta1 bungaro
9 309 0412250A 256.44 38 38 0 10 1 116 Y 13489 toxin A,beta1 bungaro
40 301 T_12 255.57 31 31 9.7094E7 7 6 12 Y 21438 T_12
48 66 XP_026559083.1 248.31 7 7 4.7046E3 5 1 7 N 88597 sulfhydryl oxidase 1 [Pseudonaja textilis]
35 118 T_16 227.52 24 24 5.7608E7 7 1 12 Y 25774 T_16
22 1663 CAP74383.1 224.26 20 20 2.8949E9 4 3 43 Y 9227 protease inhibitor-like protein 3 precursor [Bungarus multicinctus]
22 1664 B4ESA4.1 224.26 20 20 2.8949E9 4 3 43 Y 9227 RecName: Full=Kunitz-type serine protease inhibitor PILP-3; AltName: Full=Protease inhibitor-like protein 3; Flags: Precursor
66 74 XP_026571757.1 223.00 24 24 2.3295E7 5 5 7 Y 37548 cathepsin B [Pseudonaja textilis]
43 472 XP_026555793.1 221.30 14 14 5.4434E7 8 5 14 Y 34167 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like [Pseudonaja textilis]
38 451 AAL30054.1 219.26 57 57 4.4559E8 8 6 17 Y 9580 kappa 1a bungaratoxin [Bungarus candidus]
38 452 Q8AY56.1 219.26 57 57 4.4559E8 8 6 17 Y 9580 RecName: Full=Kappa 1a-bungarotoxin; Flags: Precursor
59 111 ETE59846.1 213.65 15 15 8.1876E6 9 5 11 Y 72383 Alpha-fetoprotein, partial [Ophiophagus hannah]
61 60 XP_034296605.1 209.17 9 9 1.3683E6 6 1 6 N 106081 endoplasmic reticulum aminopeptidase 1 isoform X1 [Pantherophis guttatus]
61 61 XP_034296606.1 209.17 9 9 1.3683E6 6 1 6 N 106081 endoplasmic reticulum aminopeptidase 1 isoform X1 [Pantherophis guttatus]
61 62 XP_034296607.1 209.17 10 10 1.3683E6 6 1 6 N 98369 endoplasmic reticulum aminopeptidase 1 isoform X2 [Pantherophis guttatus]
67 64 XP_026570202.1 207.56 7 7 2.7819E6 6 6 6 Y 133145 Golgi apparatus protein 1 [Pseudonaja textilis]
67 65 XP_026535930.1 207.56 7 7 2.7819E6 6 6 6 Y 132789 Golgi apparatus protein 1 [Notechis scutatus]
41 586 T_22 203.81 56 56 5.4547E8 4 4 12 Y 10626 T_22
37 557 Q9YGI8.1 200.58 35 35 1.6622E9 5 5 12 Y 9519 RecName: Full=Short neurotoxin homolog NTL4; Flags: Precursor
37 558 CAA06887.1 200.58 35 35 1.6622E9 5 5 12 Y 9519 neurotoxin-like protein [Bungarus multicinctus multicinctus]
74 82 XP_026521896.1 199.72 6 6 7.8843E5 4 1 4 Y 96900 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X2 [Notechis scutatus]
74 83 XP_026521895.1 199.72 6 6 7.8843E5 4 1 4 Y 100962 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X1 [Notechis scutatus]
44 1252 T_176 197.44 38 38 7.226E8 4 4 10 Y 8627 T_176
84 80 T_83 192.46 16 16 4.1885E6 6 6 6 N 64069 T_83
77 194 XP_034277309.1 182.52 10 10 2.5945E6 6 1 7 Y 54304 hyaluronidase [Pantherophis guttatus]
76 395 XP_034264771.1 175.61 15 15 1.4301E7 5 2 8 Y 34352 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like isoform X1 [Pantherophis guttatus]
36 328 T_158 174.15 33 33 3.9784E8 6 6 6 Y 22464 T_158
36 329 T_153 174.15 33 33 3.9784E8 6 6 6 Y 22464 T_153
36 330 T_157 174.15 30 30 3.9784E8 6 6 6 Y 24614 T_157
36 331 T_151 174.15 30 30 3.9784E8 6 6 6 Y 25392 T_151
36 332 T_152 174.15 30 30 3.9784E8 6 6 6 Y 25392 T_152
47 1253 T_175 167.03 30 30 2.4148E8 2 2 14 Y 8565 T_175
82 221 AHJ80886.1 165.14 5 5 2.6873E6 2 1 2 Y 45031 5'-nucleotidase, partial [Macrovipera lebetina]
80 703 T_132 164.12 31 31 7.7006E6 2 2 3 Y 9276 T_132
73 1064 Q9W729.1 163.69 16 16 3.3205E8 2 2 7 Y 9657 RecName: Full=Kappa-6-bungarotoxin; Short=K-6 bungarotoxin; Flags: Precursor
73 1065 CAB46659.1 163.69 16 16 3.3205E8 2 2 7 Y 9657 k-6 bungarotoxin [Bungarus multicinctus]
90 198 T_102 161.71 26 26 1.9147E6 4 2 4 Y 31778 T_102
31 1608 ETE56933.1 159.08 9 9 5.9738E8 3 3 19 Y 15656 hypothetical protein L345_17355, partial [Ophiophagus hannah]
31 1667 1IJC 159.08 19 19 5.9738E8 3 3 19 Y 7285 Chain A, Solution Structure Of Bucandin, A Neurotoxin From The Venom Of The Malayan Krait
31 1668 1F94 159.08 19 19 5.9738E8 3 3 19 Y 7285 Chain A, Bucandin
31 1669 P81782.1 159.08 19 19 5.9738E8 3 3 19 Y 7285 RecName: Full=Bucandin
92 313 ABN72545.1 158.73 16 16 7.7512E5 3 1 3 Y 31010 putative serine protease, partial [Bungarus multicinctus]
92 314 A8QL57.1 158.73 16 16 7.7512E5 3 1 3 Y 31010 RecName: Full=Snake venom serine protease BmSP; Short=SVSP; Flags: Precursor
87 267 XP_026555558.1 158.55 17 17 2.2263E6 5 3 6 Y 61349 hepatocyte growth factor activator [Pseudonaja textilis]
53 587 T_54 157.51 30 30 1.863E8 3 3 6 Y 9748 T_54
78 1670 Q8AY42.2 157.20 17 17 4.697E8 3 2 10 Y 8919 RecName: Full=Kunitz-type serine protease inhibitor B; AltName: Full=Kunitz inhibitor B; Flags: Precursor
78 1671 Q8AY43.2 157.20 17 17 4.697E8 3 2 10 Y 9077 RecName: Full=Kunitz-type serine protease inhibitor A; AltName: Full=Kunitz inhibitor A; Flags: Precursor
78 1672 AAL30069.1 157.20 16 16 4.697E8 3 2 10 Y 9391 Kunitz inhibitor b, partial [Bungarus candidus]
78 1673 AAL30068.1 157.20 16 16 4.697E8 3 2 10 Y 9606 Kunitz inhibitor a, partial [Bungarus candidus]
109 426 XP_026544110.1 150.69 13 13 6.3406E6 3 1 3 Y 50196 hepatocyte growth factor activator [Notechis scutatus]
102 945 P41331.1 142.59 27 27 6.0532E5 3 1 4 N 15437 RecName: Full=Hemoglobin subunit alpha; AltName: Full=Alpha-globin; AltName: Full=Hemoglobin alpha chain
96 213 ETE59912.1 139.66 7 7 1.9025E6 3 3 3 N 67365 78 kDa glucose-regulated protein [Ophiophagus hannah]
96 200 XP_034262421.1 139.66 6 6 1.9025E6 3 3 3 N 68299 endoplasmic reticulum chaperone BiP, partial [Pantherophis guttatus]
96 201 JAG67806.1 139.66 6 6 1.9025E6 3 3 3 N 71941 78 kDa glucose-regulated protein [Boiga irregularis]
96 214 XP_025022112.1 139.66 6 6 1.9025E6 3 3 3 N 71864 endoplasmic reticulum chaperone BiP [Python bivittatus]
96 215 JAB54174.1 139.66 6 6 1.9025E6 3 3 3 N 72106 glucose-regulated protein [Micrurus fulvius]
96 216 XP_026568326.1 139.66 6 6 1.9025E6 3 3 3 N 72187 endoplasmic reticulum chaperone BiP [Pseudonaja textilis]
96 217 XP_026542482.1 139.66 6 6 1.9025E6 3 3 3 N 72286 endoplasmic reticulum chaperone BiP [Notechis scutatus]
96 204 JAV50419.1 139.66 6 6 1.9025E6 3 3 3 N 72067 78 kDa glucose-regulated protein [Agkistrodon contortrix contortrix]
96 205 JAG44540.1 139.66 6 6 1.9025E6 3 3 3 N 72105 78 kDa glucose-regulated protein precursor [Crotalus horridus]
96 206 JAI13107.1 139.66 6 6 1.9025E6 3 3 3 N 72105 78 kDa glucose-regulated protein [Crotalus adamanteus]
96 207 XP_015681610.1 139.66 6 6 1.9025E6 3 3 3 N 72155 endoplasmic reticulum chaperone BiP [Protobothrops mucrosquamatus]
96 208 AFJ50327.1 139.66 6 6 1.9025E6 3 3 3 N 72105 Heat shock protein 5 [Crotalus adamanteus]
96 209 JAG46692.1 139.66 6 6 1.9025E6 3 3 3 N 72105 78 kDa glucose-regulated protein [Crotalus horridus]
96 210 JAA96909.1 139.66 6 6 1.9025E6 3 3 3 N 72105 78 kDa glucose-regulated protein [Crotalus horridus]
96 211 AFJ50239.1 139.66 6 6 1.9025E6 3 3 3 N 75480 78 kDa glucose-regulated protein precursor [Crotalus adamanteus]
98 342 ABH05181.1 128.06 10 10 1.5378E6 1 1 1 N 18269 C-type lectin 2 [Bungarus multicinctus]
98 343 A1XXJ9.1 128.06 10 10 1.5378E6 1 1 1 N 18269 RecName: Full=C-type lectin BML-2; Short=CTL; Flags: Precursor
112 800 ABU68503.1 125.75 16 16 8.6156E5 3 1 3 Y 16620 PLA2(IB)-Tri1 [Trimorphodon biscutatus]
122 427 T_84 118.47 15 15 1.6227E6 2 2 2 N 24381 T_84
111 1724 CAM11302.1 117.13 17 17 4.2251E7 2 2 2 Y 8306 alpha-delta-bungarotoxin-4, partial [Bungarus caeruleus]
111 1725 D2N116.1 117.13 17 17 4.2251E7 2 2 2 Y 8306 RecName: Full=Alpha-delta-bungarotoxin-4; Short=Alpha-delta-Bgt-4; Flags: Precursor
121 1677 ACY68722.1 108.97 8 8 9.8406E5 1 1 1 Y 20018 CRISP isoform 1 [Parasuta nigriceps]
99 417 AAB25729.1 104.44 3 3 7.1214E6 1 1 1 N 27514 nerve growth factor precursor [Bungarus multicinctus]
99 418 P34128.1 104.44 3 3 7.1214E6 1 1 1 N 27514 RecName: Full=Venom nerve growth factor; Short=v-NGF; Short=vNGF; Flags: Precursor
114 974 B4ESA3.1 104.39 23 23 6.4804E7 2 1 4 Y 9158 RecName: Full=Kunitz-type serine protease inhibitor PILP-2; AltName: Full=Protease inhibitor-like protein 2; Flags: Precursor
114 975 Q8AY41.2 104.39 23 23 6.4804E7 2 1 4 Y 9130 RecName: Full=Kunitz-type serine protease inhibitor C; AltName: Full=Kunitz inhibitor C; Flags: Precursor
114 976 CAP74382.1 104.39 23 23 6.4804E7 2 1 4 Y 9158 protease inhibitor-like protein 2 precursor [Bungarus multicinctus]
114 977 AAL30070.1 104.39 22 22 6.4804E7 2 1 4 Y 9659 Kunitz inhibitor c, partial [Bungarus candidus]
46 1409 JAA74768.1 97.53 9 9 9.3226E6 1 1 1 Y 11631 3FTx-Ech-35 [Echiopsis curta]
46 1410 JAA74767.1 97.53 9 9 9.3226E6 1 1 1 Y 11631 3FTx-Ech-37 [Echiopsis curta]
46 1772 P01387.1 97.53 14 14 9.3226E6 1 1 1 Y 8106 RecName: Full=Long neurotoxin 1; AltName: Full=Neurotoxin A
46 1774 Q53B58.1 97.53 11 11 9.3226E6 1 1 1 Y 10210 RecName: Full=Long neurotoxin OH-55; AltName: Full=CM-11; Flags: Precursor
46 1775 AAT97250.1 97.53 11 11 9.3226E6 1 1 1 Y 10210 long chain neurotoxin precursor [Ophiophagus hannah]
83 1000 BAC77656.1 96.75 14 14 1.0036E8 1 1 4 Y 15875 phospholipase A2II precursor [Bungarus flaviceps]
83 1001 ADF50035.1 96.75 14 14 1.0036E8 1 1 4 Y 15845 phospholipase a2 isoform 1 [Bungarus flaviceps]
83 1002 Q7T2Q4.1 96.75 14 14 1.0036E8 1 1 4 Y 15875 RecName: Full=Acidic phospholipase A2 2; Short=svPLA2; AltName: Full=PA2-II; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
113 679 ACY68711.1 87.44 12 12 2.4189E6 1 1 1 Y 15455 phospholipase A2 isoform 2 [Parasuta nigriceps]
164 1142 JAC94986.1 82.18 14 14 2.3001E6 1 1 1 Y 16723 Epididymal secretory protein type E1 [Opheodrys aestivus]
133 918 JAA97769.1 81.97 5 5 6.5848E5 1 1 1 N 38523 Annexin A2-like protein [Crotalus horridus]
133 1051 JAI10286.1 81.97 5 5 6.5848E5 1 1 1 N 38532 Annexin A2-like protein [Micrurus fulvius]
133 919 JAG47471.1 81.97 5 5 6.5848E5 1 1 1 N 38523 Annexin A2-like protein [Crotalus horridus]
133 1052 JAB54690.1 81.97 5 5 6.5848E5 1 1 1 N 38562 annexin A2 [Micrurus fulvius]
133 920 JAG45828.1 81.97 5 5 6.5848E5 1 1 1 N 38523 Annexin A2-like protein [Crotalus horridus]
133 921 JAV51253.1 81.97 5 5 6.5848E5 1 1 1 N 38542 Annexin A2-like protein [Agkistrodon contortrix contortrix]
133 922 XP_007439873.1 81.97 5 5 6.5848E5 1 1 1 N 38569 annexin A2 [Python bivittatus]
133 923 LAB40267.1 81.97 5 5 6.5848E5 1 1 1 N 39471 hypothetical protein, partial [Micrurus spixii]
133 1676 ETE59687.1 81.97 7 7 6.5848E5 1 1 1 N 27908 Annexin A2 [Ophiophagus hannah]
125 616 ETE61271.1 80.26 3 3 1.2447E7 1 1 2 N 54055 Proactivator polypeptide [Ophiophagus hannah]
125 620 AFJ51008.1 80.26 3 3 1.2447E7 1 1 2 N 58013 Proactivator polypeptide-like [Crotalus adamanteus]
125 628 XP_032088229.1 80.26 3 3 1.2447E7 1 1 2 N 58050 prosaposin-like isoform X2 [Thamnophis elegans]
125 624 XP_013923763.1 80.26 3 3 1.2447E7 1 1 2 N 58050 PREDICTED: prosaposin isoform X2 [Thamnophis sirtalis]
125 625 XP_013923762.1 80.26 2 2 1.2447E7 1 1 2 N 58435 PREDICTED: prosaposin isoform X1 [Thamnophis sirtalis]
125 632 XP_032088228.1 80.26 2 2 1.2447E7 1 1 2 N 58435 prosaposin-like isoform X1 [Thamnophis elegans]
125 629 XP_015669101.1 80.26 3 3 1.2447E7 1 1 2 N 57981 prosaposin [Protobothrops mucrosquamatus]
125 630 BAN82088.1 80.26 2 2 1.2447E7 1 1 2 N 58564 hypothetical protein [Protobothrops flavoviridis]
125 631 XP_034291658.1 80.26 2 2 1.2447E7 1 1 2 N 58438 prosaposin-like isoform X4 [Pantherophis guttatus]
125 633 XP_034291656.1 80.26 2 2 1.2447E7 1 1 2 N 58696 prosaposin-like isoform X2 [Pantherophis guttatus]
125 634 XP_034291657.1 80.26 2 2 1.2447E7 1 1 2 N 58695 prosaposin-like isoform X3 [Pantherophis guttatus]
125 635 XP_034291655.1 80.26 2 2 1.2447E7 1 1 2 N 58824 prosaposin-like isoform X1 [Pantherophis guttatus]
125 626 XP_026569354.1 80.26 3 3 1.2447E7 1 1 2 N 58289 prosaposin isoform X2 [Pseudonaja textilis]
125 627 XP_026569353.1 80.26 2 2 1.2447E7 1 1 2 N 58674 prosaposin isoform X1 [Pseudonaja textilis]
125 621 XP_026528620.1 80.26 3 3 1.2447E7 1 1 2 N 58373 prosaposin-like isoform X2 [Notechis scutatus]
125 622 XP_026528619.1 80.26 2 2 1.2447E7 1 1 2 N 58759 prosaposin-like isoform X1 [Notechis scutatus]
125 1050 XP_007441356.1 80.26 3 3 1.2447E7 1 1 2 N 42934 prosaposin-like [Python bivittatus]
116 1016 1MR6 77.20 25 25 1.6747E6 1 1 1 Y 7535 Chain A, neurotoxin
116 1017 CAA06885.1 77.20 19 19 1.6747E6 1 1 1 Y 9826 neurotoxin-like protein [Bungarus multicinctus multicinctus]
116 1018 Q9YGJ0.1 77.20 19 19 1.6747E6 1 1 1 Y 9826 RecName: Full=Gamma-bungarotoxin; AltName: Full=Long neurotoxin homolog NTL2I; Flags: Precursor
116 1019 AAD41806.1 77.20 19 19 1.6747E6 1 1 1 Y 9826 neurotoxin precursor [Bungarus multicinctus]
116 1020 CAA72941.1 77.20 19 19 1.6747E6 1 1 1 Y 9756 neurotoxin [Bungarus multicinctus]
116 1021 CAD01082.1 77.20 19 19 1.6747E6 1 1 1 Y 9826 gamma-bungarotoxin [Bungarus multicinctus]
116 1022 O12963.1 77.20 19 19 1.6747E6 1 1 1 Y 9756 RecName: Full=Long neurotoxin homolog TA-bm16; AltName: Full=Delta-protein; Flags: Precursor
131 730 LAB19298.1 74.21 4 4 1.0705E6 1 1 1 N 52913 hypothetical protein, partial [Micrurus spixii]
131 731 LAB19293.1 74.21 4 4 1.0705E6 1 1 1 N 52927 hypothetical protein, partial [Micrurus spixii]
131 732 LAB19285.1 74.21 3 3 1.0705E6 1 1 1 N 54068 hypothetical protein, partial [Micrurus spixii]
131 733 LAB19295.1 74.21 3 3 1.0705E6 1 1 1 N 54082 hypothetical protein, partial [Micrurus spixii]
131 729 LAB19282.1 74.21 3 3 1.0705E6 1 1 1 N 58575 hypothetical protein, partial [Micrurus spixii]
131 734 LAB19291.1 74.21 3 3 1.0705E6 1 1 1 N 60939 hypothetical protein, partial [Micrurus spixii]
131 735 LAB19280.1 74.21 3 3 1.0705E6 1 1 1 N 61644 hypothetical protein, partial [Micrurus spixii]
156 1370 XP_026576367.1 64.67 10 10 2.2177E5 1 1 1 N 13998 histone H2B 1/2/3/4/6-like [Pseudonaja textilis]
156 1736 XP_026577747.1 64.67 16 16 2.2177E5 1 1 1 N 9164 histone H2B 8-like [Pseudonaja textilis]
156 1737 XP_015675791.1 64.67 17 17 2.2177E5 1 1 1 N 8685 histone H2B-like [Protobothrops mucrosquamatus]
156 1738 XP_015672174.1 64.67 10 10 2.2177E5 1 1 1 N 13996 histone H2B 8-like [Protobothrops mucrosquamatus]
156 1739 XP_026539722.1 64.67 10 10 2.2177E5 1 1 1 N 13952 histone H2B 1/2/3/4/6 [Notechis scutatus]
156 1740 LAA79020.1 64.67 10 10 2.2177E5 1 1 1 N 13980 hypothetical protein [Micrurus lemniscatus lemniscatus]
156 1741 XP_026569519.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Pseudonaja textilis]
156 1742 XP_026576364.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 1/2/3/4/6-like [Pseudonaja textilis]
156 1743 XP_015678744.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Protobothrops mucrosquamatus]
156 1744 XP_026545427.1 64.67 10 10 2.2177E5 1 1 1 N 14050 histone H2B 8-like [Notechis scutatus]
156 1745 XP_026529646.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Notechis scutatus]
156 1746 XP_013925621.1 64.67 10 10 2.2177E5 1 1 1 N 14036 PREDICTED: histone H2B 5 [Thamnophis sirtalis]
156 1747 XP_026529644.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Notechis scutatus]
156 1748 XP_025022125.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Python bivittatus]
156 1749 XP_026576334.1 64.67 10 10 2.2177E5 1 1 1 N 14008 histone H2B 1/2/3/4/6-like [Pseudonaja textilis]
156 1750 XP_026576366.1 64.67 10 10 2.2177E5 1 1 1 N 13952 histone H2B 1/2/3/4/6 [Pseudonaja textilis]
156 1751 XP_015672062.1 64.67 10 10 2.2177E5 1 1 1 N 14036 histone H2B 8-like [Protobothrops mucrosquamatus]
156 1752 XP_026576365.1 64.67 10 10 2.2177E5 1 1 1 N 13994 histone H2B 1/2/3/4/6-like [Pseudonaja textilis]
156 1753 XP_026536969.1 64.67 10 10 2.2177E5 1 1 1 N 13944 histone H2B 8-like [Notechis scutatus]
156 1754 XP_007429385.1 64.67 10 10 2.2177E5 1 1 1 N 13994 histone H2B 1/2/3/4/6-like [Python bivittatus]
156 1755 XP_026545426.1 64.67 10 10 2.2177E5 1 1 1 N 14050 histone H2B 8-like [Notechis scutatus]
156 1756 XP_015681932.1 64.67 10 10 2.2177E5 1 1 1 N 14050 histone H2B 8-like [Protobothrops mucrosquamatus]
156 1757 XP_026547833.1 64.67 10 10 2.2177E5 1 1 1 N 14008 histone H2B 1/2/3/4/6-like [Notechis scutatus]
156 1758 XP_026539701.1 64.67 10 10 2.2177E5 1 1 1 N 14008 histone H2B 1/2/3/4/6-like [Notechis scutatus]
156 1759 XP_026580816.1 64.67 10 10 2.2177E5 1 1 1 N 14050 histone H2B 8-like [Pseudonaja textilis]
156 1760 XP_015681933.1 64.67 10 10 2.2177E5 1 1 1 N 14050 histone H2B 8-like [Protobothrops mucrosquamatus]
156 1761 XP_026548170.1 64.67 10 10 2.2177E5 1 1 1 N 13994 histone H2B 1/2/3/4/6-like [Notechis scutatus]
156 1762 XP_026569640.1 64.67 10 10 2.2177E5 1 1 1 N 13980 histone H2B 5 [Pseudonaja textilis]
156 1763 ETE56555.1 64.67 10 10 2.2177E5 1 1 1 N 14008 Histone H2B 1/2/3/4/6, partial [Ophiophagus hannah]
156 1764 XP_015678747.1 64.67 10 10 2.2177E5 1 1 1 N 13994 histone H2B 8 [Protobothrops mucrosquamatus]
137 1734 XP_007434930.1 62.11 3 3 3.3371E5 1 1 2 Y 38422 alpha-2-HS-glycoprotein [Python bivittatus]
145 641 XP_034281839.1 59.37 2 2 3.2482E5 1 1 1 N 53585 multiple inositol polyphosphate phosphatase 1 [Pantherophis guttatus]
145 845 XP_013925207.1 59.37 3 3 3.2482E5 1 1 1 N 39926 PREDICTED: multiple inositol polyphosphate phosphatase 1 [Thamnophis sirtalis]
145 801 XP_026542555.1 59.37 2 2 3.2482E5 1 1 1 N 53135 multiple inositol polyphosphate phosphatase 1 isoform X2 [Notechis scutatus]
145 803 XP_026575692.1 59.37 2 2 3.2482E5 1 1 1 N 53443 multiple inositol polyphosphate phosphatase 1 isoform X2 [Pseudonaja textilis]
145 802 XP_026542553.1 59.37 2 2 3.2482E5 1 1 1 N 53549 multiple inositol polyphosphate phosphatase 1 isoform X1 [Notechis scutatus]
145 770 XP_029139434.1 59.37 2 2 3.2482E5 1 1 1 N 53980 multiple inositol polyphosphate phosphatase 1 [Protobothrops mucrosquamatus]
145 804 XP_026575691.1 59.37 2 2 3.2482E5 1 1 1 N 53858 multiple inositol polyphosphate phosphatase 1 isoform X1 [Pseudonaja textilis]
145 1080 XP_032087784.1 59.37 2 2 3.2482E5 1 1 1 N 54267 multiple inositol polyphosphate phosphatase 1 [Thamnophis elegans]
145 1388 XP_015746961.1 59.37 3 3 3.2482E5 1 1 1 N 37973 multiple inositol polyphosphate phosphatase 1 [Python bivittatus]
152 1232 JAB52761.1 55.04 6 6 4.7538E5 1 1 1 Y 15817 phospholipase A2 8 [Micrurus fulvius]
152 1233 JAS04986.1 55.04 5 5 4.7538E5 1 1 1 Y 15923 Phospholipase A2 8b [Micrurus fulvius]
152 1234 JAS04987.1 55.04 5 5 4.7538E5 1 1 1 Y 15913 Phospholipase A2 8a [Micrurus fulvius]
152 1235 JAS04982.1 55.04 5 5 4.7538E5 1 1 1 Y 15924 Phospholipase A2 8f [Micrurus fulvius]
152 1236 JAS04985.1 55.04 5 5 4.7538E5 1 1 1 Y 15938 Phospholipase A2 8c [Micrurus fulvius]
152 1237 JAI08996.1 55.04 5 5 4.7538E5 1 1 1 Y 15938 Phospholipase A2 8c [Micrurus fulvius]
152 1238 JAI08997.1 55.04 5 5 4.7538E5 1 1 1 Y 15923 Phospholipase A2 8b [Micrurus fulvius]
152 1239 JAI08998.1 55.04 5 5 4.7538E5 1 1 1 Y 15913 Phospholipase A2 8a [Micrurus fulvius]
152 1240 JAI08993.1 55.04 5 5 4.7538E5 1 1 1 Y 15924 Phospholipase A2 8f [Micrurus fulvius]
152 1241 JAB52775.1 55.04 5 5 4.7538E5 1 1 1 Y 15923 phospholipase A2 3b [Micrurus fulvius]
152 1242 JAB52776.1 55.04 5 5 4.7538E5 1 1 1 Y 15913 phospholipase A2 3a [Micrurus fulvius]
152 1083 JAS05103.1 55.04 5 5 4.7538E5 1 1 1 Y 15807 Phospholipase A2 8i [Micrurus tener]
152 1335 JAS05108.1 55.04 5 5 4.7538E5 1 1 1 Y 15724 Phospholipase A2 8d [Micrurus tener]
152 1336 JAS05109.1 55.04 5 5 4.7538E5 1 1 1 Y 15865 Phospholipase A2 8c [Micrurus tener]
152 1807 JAS05107.1 55.04 5 5 4.7538E5 1 1 1 Y 15708 Phospholipase A2 8e [Micrurus tener]
152 1337 JAS05106.1 55.04 5 5 4.7538E5 1 1 1 Y 15767 Phospholipase A2 8f [Micrurus tener]
152 1338 JAS05111.1 55.04 5 5 4.7538E5 1 1 1 Y 15766 Phospholipase A2 8a [Micrurus tener]
152 1339 JAS05101.1 55.04 5 5 4.7538E5 1 1 1 Y 15739 Phospholipase A2 8k [Micrurus tener]
152 1340 JAS05102.1 55.04 5 5 4.7538E5 1 1 1 Y 15781 Phospholipase A2 8j [Micrurus tener]
152 1341 JAS05104.1 55.04 5 5 4.7538E5 1 1 1 Y 15781 Phospholipase A2 8h [Micrurus tener]
152 1342 JAS05105.1 55.04 5 5 4.7538E5 1 1 1 Y 15952 Phospholipase A2 8g [Micrurus tener]
152 1343 JAS05110.1 55.04 5 5 4.7538E5 1 1 1 Y 15766 Phospholipase A2 8b [Micrurus tener]
144 751 ACR78492.1 54.81 22 22 1.474E7 1 1 1 Y 9611 putative long chain neurotoxin 193R [Drysdalia coronoides]
144 752 ACR78484.1 54.81 22 22 1.474E7 1 1 1 Y 9611 putative long chain neurotoxin 20 [Drysdalia coronoides]
144 753 F8J2F2.1 54.81 22 22 1.474E7 1 1 1 Y 9611 RecName: Full=Long neurotoxin 20; Short=LNTX-20; AltName: Full=Long neurotoxin 193R; Flags: Precursor
144 754 ACR78483.1 54.81 22 22 1.474E7 1 1 1 Y 9664 putative long chain neurotoxin 291 [Drysdalia coronoides]
144 755 ACR78488.1 54.81 22 22 1.474E7 1 1 1 Y 9664 putative long chain neurotoxin 472 [Drysdalia coronoides]
144 758 JAA74738.1 54.81 20 20 1.474E7 1 1 1 Y 10113 3FTx-Den-9 [Denisonia devisi]
144 838 ACR78486.1 54.81 22 22 1.474E7 1 1 1 Y 9526 putative long chain neurotoxin 31 [Drysdalia coronoides]
144 839 F8J2E6.1 54.81 22 22 1.474E7 1 1 1 Y 9526 RecName: Full=Long neurotoxin 31; Short=LNTX-31; Flags: Precursor
144 840 ACR78491.1 54.81 22 22 1.474E7 1 1 1 Y 9500 putative long chain neurotoxin 178R [Drysdalia coronoides]
144 1129 JAA74652.1 54.81 22 22 1.474E7 1 1 1 Y 9635 3FTx-Aca-53 [Acanthophis wellsi]
144 1130 JAA74651.1 54.81 22 22 1.474E7 1 1 1 Y 9635 3FTx-Aca-54 [Acanthophis wellsi]
144 1128 JAA74655.1 54.81 22 22 1.474E7 1 1 1 Y 9574 3FTx-Aca-18 [Acanthophis wellsi]
144 1767 ABK63538.1 54.81 20 20 1.474E7 1 1 1 Y 10137 LNTX-1 precursor [Tropidechis carinatus]
144 1768 A8HDK4.1 54.81 20 20 1.474E7 1 1 1 Y 10137 RecName: Full=Long neurotoxin 1; Short=LNTX-1; Flags: Precursor
144 1769 ABX58163.1 54.81 22 22 1.474E7 1 1 1 Y 9588 putative long neurotoxin [Austrelaps labialis]
144 1506 ABX58162.1 54.81 22 22 1.474E7 1 1 1 Y 9567 putative long neurotoxin [Austrelaps labialis]
144 1507 ABX58156.1 54.81 22 22 1.474E7 1 1 1 Y 9594 putative long neurotoxin [Austrelaps labialis]
144 1508 ABX58159.1 54.81 22 22 1.474E7 1 1 1 Y 9567 putative long neurotoxin [Austrelaps labialis]
144 1509 ABX58160.1 54.81 22 22 1.474E7 1 1 1 Y 9650 putative long neurotoxin [Austrelaps labialis]
144 1510 ABX58161.1 54.81 22 22 1.474E7 1 1 1 Y 9622 putative long neurotoxin [Austrelaps labialis]
144 1511 ABX58158.1 54.81 22 22 1.474E7 1 1 1 Y 9566 putative long neurotoxin [Austrelaps labialis]
157 1059 P01397.2 54.53 17 17 2.0197E6 1 1 1 Y 7948 RecName: Full=Alpha-elapitoxin-Dpp2c; Short=Alpha-EPTX-Dpp2c; AltName: Full=Long neurotoxin 2; AltName: Full=Neurotoxin delta; AltName: Full=Toxin TN2
157 1058 P25667.1 54.53 17 17 2.0197E6 1 1 1 Y 7939 RecName: Full=Alpha-elapitoxin-Dpp2b; Short=Alpha-EPTX-Dpp2b; AltName: Full=Long neurotoxin 3; AltName: Full=Toxin VN2
total 246 proteins

T_169
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 224 247 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 165 180 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 321 346 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 357 372 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 253 273 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 301 316 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 299 316 PEAKS DB
M.SVPHANDIATESVVLQYTDWQDQDNR.E Y 97.78 3000.3850 26 -0.1 1001.1355 3 64.89 1 39962 BuCaMH03.raw 5.6416E6 1 1 390 415 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 206 223 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 257 273 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 181 205 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 48 73 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 208 223 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNR.E Y 85.54 3131.4253 27 1.1 1044.8169 3 69.31 1 43770 BuCaMH03.raw 8.1462E7 2 2 389 415 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 207 223 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 520 548 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 317 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 321 346 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 347 372 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 449 457 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 225 247 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 552 561 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 210 223 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 323 346 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 182 205 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNREK.N Y 71.07 3388.5630 29 0.2 848.1482 4 62.82 1 38255 BuCaMH03.raw 5.174E6 1 1 389 417 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 189 205 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 76 95 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
L.NATVDPPSADR.R Y 69.09 1141.5364 11 -0.3 571.7753 2 16.18 1 3477 BuCaMH03.raw 1.4697E6 1 1 564 574 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 347 356 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 254 273 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 50 73 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 224 252 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 49 73 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 166 180 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 303 316 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 209 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 381 388 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 359 372 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 329 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 321 339 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 76 87 PEAKS DB
L.LNATVDPPSADR.R Y 54.61 1254.6204 12 0.9 628.3180 2 26.78 1 9665 BuCaMH03.raw 7.2628E6 1 1 563 574 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 302 316 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 185 205 PEAKS DB
K.LLNATVDPPSADR.R Y 53.44 1367.7045 13 0.5 684.8599 2 37.10 1 17092 BuCaMH03.raw 7.186E6 1 1 562 574 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 206 218 PEAKS DB
total 54 peptides
T_163
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 264 287 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 205 220 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 361 386 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 397 412 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 293 313 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 341 356 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 339 356 PEAKS DB
M.SVPHANDIATESVVLQYTDWQDQDNR.E Y 97.78 3000.3850 26 -0.1 1001.1355 3 64.89 1 39962 BuCaMH03.raw 5.6416E6 1 1 430 455 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 246 263 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 297 313 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 460 484 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 221 245 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 88 113 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 248 263 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNR.E Y 85.54 3131.4253 27 1.1 1044.8169 3 69.31 1 43770 BuCaMH03.raw 8.1462E7 2 2 429 455 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 247 263 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 560 588 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 357 386 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 361 386 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 458 484 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 387 412 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 489 497 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 589 601 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 265 287 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 592 601 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 250 263 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 363 386 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 222 245 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNREK.N Y 71.07 3388.5630 29 0.2 848.1482 4 62.82 1 38255 BuCaMH03.raw 5.174E6 1 1 429 457 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 229 245 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 116 135 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 591 601 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
L.NATVDPPSADR.R Y 69.09 1141.5364 11 -0.3 571.7753 2 16.18 1 3477 BuCaMH03.raw 1.4697E6 1 1 604 614 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 590 601 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 387 396 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 294 313 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 90 113 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 264 292 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 89 113 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 206 220 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 343 356 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 249 263 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 264 287 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 421 428 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 399 412 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 369 386 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 361 379 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 116 127 PEAKS DB
L.LNATVDPPSADR.R Y 54.61 1254.6204 12 0.9 628.3180 2 26.78 1 9665 BuCaMH03.raw 7.2628E6 1 1 603 614 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 342 356 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 322 338 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 225 245 PEAKS DB
K.LLNATVDPPSADR.R Y 53.44 1367.7045 13 0.5 684.8599 2 37.10 1 17092 BuCaMH03.raw 7.186E6 1 1 602 614 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 246 258 PEAKS DB
total 54 peptides
T_161
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 320 343 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 261 276 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 417 442 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 453 468 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 349 369 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 397 412 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 395 412 PEAKS DB
M.SVPHANDIATESVVLQYTDWQDQDNR.E Y 97.78 3000.3850 26 -0.1 1001.1355 3 64.89 1 39962 BuCaMH03.raw 5.6416E6 1 1 486 511 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 302 319 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 353 369 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 516 540 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 277 301 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 144 169 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 304 319 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNR.E Y 85.54 3131.4253 27 1.1 1044.8169 3 69.31 1 43770 BuCaMH03.raw 8.1462E7 2 2 485 511 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 303 319 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 616 644 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 413 442 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 417 442 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 514 540 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 443 468 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 545 553 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 645 657 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 321 343 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 648 657 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 306 319 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 419 442 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 278 301 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNREK.N Y 71.07 3388.5630 29 0.2 848.1482 4 62.82 1 38255 BuCaMH03.raw 5.174E6 1 1 485 513 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 285 301 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 172 191 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 647 657 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
L.NATVDPPSADR.R Y 69.09 1141.5364 11 -0.3 571.7753 2 16.18 1 3477 BuCaMH03.raw 1.4697E6 1 1 660 670 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 646 657 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 443 452 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 350 369 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 146 169 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 320 348 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 145 169 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 262 276 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 399 412 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 305 319 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 320 343 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 477 484 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 455 468 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 425 442 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 417 435 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 172 183 PEAKS DB
L.LNATVDPPSADR.R Y 54.61 1254.6204 12 0.9 628.3180 2 26.78 1 9665 BuCaMH03.raw 7.2628E6 1 1 659 670 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 398 412 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 378 394 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 281 301 PEAKS DB
K.LLNATVDPPSADR.R Y 53.44 1367.7045 13 0.5 684.8599 2 37.10 1 17092 BuCaMH03.raw 7.186E6 1 1 658 670 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 302 314 PEAKS DB
total 54 peptides
T_167
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 342 365 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 283 298 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 439 464 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 475 490 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 371 391 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 419 434 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 417 434 PEAKS DB
M.SVPHANDIATESVVLQYTDWQDQDNR.E Y 97.78 3000.3850 26 -0.1 1001.1355 3 64.89 1 39962 BuCaMH03.raw 5.6416E6 1 1 508 533 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 324 341 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 375 391 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 538 562 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 299 323 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 166 191 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 326 341 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNR.E Y 85.54 3131.4253 27 1.1 1044.8169 3 69.31 1 43770 BuCaMH03.raw 8.1462E7 2 2 507 533 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 325 341 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 638 666 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 435 464 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 439 464 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 536 562 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 465 490 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 567 575 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 667 679 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 343 365 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 670 679 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 328 341 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 441 464 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 300 323 PEAKS DB
R.MSVPHANDIATESVVLQYTDWQDQDNREK.N Y 71.07 3388.5630 29 0.2 848.1482 4 62.82 1 38255 BuCaMH03.raw 5.174E6 1 1 507 535 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 307 323 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 194 213 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 669 679 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
L.NATVDPPSADR.R Y 69.09 1141.5364 11 -0.3 571.7753 2 16.18 1 3477 BuCaMH03.raw 1.4697E6 1 1 682 692 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 668 679 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 465 474 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 372 391 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 168 191 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 342 370 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 167 191 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 284 298 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 421 434 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 327 341 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 342 365 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 499 506 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 477 490 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 447 464 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 439 457 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 194 205 PEAKS DB
L.LNATVDPPSADR.R Y 54.61 1254.6204 12 0.9 628.3180 2 26.78 1 9665 BuCaMH03.raw 7.2628E6 1 1 681 692 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 420 434 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 400 416 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 303 323 PEAKS DB
K.LLNATVDPPSADR.R Y 53.44 1367.7045 13 0.5 684.8599 2 37.10 1 17092 BuCaMH03.raw 7.186E6 1 1 680 692 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 324 336 PEAKS DB
total 54 peptides
T_170
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 222 245 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 163 178 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 319 344 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 355 370 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 251 271 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 299 314 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 297 314 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 204 221 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 255 271 PEAKS DB
R.MSVPHANDIATEAVVLQYTDWQDQDNR.E Y 94.52 3115.4304 27 0.3 1039.4844 3 72.50 1 46334 BuCaMH03.raw 1.2758E8 2 2 387 413 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 418 442 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 179 203 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 46 71 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 206 221 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 205 221 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 518 546 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 315 344 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 319 344 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 416 442 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 345 370 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 447 455 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 547 559 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 223 245 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 550 559 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 208 221 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 321 344 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 180 203 PEAKS DB
H.ANDIATEAVVLQYTDWQDQDNR.E Y 72.06 2564.1780 22 1.6 855.7346 3 75.14 1 48499 BuCaMH03.raw 5.1842E5 1 1 392 413 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 187 203 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 74 93 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 549 559 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 548 559 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 345 354 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 252 271 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 48 71 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 222 250 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 47 71 PEAKS DB
M.SVPHANDIATEAVVLQYTDWQDQDNR.E Y 57.10 2984.3899 26 0.2 995.8041 3 68.45 1 42800 BuCaMH03.raw 9.6717E6 1 1 388 413 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 164 178 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 301 314 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 207 221 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 222 245 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 379 386 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 357 370 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 327 344 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 319 337 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 74 85 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 300 314 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 280 296 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 183 203 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 204 216 PEAKS DB
total 51 peptides
T_168
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 224 247 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 165 180 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 321 346 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 357 372 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 253 273 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 301 316 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 299 316 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 206 223 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 257 273 PEAKS DB
R.MSVPHANDIATEAVVLQYTDWQDQDNR.E Y 94.52 3115.4304 27 0.3 1039.4844 3 72.50 1 46334 BuCaMH03.raw 1.2758E8 2 2 389 415 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 181 205 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 48 73 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 208 223 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 207 223 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 520 548 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 317 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 321 346 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 347 372 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 449 457 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 225 247 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 552 561 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 210 223 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 323 346 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 182 205 PEAKS DB
H.ANDIATEAVVLQYTDWQDQDNR.E Y 72.06 2564.1780 22 1.6 855.7346 3 75.14 1 48499 BuCaMH03.raw 5.1842E5 1 1 394 415 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 189 205 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 76 95 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 347 356 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 254 273 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 50 73 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 224 252 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 49 73 PEAKS DB
M.SVPHANDIATEAVVLQYTDWQDQDNR.E Y 57.10 2984.3899 26 0.2 995.8041 3 68.45 1 42800 BuCaMH03.raw 9.6717E6 1 1 390 415 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 166 180 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 303 316 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 209 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 381 388 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 359 372 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 329 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 321 339 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 76 87 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 302 316 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 185 205 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 206 218 PEAKS DB
total 51 peptides
T_171
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 224 247 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 165 180 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 321 346 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 357 372 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 253 273 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 301 316 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 299 316 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 206 223 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 257 273 PEAKS DB
R.MSVPHANDIATEAVVLQYTDWQDQDNR.E Y 94.52 3115.4304 27 0.3 1039.4844 3 72.50 1 46334 BuCaMH03.raw 1.2758E8 2 2 389 415 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 420 444 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 181 205 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 48 73 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 208 223 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 207 223 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 520 548 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 317 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 321 346 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 418 444 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 347 372 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 449 457 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 225 247 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 552 561 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 210 223 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 323 346 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 182 205 PEAKS DB
H.ANDIATEAVVLQYTDWQDQDNR.E Y 72.06 2564.1780 22 1.6 855.7346 3 75.14 1 48499 BuCaMH03.raw 5.1842E5 1 1 394 415 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 189 205 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 76 95 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 551 561 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 550 561 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 347 356 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 254 273 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 50 73 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 224 252 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 49 73 PEAKS DB
M.SVPHANDIATEAVVLQYTDWQDQDNR.E Y 57.10 2984.3899 26 0.2 995.8041 3 68.45 1 42800 BuCaMH03.raw 9.6717E6 1 1 390 415 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 166 180 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 303 316 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 209 223 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 224 247 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 381 388 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 359 372 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 329 346 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 321 339 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 76 87 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 302 316 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 282 298 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 185 205 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 206 218 PEAKS DB
total 51 peptides
T_166
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.AVTIFGESAGAASVGMHLLSTQSR.T N 110.40 2389.2061 24 0.0 797.4093 3 70.91 1 45278 BuCaMH03.raw 2.6603E8 4 4 216 239 PEAKS DB
R.FLTYTQNVILVSLSYR.V N 110.00 1916.0408 16 0.4 959.0281 2 83.45 1 55322 BuCaMH03.raw 3.0247E7 3 3 157 172 PEAKS DB
R.FPFVPVIDGDFFPDTPEAMLSSGNFK.E N 109.19 2873.3621 26 0.6 1437.6892 2 98.27 1 67043 BuCaMH03.raw 4.4491E8 2 2 313 338 PEAKS DB
K.DEGSYFLIYGLPGFSK.D N 106.68 1791.8718 16 0.8 896.9439 2 93.19 1 62858 BuCaMH03.raw 2.4463E8 2 2 349 364 PEAKS DB
R.AILQSGGPNAPWATVTPAESR.R N 105.98 2122.0806 21 0.3 1062.0479 2 59.69 1 35420 BuCaMH03.raw 9.8415E7 2 2 245 265 PEAKS DB
K.NPQELIDEEWSVLPYK.S N 102.10 1958.9625 16 0.4 980.4890 2 78.54 1 51369 BuCaMH03.raw 6.749E7 2 2 293 308 PEAKS DB
R.SKNPQELIDEEWSVLPYK.S N 100.91 2174.0896 18 2.3 725.7054 3 68.47 1 43161 BuCaMH03.raw 1.243E8 2 2 291 308 PEAKS DB
R.LALQWIQNNIHPFGGNPR.A N 96.68 2074.0859 18 0.3 692.3694 3 67.05 1 41669 BuCaMH03.raw 1.057E7 2 2 198 215 PEAKS DB
Q.SGGPNAPWATVTPAESR.R N 95.90 1696.8169 17 -0.7 849.4152 2 46.64 1 24656 BuCaMH03.raw 4.0143E6 1 1 249 265 PEAKS DB
R.MSVPHANDIATEAVVLQYTDWQDQDNR.E Y 94.52 3115.4304 27 0.3 1039.4844 3 72.50 1 46334 BuCaMH03.raw 1.2758E8 2 2 381 407 PEAKS DB
R.EALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 93.85 2801.3330 25 -0.2 934.7847 3 78.96 1 51733 BuCaMH03.raw 2.9516E8 2 2 412 436 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.VGAFGFLGLPGSPEAPGNMGLLDQR.L N 92.98 2499.2581 25 1.1 834.0942 3 90.41 1 60987 BuCaMH03.raw 3.7724E8 2 2 173 197 PEAKS DB
R.GLSLPVLDGHVTAFLGIPFAEPPVGR.M N 86.95 2658.4534 26 1.3 887.1595 3 96.29 1 65362 BuCaMH03.raw 2.0859E9 4 4 40 65 PEAKS DB
A.LQWIQNNIHPFGGNPR.A N 86.76 1889.9648 16 0.8 945.9904 2 52.84 1 29897 BuCaMH03.raw 2.3373E7 2 2 200 215 PEAKS DB
L.ALQWIQNNIHPFGGNPR.A N 84.31 1961.0020 17 0.2 981.5084 2 56.08 1 32631 BuCaMH03.raw 7.657E7 2 2 199 215 PEAKS DB
K.SGAWPTYTASQPQYVQLNTQPLATQPSLR.A N 79.74 3202.6047 29 0.8 1068.5431 3 70.50 1 44551 BuCaMH03.raw 4.9159E7 1 1 512 540 PEAKS DB
K.SIFRFPFVPVIDGDFFPDTPEAMLSSGNFK.E N 79.19 3376.6477 30 -0.6 1126.5558 3 98.25 1 66983 BuCaMH03.raw 1.9571E6 1 1 309 338 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM(+15.99)LSSGNFK.E N 79.18 2889.3569 26 0.0 964.1262 3 98.20 1 66887 BuCaMH03.raw 1.6186E7 1 1 313 338 Oxidation (M) M19:Oxidation (M):1000.00 PEAKS DB
K.NREALDDIVGDHNVIC(+57.02)PVVQFANDYAK.R N 77.79 3071.4771 27 0.4 768.8768 4 70.23 1 44298 BuCaMH03.raw 9.8218E6 2 2 410 436 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVKDEGSYFLIYGLPGFSK.D N 77.49 2858.5105 26 0.5 953.8446 3 94.22 1 63592 BuCaMH03.raw 1.1881E7 1 1 339 364 PEAKS DB
K.VYAYLFDHR.A N 76.38 1182.5822 9 0.3 592.2985 2 41.43 1 20432 BuCaMH03.raw 2.3244E7 2 2 441 449 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 76.29 1630.8079 13 0.1 544.6099 3 67.38 1 41864 BuCaMH03.raw 6.214E6 1 1 541 553 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
A.VTIFGESAGAASVGMHLLSTQSR.T N 75.90 2318.1689 23 1.1 773.7311 3 69.24 1 43488 BuCaMH03.raw 1.4432E6 1 1 217 239 PEAKS DB
I.C(+57.02)AFWNHFLPK.L N 74.57 1318.6281 10 -0.5 660.3210 2 56.23 1 32768 BuCaMH03.raw 7.6723E6 1 1 544 553 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Q.WIQNNIHPFGGNPR.A N 73.92 1648.8223 14 0.4 825.4187 2 39.98 1 19293 BuCaMH03.raw 1.286E7 2 2 202 215 PEAKS DB
P.FVPVIDGDFFPDTPEAMLSSGNFK.E N 73.61 2629.2410 24 0.1 1315.6279 2 94.45 1 64055 BuCaMH03.raw 2.0905E7 1 1 315 338 PEAKS DB
V.GAFGFLGLPGSPEAPGNMGLLDQR.L N 72.34 2400.1895 24 0.4 1201.1025 2 88.38 1 58926 BuCaMH03.raw 3.179E7 2 2 174 197 PEAKS DB
H.ANDIATEAVVLQYTDWQDQDNR.E Y 72.06 2564.1780 22 1.6 855.7346 3 75.14 1 48499 BuCaMH03.raw 5.1842E5 1 1 386 407 PEAKS DB
G.LPGSPEAPGNMGLLDQR.L N 70.60 1750.8672 17 0.7 876.4415 2 54.97 1 31655 BuCaMH03.raw 4.4619E6 1 1 181 197 PEAKS DB
R.FLRPEPVKPWPHVLDATSYK.P N 69.65 2379.2739 20 0.8 595.8262 4 48.92 1 26568 BuCaMH03.raw 6.2045E6 1 1 68 87 PEAKS DB
Q.IC(+57.02)AFWNHFLPK.L N 69.60 1431.7122 11 0.3 478.2448 3 63.50 1 38737 BuCaMH03.raw 2.159E6 1 1 543 553 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.QIC(+57.02)AFWNHFLPK.L N 68.21 1559.7708 12 0.3 520.9310 3 65.09 1 40072 BuCaMH03.raw 1.1741E7 2 2 542 553 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.ETQVLLGVVK.D N 66.91 1084.6492 10 -0.4 543.3317 2 48.73 1 26723 BuCaMH03.raw 1.4354E8 1 1 339 348 PEAKS DB
A.ILQSGGPNAPWATVTPAESR.R N 64.65 2051.0435 20 0.5 1026.5295 2 55.18 1 31833 BuCaMH03.raw 2.893E6 1 1 246 265 PEAKS DB
L.SLPVLDGHVTAFLGIPFAEPPVGR.M N 64.20 2488.3477 24 1.4 830.4576 3 89.15 1 59573 BuCaMH03.raw 2.1629E7 1 1 42 65 PEAKS DB
R.AVTIFGESAGAASVGMHLLSTQSRTLFQR.A N 62.77 3034.5657 29 0.9 759.6494 4 77.95 1 50683 BuCaMH03.raw 8.7118E5 1 1 216 244 PEAKS DB
G.LSLPVLDGHVTAFLGIPFAEPPVGR.M N 61.54 2601.4319 25 0.0 868.1512 3 94.83 1 64548 BuCaMH03.raw 9.5169E6 2 2 41 65 PEAKS DB
M.SVPHANDIATEAVVLQYTDWQDQDNR.E Y 57.10 2984.3899 26 0.2 995.8041 3 68.45 1 42800 BuCaMH03.raw 9.6717E6 1 1 382 407 PEAKS DB
F.LTYTQNVILVSLSYR.V N 56.26 1768.9723 15 0.1 885.4935 2 75.21 1 48520 BuCaMH03.raw 1.4443E6 1 1 158 172 PEAKS DB
P.QELIDEEWSVLPYK.S N 56.12 1747.8668 14 0.9 874.9415 2 73.88 1 47373 BuCaMH03.raw 3.1518E6 1 1 295 308 PEAKS DB
L.QWIQNNIHPFGGNPR.A N 55.84 1776.8809 15 -0.4 593.3007 3 43.44 1 22097 BuCaMH03.raw 2.5227E7 1 1 201 215 PEAKS DB
R.AVTIFGESAGAASVGM(+15.99)HLLSTQSR.T N 55.79 2405.2009 24 0.0 802.7409 3 70.98 1 44980 BuCaMH03.raw 5.9259E6 1 1 216 239 Oxidation (M) M16:Oxidation (M):1000.00 PEAKS DB
R.ADFLEGVR.M N 55.33 905.4606 8 0.5 453.7378 2 47.32 1 25289 BuCaMH03.raw 6.9015E7 2 2 373 380 PEAKS DB
E.GSYFLIYGLPGFSK.D N 55.01 1547.8024 14 0.7 774.9090 2 85.55 1 56608 BuCaMH03.raw 1.0538E6 1 1 351 364 PEAKS DB
D.GDFFPDTPEAMLSSGNFK.E N 54.97 1958.8719 18 0.7 980.4440 2 77.20 1 50118 BuCaMH03.raw 9.7457E5 1 1 321 338 PEAKS DB
R.FPFVPVIDGDFFPDTPEAM.L N 54.90 2139.9863 19 0.5 1071.0010 2 98.34 1 67085 BuCaMH03.raw 5.9713E6 1 1 313 331 PEAKS DB
R.FLRPEPVKPWPH.V N 54.64 1501.8193 12 0.7 501.6141 3 36.30 1 16415 BuCaMH03.raw 7.868E6 1 1 68 79 PEAKS DB
N.PQELIDEEWSVLPYK.S N 54.23 1844.9196 15 1.3 923.4683 2 74.37 1 47795 BuCaMH03.raw 4.9513E5 1 1 294 308 PEAKS DB
K.QLGC(+57.02)HFNNDSELVSC(+57.02)LR.S N 54.19 2047.9204 17 0.2 683.6476 3 45.75 1 23845 BuCaMH03.raw 8.5586E6 1 1 274 290 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.GFLGLPGSPEAPGNMGLLDQR.L N 54.11 2125.0625 21 0.3 1063.5388 2 79.70 1 52045 BuCaMH03.raw 1.5382E6 1 1 177 197 PEAKS DB
R.LALQWIQNNIHPF.G N 53.30 1592.8463 13 0.4 797.4308 2 79.77 1 52223 BuCaMH03.raw 3.4534E5 1 1 198 210 PEAKS DB
total 51 peptides
T_48
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 121.75 2406.9482 22 -0.5 1204.4808 2 38.36 1 18143 BuCaMH03.raw 4.9343E8 3 3 178 199 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.FSC(+57.02)GENLFMSSQPYAWSK.V N 111.14 2137.9238 18 0.0 1069.9692 2 69.16 1 43364 BuCaMH03.raw 4.5041E8 3 3 88 105 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.NFVYGVGANPPDSVIGHYTQIVWYK.S Y 106.01 2823.4021 25 0.4 942.1417 3 76.37 1 49615 BuCaMH03.raw 2.5384E9 3 3 116 140 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 104.88 1848.8247 16 0.4 925.4200 2 52.32 1 29479 BuCaMH03.raw 2.3872E9 6 6 52 67 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 97.35 1864.8196 16 -0.5 933.4166 2 41.32 1 20903 BuCaMH03.raw 2.4898E8 4 4 52 67 Oxidation (M) M5:Oxidation (M):91.37 PEAKS DB
K.NFVYGVGANPPDSVIGHYTQIVWYKSQLLGC(+57.02)AVTR.C Y 94.72 3908.9670 35 2.7 978.2516 4 82.15 1 54324 BuCaMH03.raw 3.4868E8 2 2 116 150 Carbamidomethylation C31:Carbamidomethylation:1000.00 PEAKS DB
F.SC(+57.02)GENLFMSSQPYAWSK.V N 93.20 1990.8553 17 -0.1 996.4349 2 63.34 1 38585 BuCaMH03.raw 2.72E8 1 1 89 105 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 90.98 1864.8196 16 3.6 933.4204 2 40.80 1 20445 BuCaMH03.raw 2.3955E8 4 4 52 67 Oxidation (M) M2:Oxidation (M):92.25 PEAKS DB
K.FSC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 90.78 2153.9187 18 -3.0 1077.9634 2 69.20 1 43521 BuCaMH03.raw 1.7168E7 5 5 88 105 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
K.YIYVC(+57.02)QYC(+57.02)PAGNIR.G N 90.66 1775.8124 14 4.0 888.9171 2 52.86 1 30346 BuCaMH03.raw 1.8742E9 6 6 156 169 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.FVYGVGANPPDSVIGHYTQIVWYK.S Y 86.70 2709.3591 24 0.4 904.1273 3 75.27 1 48539 BuCaMH03.raw 6.0887E6 1 1 117 140 PEAKS DB
K.SQLLGC(+57.02)AVTRC(+57.02)SSSKYIYVC(+57.02)QYC(+57.02)PAGNIR.G Y 83.02 3410.5991 29 -1.8 1137.8716 3 50.08 1 27603 BuCaMH03.raw 2.3175E7 2 2 141 169 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)TFAHSPPHLR.T N 82.82 1321.6350 11 0.4 661.8251 2 17.45 1 4128 BuCaMH03.raw 5.1391E8 3 3 73 83 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.VIQSWYDENKNFVYGVGANPPDSVIGHYTQIVWYK.S Y 80.33 4085.9951 35 0.6 818.2068 5 78.35 1 51012 BuCaMH03.raw 3.1771E7 3 3 106 140 PEAKS DB
M.EWNSNAAQNAK.R N 80.28 1231.5581 11 -0.7 616.7859 2 12.85 1 2052 BuCaMH03.raw 6.4438E5 1 1 57 67 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 79.43 1734.7817 15 0.8 868.3989 2 46.49 1 24445 BuCaMH03.raw 5.4821E7 1 1 53 67 PEAKS DB
F.SC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 78.92 2006.8502 17 -1.7 1004.4307 2 63.36 1 38717 BuCaMH03.raw 0 0 0 89 105 Carbamidomethylation; Oxidation (M) C2:Carbamidomethylation:1000.00;M8:Oxidation (M):1000.00 PEAKS DB
C.TFAHSPPHLR.T N 78.16 1161.6042 10 0.4 388.2088 3 12.74 1 1951 BuCaMH03.raw 1.9167E8 3 3 74 83 PEAKS DB
K.VIQSWYDENK.N N 77.34 1280.6036 10 0.6 641.3095 2 37.09 1 17259 BuCaMH03.raw 5.4482E8 1 1 106 115 PEAKS DB
D.SVIGHYTQIVWYK.S N 76.45 1592.8351 13 1.1 531.9529 3 53.77 1 30679 BuCaMH03.raw 1.5322E6 1 1 128 140 PEAKS DB
K.NFVYGVGANPPDSVIGH.Y Y 75.23 1741.8423 17 1.3 871.9296 2 59.44 1 35413 BuCaMH03.raw 3.7341E6 1 1 116 132 PEAKS DB
K.VIQSWYDENKNFVYGVGANPPDSVIGHYTQIVWYKSQLLGC(+57.02)AVTR.C Y 74.74 5171.5601 45 -0.2 1035.3191 5 83.12 1 54986 BuCaMH03.raw 9.9727E7 1 1 106 150 Carbamidomethylation C41:Carbamidomethylation:1000.00 PEAKS DB
Y.IYVC(+57.02)QYC(+57.02)PAGNIR.G N 69.26 1612.7490 13 0.7 807.3823 2 42.95 1 22016 BuCaMH03.raw 1.4932E8 1 1 157 169 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
P.DSVIGHYTQIVWYK.S Y 68.88 1707.8621 14 1.3 570.2953 3 63.67 1 38955 BuCaMH03.raw 7.1495E5 1 1 127 140 PEAKS DB
C.GENLFMSSQPYAWSK.V N 67.08 1743.7926 15 -0.7 872.9030 2 62.86 1 38254 BuCaMH03.raw 6.1843E6 1 1 91 105 PEAKS DB
K.YNDDYTNC(+57.02)K.S N 66.61 1191.4502 9 0.0 596.7324 2 13.11 1 2718 BuCaMH03.raw 1.4739E8 2 2 200 208 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.SQLLGC(+57.02)AVTR.C Y 66.59 1103.5757 10 0.0 552.7951 2 33.38 1 14240 BuCaMH03.raw 7.8985E8 2 2 141 150 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
Y.KSGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 66.32 2535.0432 23 0.9 846.0225 3 30.53 1 12230 BuCaMH03.raw 3.4129E5 1 1 177 199 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)AASC(+57.02)FC(+57.02)R.T N 63.47 1030.3783 8 -0.5 516.1962 2 15.60 1 3145 BuCaMH03.raw 2.3446E8 1 1 225 232 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.MLQM(+15.99)EWNSNAAQNAK.R N 62.98 1750.7767 15 1.1 876.3966 2 46.48 1 24489 BuCaMH03.raw 7.4598E5 1 1 53 67 Oxidation (M) M4:Oxidation (M):9.05 PEAKS DB
S.C(+57.02)GENLFMSSQPYAWSK.V N 62.04 1903.8232 16 0.6 952.9195 2 64.03 1 39173 BuCaMH03.raw 3.3027E7 1 1 90 105 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
A.DRC(+57.02)TFAHSPPHLR.T N 59.95 1592.7629 13 0.0 399.1980 4 17.37 1 4025 BuCaMH03.raw 1.6408E6 1 1 71 83 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.YVC(+57.02)QYC(+57.02)PAGNIR.G N 58.43 1499.6649 12 0.3 750.8400 2 32.81 1 13775 BuCaMH03.raw 1.3464E8 1 1 158 169 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
S.QLLGC(+57.02)AVTR.C Y 57.22 1016.5437 9 -0.2 509.2790 2 30.69 1 12644 BuCaMH03.raw 1.32E8 1 1 142 150 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)SSSKYIYVC(+57.02)QYC(+57.02)PAGNIR.G N 56.75 2325.0339 19 -0.5 776.0182 3 41.99 1 20895 BuCaMH03.raw 1.169E6 1 1 151 169 Carbamidomethylation C1:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
E.NLFMSSQPYAWSK.V N 56.27 1557.7285 13 -0.7 779.8710 2 60.42 1 36234 BuCaMH03.raw 3.801E5 1 1 93 105 PEAKS DB
I.QSWYDENK.N N 54.93 1068.4512 8 -0.1 535.2328 2 24.52 1 8368 BuCaMH03.raw 2.7802E7 1 1 108 115 PEAKS DB
K.C(+57.02)AASC(+57.02)FC(+57.02)RTEII N 53.43 1486.6367 12 0.9 744.3263 2 46.59 1 24640 BuCaMH03.raw 2.8965E6 1 1 225 236 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.GSIATPYK.S N 53.13 835.4440 8 -0.5 418.7290 2 19.69 1 5275 BuCaMH03.raw 1.8197E8 1 1 170 177 PEAKS DB
R.NM(+15.99)LQM(+15.99)EWNSNAAQNAK.R N 53.13 1880.8146 16 1.2 941.4156 2 46.89 1 24806 BuCaMH03.raw 3.9953E5 1 1 52 67 Oxidation (M) M2:Oxidation (M):1000.00;M5:Oxidation (M):1000.00 PEAKS DB
total 40 peptides
T_44
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 121.75 2406.9482 22 -0.5 1204.4808 2 38.36 1 18143 BuCaMH03.raw 4.9343E8 3 3 220 241 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.FSC(+57.02)GENLFMSSQPYAWSK.V N 111.14 2137.9238 18 0.0 1069.9692 2 69.16 1 43364 BuCaMH03.raw 4.5041E8 3 3 130 147 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.NFVYGVGANPPDSVIGHYTQIVWYK.S Y 106.01 2823.4021 25 0.4 942.1417 3 76.37 1 49615 BuCaMH03.raw 2.5384E9 3 3 158 182 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 104.88 1848.8247 16 0.4 925.4200 2 52.32 1 29479 BuCaMH03.raw 2.3872E9 6 6 94 109 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 97.35 1864.8196 16 -0.5 933.4166 2 41.32 1 20903 BuCaMH03.raw 2.4898E8 4 4 94 109 Oxidation (M) M5:Oxidation (M):91.37 PEAKS DB
K.NFVYGVGANPPDSVIGHYTQIVWYKSQLLGC(+57.02)AVTR.C Y 94.72 3908.9670 35 2.7 978.2516 4 82.15 1 54324 BuCaMH03.raw 3.4868E8 2 2 158 192 Carbamidomethylation C31:Carbamidomethylation:1000.00 PEAKS DB
F.SC(+57.02)GENLFMSSQPYAWSK.V N 93.20 1990.8553 17 -0.1 996.4349 2 63.34 1 38585 BuCaMH03.raw 2.72E8 1 1 131 147 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 90.98 1864.8196 16 3.6 933.4204 2 40.80 1 20445 BuCaMH03.raw 2.3955E8 4 4 94 109 Oxidation (M) M2:Oxidation (M):92.25 PEAKS DB
K.FSC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 90.78 2153.9187 18 -3.0 1077.9634 2 69.20 1 43521 BuCaMH03.raw 1.7168E7 5 5 130 147 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
K.YIYVC(+57.02)QYC(+57.02)PAGNIR.G N 90.66 1775.8124 14 4.0 888.9171 2 52.86 1 30346 BuCaMH03.raw 1.8742E9 6 6 198 211 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.FVYGVGANPPDSVIGHYTQIVWYK.S Y 86.70 2709.3591 24 0.4 904.1273 3 75.27 1 48539 BuCaMH03.raw 6.0887E6 1 1 159 182 PEAKS DB
K.SQLLGC(+57.02)AVTRC(+57.02)SSSKYIYVC(+57.02)QYC(+57.02)PAGNIR.G Y 83.02 3410.5991 29 -1.8 1137.8716 3 50.08 1 27603 BuCaMH03.raw 2.3175E7 2 2 183 211 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)TFAHSPPHLR.T N 82.82 1321.6350 11 0.4 661.8251 2 17.45 1 4128 BuCaMH03.raw 5.1391E8 3 3 115 125 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.VIQSWYDENKNFVYGVGANPPDSVIGHYTQIVWYK.S Y 80.33 4085.9951 35 0.6 818.2068 5 78.35 1 51012 BuCaMH03.raw 3.1771E7 3 3 148 182 PEAKS DB
M.EWNSNAAQNAK.R N 80.28 1231.5581 11 -0.7 616.7859 2 12.85 1 2052 BuCaMH03.raw 6.4438E5 1 1 99 109 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 79.43 1734.7817 15 0.8 868.3989 2 46.49 1 24445 BuCaMH03.raw 5.4821E7 1 1 95 109 PEAKS DB
F.SC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 78.92 2006.8502 17 -1.7 1004.4307 2 63.36 1 38717 BuCaMH03.raw 0 0 0 131 147 Carbamidomethylation; Oxidation (M) C2:Carbamidomethylation:1000.00;M8:Oxidation (M):1000.00 PEAKS DB
C.TFAHSPPHLR.T N 78.16 1161.6042 10 0.4 388.2088 3 12.74 1 1951 BuCaMH03.raw 1.9167E8 3 3 116 125 PEAKS DB
K.VIQSWYDENK.N N 77.34 1280.6036 10 0.6 641.3095 2 37.09 1 17259 BuCaMH03.raw 5.4482E8 1 1 148 157 PEAKS DB
D.SVIGHYTQIVWYK.S N 76.45 1592.8351 13 1.1 531.9529 3 53.77 1 30679 BuCaMH03.raw 1.5322E6 1 1 170 182 PEAKS DB
K.NFVYGVGANPPDSVIGH.Y Y 75.23 1741.8423 17 1.3 871.9296 2 59.44 1 35413 BuCaMH03.raw 3.7341E6 1 1 158 174 PEAKS DB
K.VIQSWYDENKNFVYGVGANPPDSVIGHYTQIVWYKSQLLGC(+57.02)AVTR.C Y 74.74 5171.5601 45 -0.2 1035.3191 5 83.12 1 54986 BuCaMH03.raw 9.9727E7 1 1 148 192 Carbamidomethylation C41:Carbamidomethylation:1000.00 PEAKS DB
Y.IYVC(+57.02)QYC(+57.02)PAGNIR.G N 69.26 1612.7490 13 0.7 807.3823 2 42.95 1 22016 BuCaMH03.raw 1.4932E8 1 1 199 211 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
P.DSVIGHYTQIVWYK.S Y 68.88 1707.8621 14 1.3 570.2953 3 63.67 1 38955 BuCaMH03.raw 7.1495E5 1 1 169 182 PEAKS DB
C.GENLFMSSQPYAWSK.V N 67.08 1743.7926 15 -0.7 872.9030 2 62.86 1 38254 BuCaMH03.raw 6.1843E6 1 1 133 147 PEAKS DB
K.YNDDYTNC(+57.02)K.S N 66.61 1191.4502 9 0.0 596.7324 2 13.11 1 2718 BuCaMH03.raw 1.4739E8 2 2 242 250 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.SQLLGC(+57.02)AVTR.C Y 66.59 1103.5757 10 0.0 552.7951 2 33.38 1 14240 BuCaMH03.raw 7.8985E8 2 2 183 192 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
Y.KSGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 66.32 2535.0432 23 0.9 846.0225 3 30.53 1 12230 BuCaMH03.raw 3.4129E5 1 1 219 241 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)AASC(+57.02)FC(+57.02)R.T N 63.47 1030.3783 8 -0.5 516.1962 2 15.60 1 3145 BuCaMH03.raw 2.3446E8 1 1 267 274 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.MLQM(+15.99)EWNSNAAQNAK.R N 62.98 1750.7767 15 1.1 876.3966 2 46.48 1 24489 BuCaMH03.raw 7.4598E5 1 1 95 109 Oxidation (M) M4:Oxidation (M):9.05 PEAKS DB
S.C(+57.02)GENLFMSSQPYAWSK.V N 62.04 1903.8232 16 0.6 952.9195 2 64.03 1 39173 BuCaMH03.raw 3.3027E7 1 1 132 147 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
A.DRC(+57.02)TFAHSPPHLR.T N 59.95 1592.7629 13 0.0 399.1980 4 17.37 1 4025 BuCaMH03.raw 1.6408E6 1 1 113 125 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.YVC(+57.02)QYC(+57.02)PAGNIR.G N 58.43 1499.6649 12 0.3 750.8400 2 32.81 1 13775 BuCaMH03.raw 1.3464E8 1 1 200 211 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
S.QLLGC(+57.02)AVTR.C Y 57.22 1016.5437 9 -0.2 509.2790 2 30.69 1 12644 BuCaMH03.raw 1.32E8 1 1 184 192 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)SSSKYIYVC(+57.02)QYC(+57.02)PAGNIR.G N 56.75 2325.0339 19 -0.5 776.0182 3 41.99 1 20895 BuCaMH03.raw 1.169E6 1 1 193 211 Carbamidomethylation C1:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
E.NLFMSSQPYAWSK.V N 56.27 1557.7285 13 -0.7 779.8710 2 60.42 1 36234 BuCaMH03.raw 3.801E5 1 1 135 147 PEAKS DB
I.QSWYDENK.N N 54.93 1068.4512 8 -0.1 535.2328 2 24.52 1 8368 BuCaMH03.raw 2.7802E7 1 1 150 157 PEAKS DB
K.C(+57.02)AASC(+57.02)FC(+57.02)RTEII N 53.43 1486.6367 12 0.9 744.3263 2 46.59 1 24640 BuCaMH03.raw 2.8965E6 1 1 267 278 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.GSIATPYK.S N 53.13 835.4440 8 -0.5 418.7290 2 19.69 1 5275 BuCaMH03.raw 1.8197E8 1 1 212 219 PEAKS DB
R.NM(+15.99)LQM(+15.99)EWNSNAAQNAK.R N 53.13 1880.8146 16 1.2 941.4156 2 46.89 1 24806 BuCaMH03.raw 3.9953E5 1 1 94 109 Oxidation (M) M2:Oxidation (M):1000.00;M5:Oxidation (M):1000.00 PEAKS DB
total 40 peptides
T_42
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.RPTWHYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 122.66 3211.3223 27 -0.1 1071.4479 3 56.78 1 33454 BuCaMH03.raw 1.8052E9 9 9 51 77 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.VHDDC(+57.02)YGAVLK.R Y 100.01 1275.5918 11 -0.3 638.8030 2 24.91 1 8530 BuCaMH03.raw 5.296E8 3 3 81 91 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.TPYINANYNINPR.R Y 98.04 1548.7684 13 0.3 775.3917 2 44.77 1 23425 BuCaMH03.raw 1.339E9 3 3 137 149 PEAKS DB
H.YMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 96.67 2533.9824 22 1.3 1268.0001 2 63.10 1 38558 BuCaMH03.raw 2.7198E8 2 2 56 77 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NPYFTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 96.58 2541.9663 20 2.3 1271.9934 2 61.92 1 37752 BuCaMH03.raw 1.7996E9 3 3 94 113 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.RRPTWHYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 89.31 3367.4233 28 0.5 674.4923 5 52.46 1 29426 BuCaMH03.raw 1.5194E9 3 3 50 77 Carbamidomethylation C12:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
K.VHDDC(+57.02)YGAVLKR.K Y 86.68 1431.6929 12 0.6 478.2385 3 18.32 1 5355 BuCaMH03.raw 1.325E8 4 4 81 92 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.WHYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 86.29 2857.1206 24 0.2 953.3810 3 62.86 1 38208 BuCaMH03.raw 2.4087E7 1 1 54 77 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.KC(+57.02)NPYFTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 85.96 2670.0613 21 -0.7 891.0271 3 51.56 1 29044 BuCaMH03.raw 7.2782E7 2 2 93 113 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
P.TWHYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 84.02 2958.1685 25 -0.6 987.0628 3 63.50 1 39184 BuCaMH03.raw 3.0856E8 2 2 53 77 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.YGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 83.91 2124.8516 19 0.3 1063.4333 2 53.31 1 30243 BuCaMH03.raw 1.1347E7 1 1 59 77 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
L.NLIQFSYLIQC(+57.02)ANHR.R Y 83.84 1875.9414 15 -0.1 938.9779 2 66.59 1 41694 BuCaMH03.raw 2.8781E9 11 11 35 49 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
C.NPYFTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 83.40 2381.9358 19 -0.7 1191.9744 2 61.00 1 36962 BuCaMH03.raw 3.2482E8 2 2 95 113 Carbamidomethylation C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
M.DYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 83.36 2239.8787 20 0.4 1120.9470 2 59.09 1 35006 BuCaMH03.raw 1.049E7 1 1 58 77 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
R.PTWHYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 83.00 3055.2212 26 -1.0 1019.4133 3 63.84 1 39516 BuCaMH03.raw 1.0892E8 2 2 52 77 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
P.YINANYNINPR.R Y 81.77 1350.6680 11 0.6 676.3417 2 35.58 1 15920 BuCaMH03.raw 5.2139E8 1 1 139 149 PEAKS DB
V.HDDC(+57.02)YGAVLKR.K Y 81.74 1332.6244 11 -0.4 445.2152 3 17.97 1 4312 BuCaMH03.raw 3.012E7 2 2 82 92 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
P.YFTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 80.93 2170.8401 17 -2.5 1086.4246 2 56.36 1 32762 BuCaMH03.raw 1.3663E8 1 1 97 113 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.RPTWHYM(+15.99)DYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 80.32 3227.3171 27 0.1 1076.7798 3 52.72 1 29904 BuCaMH03.raw 6.0388E7 5 5 51 77 Oxidation (M); Carbamidomethylation M7:Oxidation (M):1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
N.LIQFSYLIQC(+57.02)ANHR.R Y 80.06 1761.8984 14 0.5 881.9570 2 62.52 1 37958 BuCaMH03.raw 2.3579E7 2 2 36 49 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
P.LNLIQFSYLIQC(+57.02)ANHR.R Y 79.98 1989.0254 16 1.7 664.0168 3 77.20 1 50404 BuCaMH03.raw 1.3534E8 2 2 34 49 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
R.AVC(+57.02)DC(+57.02)DVKAALC(+57.02)FAR.T Y 79.37 1754.7902 15 0.5 878.4028 2 46.95 1 24960 BuCaMH03.raw 2.3702E6 2 2 122 136 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.FTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 78.56 2007.7767 16 1.9 1004.8975 2 50.42 1 28170 BuCaMH03.raw 2.492E8 3 3 98 113 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.RRPTWHYM(+15.99)DYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 78.49 3383.4182 28 -1.3 846.8607 4 52.41 1 29985 BuCaMH03.raw 3.2508E7 3 3 50 77 Oxidation (M); Carbamidomethylation M8:Oxidation (M):1000.00;C12:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
V.HDDC(+57.02)YGAVLK.R Y 77.02 1176.5233 10 0.1 589.2690 2 22.89 1 7411 BuCaMH03.raw 2.7654E8 2 2 82 91 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
L.IQFSYLIQC(+57.02)ANHR.R Y 76.97 1648.8143 13 1.2 825.4154 2 53.58 1 30470 BuCaMH03.raw 1.7614E7 2 2 37 49 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.PYFTTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 73.27 2267.8928 18 -0.5 1134.9531 2 60.38 1 36085 BuCaMH03.raw 1.0805E7 1 1 96 113 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
Y.INANYNINPR.R Y 70.91 1187.6047 10 0.2 594.8098 2 28.98 1 11434 BuCaMH03.raw 1.004E8 1 1 140 149 PEAKS DB
Y.MDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 69.34 2370.9192 21 -0.6 1186.4662 2 60.14 1 35844 BuCaMH03.raw 1.2299E7 1 1 57 77 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
H.DDC(+57.02)YGAVLKR.K Y 68.46 1195.5656 10 0.3 598.7902 2 27.06 1 10045 BuCaMH03.raw 5.0135E6 1 1 83 92 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
F.TTYDYYC(+57.02)GADGPYC(+57.02)R.N Y 68.25 1860.7083 15 0.3 931.3617 2 41.22 1 20201 BuCaMH03.raw 4.1122E7 1 1 99 113 Carbamidomethylation C7:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.YYC(+57.02)GADGPYC(+57.02)R.N Y 67.84 1380.5227 11 0.8 691.2692 2 25.98 1 9110 BuCaMH03.raw 2.2258E7 1 1 103 113 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
H.YM(+15.99)DYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 67.64 2549.9773 22 -0.1 1275.9958 2 58.36 1 34419 BuCaMH03.raw 6.7922E6 2 2 56 77 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
W.HYMDYGC(+57.02)YC(+57.02)GYGGSGTPIDDLDR.C Y 66.91 2671.0413 23 0.5 891.3548 3 54.97 1 31590 BuCaMH03.raw 3.6351E7 1 1 55 77 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
L.NLIQFSYLIQC(+57.02)ANHRR.R Y 66.64 2032.0425 16 -0.3 509.0178 4 57.41 1 33555 BuCaMH03.raw 2.8392E7 1 1 35 50 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.TYDYYC(+57.02)GADGPYC(+57.02)R.N Y 65.81 1759.6606 14 -0.1 880.8375 2 40.08 1 19315 BuCaMH03.raw 3.1492E7 1 1 100 113 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
T.YDYYC(+57.02)GADGPYC(+57.02)R.N Y 65.39 1658.6129 13 -0.5 830.3134 2 39.00 1 18639 BuCaMH03.raw 2.0689E7 1 1 101 113 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.AALC(+57.02)FAR.T N 64.40 807.4061 7 0.3 404.7105 2 30.53 1 12209 BuCaMH03.raw 2.029E7 1 1 130 136 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
G.YGGSGTPIDDLDR.C Y 57.06 1364.6207 13 0.9 683.3182 2 41.20 1 20295 BuCaMH03.raw 1.215E6 1 1 65 77 PEAKS DB
H.DDC(+57.02)YGAVLK.R Y 56.12 1039.4645 9 0.7 520.7399 2 35.85 1 16119 BuCaMH03.raw 1.8094E7 1 1 83 91 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.NANYNINPR.R Y 54.99 1074.5206 9 0.7 538.2679 2 20.02 1 5503 BuCaMH03.raw 2.7619E7 1 1 141 149 PEAKS DB
total 41 peptides
ACE73578.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 121.75 2406.9482 22 -0.5 1204.4808 2 38.36 1 18143 BuCaMH03.raw 4.9343E8 3 3 180 201 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
I.FSC(+57.02)GENLFMSSQPYAWSK.V N 111.14 2137.9238 18 0.0 1069.9692 2 69.16 1 43364 BuCaMH03.raw 4.5041E8 3 3 90 107 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.IFSC(+57.02)GENLFMSSQPYAWSK.V Y 106.85 2251.0078 19 -0.1 1126.5111 2 75.24 1 48893 BuCaMH03.raw 3.6678E7 4 4 89 107 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 104.88 1848.8247 16 0.4 925.4200 2 52.32 1 29479 BuCaMH03.raw 2.3872E9 6 6 54 69 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 97.35 1864.8196 16 -0.5 933.4166 2 41.32 1 20903 BuCaMH03.raw 2.4898E8 4 4 54 69 Oxidation (M) M5:Oxidation (M):91.37 PEAKS DB
F.SC(+57.02)GENLFMSSQPYAWSK.V N 93.20 1990.8553 17 -0.1 996.4349 2 63.34 1 38585 BuCaMH03.raw 2.72E8 1 1 91 107 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 90.98 1864.8196 16 3.6 933.4204 2 40.80 1 20445 BuCaMH03.raw 2.3955E8 4 4 54 69 Oxidation (M) M2:Oxidation (M):92.25 PEAKS DB
I.FSC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 90.78 2153.9187 18 -3.0 1077.9634 2 69.20 1 43521 BuCaMH03.raw 1.7168E7 5 5 90 107 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
R.C(+57.02)TFAHSPPHLR.T N 82.82 1321.6350 11 0.4 661.8251 2 17.45 1 4128 BuCaMH03.raw 5.1391E8 3 3 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
M.EWNSNAAQNAK.R N 80.28 1231.5581 11 -0.7 616.7859 2 12.85 1 2052 BuCaMH03.raw 6.4438E5 1 1 59 69 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 79.43 1734.7817 15 0.8 868.3989 2 46.49 1 24445 BuCaMH03.raw 5.4821E7 1 1 55 69 PEAKS DB
F.SC(+57.02)GENLFM(+15.99)SSQPYAWSK.V N 78.92 2006.8502 17 -1.7 1004.4307 2 63.36 1 38717 BuCaMH03.raw 0 0 0 91 107 Carbamidomethylation; Oxidation (M) C2:Carbamidomethylation:1000.00;M8:Oxidation (M):1000.00 PEAKS DB
C.TFAHSPPHLR.T N 78.16 1161.6042 10 0.4 388.2088 3 12.74 1 1951 BuCaMH03.raw 1.9167E8 3 3 76 85 PEAKS DB
K.VIQSWYDENK.K N 77.34 1280.6036 10 0.6 641.3095 2 37.09 1 17259 BuCaMH03.raw 5.4482E8 1 1 108 117 PEAKS DB
G.SVIGHYTQIVWYK.S N 76.45 1592.8351 13 1.1 531.9529 3 53.77 1 30679 BuCaMH03.raw 1.5322E6 1 1 130 142 PEAKS DB
C.GENLFMSSQPYAWSK.V N 67.08 1743.7926 15 -0.7 872.9030 2 62.86 1 38254 BuCaMH03.raw 6.1843E6 1 1 93 107 PEAKS DB
K.YNDDYTNC(+57.02)K.S N 66.61 1191.4502 9 0.0 596.7324 2 13.11 1 2718 BuCaMH03.raw 1.4739E8 2 2 202 210 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
Y.KSGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.Y N 66.32 2535.0432 23 0.9 846.0225 3 30.53 1 12230 BuCaMH03.raw 3.4129E5 1 1 179 201 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
N.MLQM(+15.99)EWNSNAAQNAK.R N 62.98 1750.7767 15 1.1 876.3966 2 46.48 1 24489 BuCaMH03.raw 7.4598E5 1 1 55 69 Oxidation (M) M4:Oxidation (M):9.05 PEAKS DB
S.C(+57.02)GENLFMSSQPYAWSK.V N 62.04 1903.8232 16 0.6 952.9195 2 64.03 1 39173 BuCaMH03.raw 3.3027E7 1 1 92 107 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
A.DRC(+57.02)TFAHSPPHLR.T N 59.95 1592.7629 13 0.0 399.1980 4 17.37 1 4025 BuCaMH03.raw 1.6408E6 1 1 73 85 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.NLFMSSQPYAWSK.V N 56.27 1557.7285 13 -0.7 779.8710 2 60.42 1 36234 BuCaMH03.raw 3.801E5 1 1 95 107 PEAKS DB
I.QSWYDENK.K N 54.93 1068.4512 8 -0.1 535.2328 2 24.52 1 8368 BuCaMH03.raw 2.7802E7 1 1 110 117 PEAKS DB
K.VIQSWYDENKK.F N 53.89 1408.6986 11 0.7 705.3571 2 25.45 1 8817 BuCaMH03.raw 4.9114E5 1 1 108 118 PEAKS DB
R.NM(+15.99)LQM(+15.99)EWNSNAAQNAK.R N 53.13 1880.8146 16 1.2 941.4156 2 46.89 1 24806 BuCaMH03.raw 3.9953E5 1 1 54 69 Oxidation (M) M2:Oxidation (M):1000.00;M5:Oxidation (M):1000.00 PEAKS DB
total 25 peptides
T_127
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TWGHYVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 116.25 2833.1860 26 -0.1 1417.6002 2 56.08 1 32896 BuCaMH03.raw 4.0017E9 7 7 53 78 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.RTIIC(+57.02)YGAAGTC(+57.02)AR.I N 98.88 1568.7551 14 0.3 785.3851 2 24.68 1 8363 BuCaMH03.raw 2.3225E7 2 2 110 123 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.HYVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 98.37 2489.0376 23 -0.5 830.6861 3 46.53 1 24631 BuCaMH03.raw 1.0074E7 2 2 56 78 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.I N 90.97 1789.6494 14 -0.2 895.8318 2 17.70 1 4370 BuCaMH03.raw 2.9791E8 4 4 79 92 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)AR.I N 87.88 1412.6541 13 0.2 707.3345 2 33.70 1 14805 BuCaMH03.raw 2.1013E9 2 2 111 123 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
H.YVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 83.29 2351.9788 22 -0.2 1176.9965 2 54.31 1 31046 BuCaMH03.raw 3.6621E7 2 2 57 78 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 81.29 1811.7566 18 1.0 906.8865 2 39.40 1 18973 BuCaMH03.raw 1.6098E6 1 1 61 78 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GAGGSGTPVDALDR.C N 81.27 1594.7046 16 -0.2 798.3594 2 37.56 1 17571 BuCaMH03.raw 3.935E6 1 1 63 78 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
T.IIC(+57.02)YGAAGTC(+57.02)AR.I N 80.96 1311.6063 12 -0.3 656.8102 2 27.05 1 10166 BuCaMH03.raw 1.2342E8 1 1 112 123 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
H.LNLYQFMQMIR.Y Y 76.26 1455.7367 11 1.0 728.8763 2 91.16 1 61535 BuCaMH03.raw 1.3252E8 2 2 35 45 PEAKS DB
G.C(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 74.59 1754.7352 17 -0.1 878.3748 2 39.18 1 18847 BuCaMH03.raw 0 0 0 62 78 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
V.DYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 74.49 2089.8469 20 0.0 1045.9308 2 50.93 1 28639 BuCaMH03.raw 5.2431E7 2 2 59 78 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)YVHDNC(+57.02)YGDAEK.I N 73.17 1629.6188 13 -0.3 544.2134 3 14.86 1 2919 BuCaMH03.raw 1.0574E7 2 2 80 92 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFMQMIR.Y Y 71.53 1342.6526 10 0.8 672.3341 2 79.49 1 51920 BuCaMH03.raw 5.2816E9 4 4 36 45 PEAKS DB
R.YTIPC(+57.02)DKTWGHYVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 71.26 3710.5864 33 0.3 928.6542 4 60.20 1 35965 BuCaMH03.raw 2.0275E7 2 2 46 78 Carbamidomethylation C5:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 70.85 1974.8199 19 0.3 988.4175 2 44.69 1 23010 BuCaMH03.raw 1.2369E7 1 1 60 78 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
C.DKTWGHYVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 69.96 3076.3079 28 0.6 770.0847 4 53.88 1 30769 BuCaMH03.raw 7.7241E6 2 2 51 78 Carbamidomethylation C12:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.YVHDNC(+57.02)YGDAEK.I N 69.88 1469.5881 12 0.7 735.8019 2 12.57 1 1878 BuCaMH03.raw 7.7179E6 2 2 81 92 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
T.WGHYVDYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C Y 68.98 2732.1384 25 0.5 911.7206 3 54.52 1 31246 BuCaMH03.raw 1.6963E7 1 1 54 78 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
I.IC(+57.02)YGAAGTC(+57.02)AR.I N 65.84 1198.5223 11 0.0 600.2684 2 19.82 1 5420 BuCaMH03.raw 1.7918E7 1 1 113 123 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
L.NLYQFMQM(+15.99)IR.Y Y 62.65 1358.6475 10 0.6 680.3314 2 67.92 1 42635 BuCaMH03.raw 9.2925E6 1 1 36 45 Oxidation (M) M8:Oxidation (M):45.01 PEAKS DB
H.LNLYQFMQM(+15.99)IR.Y Y 58.29 1471.7316 11 0.8 736.8737 2 81.39 1 53949 BuCaMH03.raw 2.4076E6 2 2 35 45 Oxidation (M) M9:Oxidation (M):25.66 PEAKS DB
Y.C(+57.02)GAGGSGTPVDALDR.C N 58.21 1431.6412 15 0.0 716.8279 2 32.56 1 13642 BuCaMH03.raw 3.4042E7 1 1 64 78 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.LYQFMQMIR.Y Y 58.01 1228.6096 9 0.1 615.3121 2 66.33 1 41479 BuCaMH03.raw 3.6425E7 1 1 37 45 PEAKS DB
L.NLYQFMQMIRYTIPC(+57.02)DK.T Y 57.25 2220.0530 17 2.1 741.0265 3 84.76 1 55874 BuCaMH03.raw 4.5928E7 1 1 36 52 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
R.YTIPC(+57.02)DK.T N 54.13 895.4109 7 -1.2 448.7122 2 23.30 1 7704 BuCaMH03.raw 4.3871E8 1 1 46 52 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 26 peptides
T_32
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TWGEYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 107.03 2797.1384 26 -0.2 1399.5762 2 64.67 1 41686 BuCaMH03.raw 1.9214E9 9 9 54 79 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.RTIIC(+57.02)YGAAGTC(+57.02)AR.I N 98.88 1568.7551 14 0.3 785.3851 2 24.68 1 8363 BuCaMH03.raw 2.3225E7 2 2 111 124 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YADAEKK.H Y 92.10 1931.7600 15 -0.2 966.8871 2 12.70 1 1944 BuCaMH03.raw 2.6495E8 4 4 80 94 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGTC(+57.02)AR.I N 87.88 1412.6541 13 0.2 707.3345 2 33.70 1 14805 BuCaMH03.raw 2.1013E9 2 2 112 124 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YADAEK.K Y 85.72 1803.6650 14 0.3 902.8401 2 19.62 1 5276 BuCaMH03.raw 3.3243E8 4 4 80 93 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 81.29 1811.7566 18 1.0 906.8865 2 39.40 1 18973 BuCaMH03.raw 1.6098E6 1 1 62 79 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GAGGSGTPVDALDR.C N 81.27 1594.7046 16 -0.2 798.3594 2 37.56 1 17571 BuCaMH03.raw 3.935E6 1 1 64 79 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
T.IIC(+57.02)YGAAGTC(+57.02)AR.I N 80.96 1311.6063 12 -0.3 656.8102 2 27.05 1 10166 BuCaMH03.raw 1.2342E8 1 1 113 124 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFMEM(+15.99)IR.Y N 78.21 1295.6366 10 -0.2 648.8254 2 78.80 1 54312 BuCaMH03.raw 4.9087E8 4 4 37 46 Oxidation (M) M8:Oxidation (M):52.04 PEAKS DB
L.NLINFM(+15.99)EMIR.Y N 74.92 1295.6366 10 0.0 648.8256 2 67.65 1 42306 BuCaMH03.raw 3.5844E8 3 3 37 46 Oxidation (M) M6:Oxidation (M):32.28 PEAKS DB
G.C(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 74.59 1754.7352 17 -0.1 878.3748 2 39.18 1 18847 BuCaMH03.raw 0 0 0 63 79 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
A.DYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 74.49 2089.8469 20 0.0 1045.9308 2 50.93 1 28639 BuCaMH03.raw 5.2431E7 2 2 60 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
L.NLINFM(+15.99)EM(+15.99)IR.Y N 74.44 1311.6315 10 0.7 656.8235 2 83.18 1 54954 BuCaMH03.raw 8.4715E6 1 1 37 46 Oxidation (M) M6:Oxidation (M):1000.00;M8:Oxidation (M):1000.00 PEAKS DB
L.NLINFMEMIR.Y N 73.01 1279.6417 10 0.6 640.8285 2 88.88 1 59453 BuCaMH03.raw 1.4319E10 1 1 37 46 PEAKS DB
D.YGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 70.85 1974.8199 19 0.3 988.4175 2 44.69 1 23010 BuCaMH03.raw 1.2369E7 1 1 61 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
W.GEYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 68.56 2510.0115 24 1.4 1256.0148 2 53.68 1 30613 BuCaMH03.raw 6.51E5 1 1 56 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMEM(+15.99)IR.Y N 67.56 1408.7207 11 0.2 705.3678 2 89.30 1 63361 BuCaMH03.raw 3.3651E7 3 3 36 46 Oxidation (M) M9:Oxidation (M):36.05 PEAKS DB
G.EYADYGC(+57.02)YC(+57.02)GAGGSGTPVDALDR.C N 67.26 2452.9900 23 2.3 1227.5051 2 53.86 1 30821 BuCaMH03.raw 0 0 0 57 79 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
I.IC(+57.02)YGAAGTC(+57.02)AR.I N 65.84 1198.5223 11 0.0 600.2684 2 19.82 1 5420 BuCaMH03.raw 1.7918E7 1 1 114 124 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFMEMIR.Y N 65.28 1392.7257 11 -0.1 697.3701 2 93.64 1 63504 BuCaMH03.raw 7.6606E8 2 2 36 46 PEAKS DB
L.NLINFMEMIRYTIPC(+57.02)EK.T N 61.55 2171.0576 17 0.4 724.6934 3 87.62 1 58648 BuCaMH03.raw 5.837E7 2 2 37 53 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GAGGSGTPVDALDR.C N 58.21 1431.6412 15 0.0 716.8279 2 32.56 1 13642 BuCaMH03.raw 3.4042E7 1 1 65 79 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
P.LNLINFM(+15.99)EMIR.Y N 57.80 1408.7207 11 0.2 705.3678 2 89.30 1 63002 BuCaMH03.raw 1.8584E7 1 1 36 46 Oxidation (M) M7:Oxidation (M):18.53 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.49 1181.5936 9 0.4 591.8043 2 64.15 1 39326 BuCaMH03.raw 1.3572E6 1 1 38 46 Oxidation (M) M5:Oxidation (M):36.05 PEAKS DB
N.LINFMEMIR.Y N 56.00 1165.5988 9 0.3 583.8068 2 78.38 1 51198 BuCaMH03.raw 3.6549E8 1 1 38 46 PEAKS DB
C.YVHDNC(+57.02)YADAEK.K Y 55.73 1483.6038 12 0.4 495.5421 3 12.59 1 1893 BuCaMH03.raw 3.1811E6 2 2 82 93 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.LINFMEM(+15.99)IR.Y N 55.71 1181.5936 9 -0.6 591.8037 2 78.37 1 50945 BuCaMH03.raw 5.8354E6 2 2 38 46 Oxidation (M) M7:Oxidation (M):36.05 PEAKS DB
R.YTIPC(+57.02)EK.T N 54.55 909.4266 7 0.4 455.7207 2 24.68 1 8545 BuCaMH03.raw 6.5047E8 1 1 47 53 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 28 peptides
T_39
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FASAPYNEKNFDVVLETHC(+57.02)H Y 105.87 2893.3164 25 0.6 724.3368 4 60.61 1 36301 BuCaMH03.raw 2.5498E7 2 2 130 154 Carbamidomethylation C5:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
P.LDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 88.26 2325.9412 19 0.3 1163.9781 2 30.55 1 12281 BuCaMH03.raw 1.3893E6 1 1 72 90 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FASAPYNEK.N Y 85.72 1541.7184 14 0.1 771.8665 2 47.16 1 25162 BuCaMH03.raw 2.244E9 6 6 130 143 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.NFDVVLETHC(+57.02)H Y 84.01 1369.6085 11 0.5 685.8119 2 39.84 1 19506 BuCaMH03.raw 1.8057E9 18 18 144 154 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
C.DIGNTGTPLDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 75.50 3081.2861 27 -1.5 1028.1011 3 53.91 1 30888 BuCaMH03.raw 2.1865E6 1 1 64 90 Carbamidomethylation C15:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
R.KLPEC(+57.02)APYYETYSYTC(+57.02)SGGTVTC(+57.02)SADNEGC(+57.02)AASVC(+57.02)NC(+57.02)DR.T Y 74.93 4472.7695 39 -0.4 1491.9298 3 51.87 1 28996 BuCaMH03.raw 1.0858E9 3 3 91 129 Carbamidomethylation C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00;C35:Carbamidomethylation:1000.00;C37:Carbamidomethylation:1000.00 PEAKS DB
K.SMVQC(+57.02)TSTRPWLDYADYGC(+57.02)NC(+57.02)DIGNTGTPLDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 72.34 5646.3042 48 0.1 1412.5835 4 67.68 1 42292 BuCaMH03.raw 0 0 0 43 90 Carbamidomethylation C5:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C36:Carbamidomethylation:1000.00;C37:Carbamidomethylation:1000.00;C43:Carbamidomethylation:1000.00 PEAKS DB
C.SADNEGC(+57.02)AASVC(+57.02)NC(+57.02)DR.T Y 72.28 1784.6512 16 0.0 893.3329 2 15.58 1 3272 BuCaMH03.raw 5.675E6 1 1 114 129 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
K.SMVQC(+57.02)TSTRPWLD.Y Y 69.81 1579.7123 13 0.4 790.8638 2 49.04 1 26694 BuCaMH03.raw 1.8661E6 1 1 43 55 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
N.C(+57.02)DIGNTGTPLDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 68.95 3241.3169 28 0.3 1081.4465 3 51.87 1 28984 BuCaMH03.raw 3.2874E6 1 1 63 90 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
R.KLPEC(+57.02)APYYETY.S Y 68.44 1532.6857 12 0.5 767.3505 2 46.50 1 24408 BuCaMH03.raw 3.0376E8 1 1 91 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
N.FDVVLETHC(+57.02)H Y 67.04 1255.5656 10 -0.2 628.7899 2 36.64 1 17140 BuCaMH03.raw 1.4532E9 3 3 145 154 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.SMVQC(+57.02)TSTRP.W Y 64.72 1165.5220 10 0.5 583.7686 2 16.91 1 3933 BuCaMH03.raw 1.1226E7 1 1 43 52 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
L.DELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 64.29 2212.8572 18 -0.3 1107.4355 2 25.81 1 9384 BuCaMH03.raw 1.3446E8 2 2 73 90 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.TAALC(+57.02)FASAPYN.E N 63.97 1284.5808 12 0.9 643.2983 2 61.35 1 36882 BuCaMH03.raw 4.7091E7 1 1 130 141 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.DYGC(+57.02)NC(+57.02)DIGNTGTPLDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 63.34 3850.5022 33 -2.4 1284.5049 3 56.35 1 32763 BuCaMH03.raw 1.7314E8 1 1 58 90 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
K.SMVQC(+57.02)TSTRPWLDYA.D Y 61.83 1813.8127 15 0.9 907.9145 2 59.67 1 35458 BuCaMH03.raw 1.4356E7 1 1 43 57 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.KLPEC(+57.02)APYYETYSYTC(+57.02).S Y 59.07 2043.8594 16 0.6 1022.9376 2 53.06 1 30006 BuCaMH03.raw 1.4876E7 1 1 91 106 Carbamidomethylation C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
F.DVVLETHC(+57.02)H Y 58.95 1108.4972 9 0.2 555.2560 2 18.98 1 5154 BuCaMH03.raw 9.5924E7 1 1 146 154 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.SM(+15.99)VQC(+57.02)TSTRP.W Y 57.70 1181.5168 10 0.1 591.7657 2 16.16 1 4018 BuCaMH03.raw 2.6305E6 1 1 43 52 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
D.RTAALC(+57.02)FASAPYNEK.N Y 57.60 1697.8195 15 -0.1 566.9470 3 35.73 1 16103 BuCaMH03.raw 3.6281E5 1 1 129 143 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
A.LC(+57.02)FASAPYNEK.N Y 55.94 1298.5964 11 -0.7 650.3051 2 39.43 1 18904 BuCaMH03.raw 5.8058E7 1 1 133 143 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
T.AALC(+57.02)FASAPYNEK.N Y 55.31 1440.6707 13 0.4 721.3429 2 44.56 1 23283 BuCaMH03.raw 4.4605E7 1 1 131 143 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.PWLDYADYGC(+57.02)NC(+57.02)DIGNTGTPLDELDTC(+57.02)C(+57.02)QTHANC(+57.02)YAEAR.K Y 54.88 4595.8457 39 -0.2 1532.9556 3 72.17 1 46214 BuCaMH03.raw 1.6965E8 1 1 52 90 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
K.NFDVVLETH.C Y 53.00 1072.5189 9 -0.5 537.2665 2 51.60 1 28907 BuCaMH03.raw 3.8982E6 1 1 144 152 PEAKS DB
total 25 peptides
T_130
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLSQAGHR.V N 97.43 2349.2375 24 0.6 784.0869 3 63.13 1 38339 BuCaMH03.raw 1.3603E7 2 2 90 113 PEAKS DB
K.SMHQAIAEIVHLNAQVTK.I N 92.86 1989.0465 18 1.1 664.0235 3 50.27 1 27750 BuCaMH03.raw 6.3424E6 3 3 301 318 PEAKS DB
R.EADYEEFLEIAR.N N 91.88 1483.6830 12 0.7 742.8493 2 71.75 1 45615 BuCaMH03.raw 5.1224E6 1 1 68 79 PEAKS DB
Y.VLADDSDFFQALDIK.T N 88.26 1695.8354 15 -0.1 848.9249 2 81.35 1 53415 BuCaMH03.raw 5.554E6 1 1 428 442 PEAKS DB
E.ADYEEFLEIAR.N N 84.13 1354.6404 11 0.7 678.3279 2 68.97 1 43275 BuCaMH03.raw 7.4529E6 1 1 69 79 PEAKS DB
K.TSADIVINDLSLIHQLPK.N N 82.55 1976.0942 18 0.9 659.7059 3 72.99 1 46603 BuCaMH03.raw 7.9369E6 2 2 443 460 PEAKS DB
T.SFTPYQFQDYSETFAAPVGR.I Y 79.76 2310.0593 20 -1.5 1156.0352 2 73.49 1 47054 BuCaMH03.raw 1.8E6 1 1 487 506 PEAKS DB
K.LNEFFQENENAWYFIR.N N 75.72 2118.9800 16 0.4 1060.4977 2 82.64 1 54427 BuCaMH03.raw 3.5944E6 1 1 164 179 PEAKS DB
L.NEFFQENENAWYFIR.N N 69.66 2005.8959 15 0.5 1003.9557 2 79.06 1 51465 BuCaMH03.raw 5.1838E6 1 1 165 179 PEAKS DB
K.RFDEIIDGFDQLPK.S N 69.25 1691.8518 14 -0.2 564.9578 3 66.71 1 41409 BuCaMH03.raw 2.6804E6 2 2 287 300 PEAKS DB
K.EGWYVNMGPMR.L N 68.49 1338.5850 11 0.8 670.3003 2 58.96 1 34889 BuCaMH03.raw 1.2121E7 1 1 135 145 PEAKS DB
K.NEIQDLC(+57.02)YPSLIK.K N 68.00 1591.7915 13 0.4 796.9034 2 62.11 1 37547 BuCaMH03.raw 7.0247E6 1 1 461 473 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.YEEFLEIAR.N N 66.92 1168.5764 9 2.1 585.2967 2 56.08 1 32599 BuCaMH03.raw 1.8928E6 1 1 71 79 PEAKS DB
R.SPLEEC(+57.02)FR.E N 65.33 1036.4647 8 0.1 519.2397 2 34.43 1 15058 BuCaMH03.raw 2.9904E6 1 1 60 67 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.EFFQENENAWYFIR.N N 65.02 1891.8529 14 -1.7 946.9321 2 79.09 1 51607 BuCaMH03.raw 9.4924E5 1 1 166 179 PEAKS DB
R.ISFEPPLPPK.K N 64.81 1123.6277 10 0.4 562.8214 2 55.18 1 32023 BuCaMH03.raw 2.0577E6 1 1 357 366 PEAKS DB
R.VHGWLDSTIK.S N 62.75 1154.6084 10 -0.1 578.3114 2 36.99 1 17052 BuCaMH03.raw 2.2229E6 2 2 517 526 PEAKS DB
A.DYEEFLEIAR.N N 61.24 1283.6033 10 1.2 642.8097 2 71.33 1 45329 BuCaMH03.raw 4.864E5 1 1 70 79 PEAKS DB
R.FDEIIDGFDQLPK.S N 61.23 1535.7507 13 0.7 768.8832 2 72.44 1 46158 BuCaMH03.raw 1.0313E7 1 1 288 300 PEAKS DB
K.TLSYVTADYVIVC(+57.02)ATSR.A N 60.60 1917.9506 17 0.5 959.9830 2 69.81 1 44066 BuCaMH03.raw 2.4641E6 2 2 336 352 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
F.QENENAWYFIR.N N 60.27 1468.6735 11 0.6 735.3445 2 60.74 1 36464 BuCaMH03.raw 5.201E5 1 1 169 179 PEAKS DB
K.WSLDKYTMGALTSFTPYQFQDYSETFAAPVGR.I Y 59.97 3676.7183 32 -0.6 1226.5793 3 91.66 1 61646 BuCaMH03.raw 1.7061E6 1 1 475 506 PEAKS DB
K.FWEADGIHGGK.S N 53.59 1215.5673 11 0.0 406.1964 3 29.75 1 11639 BuCaMH03.raw 3.2139E6 1 1 390 400 PEAKS DB
total 23 peptides
T_131
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLSQAGHR.V N 97.43 2349.2375 24 0.6 784.0869 3 63.13 1 38339 BuCaMH03.raw 1.3603E7 2 2 90 113 PEAKS DB
K.SMHQAIAEIVHLNAQVTK.I N 92.86 1989.0465 18 1.1 664.0235 3 50.27 1 27750 BuCaMH03.raw 6.3424E6 3 3 301 318 PEAKS DB
R.EADYEEFLEIAR.N N 91.88 1483.6830 12 0.7 742.8493 2 71.75 1 45615 BuCaMH03.raw 5.1224E6 1 1 68 79 PEAKS DB
Y.VLADDSDFFQALDIK.T N 88.26 1695.8354 15 -0.1 848.9249 2 81.35 1 53415 BuCaMH03.raw 5.554E6 1 1 428 442 PEAKS DB
E.ADYEEFLEIAR.N N 84.13 1354.6404 11 0.7 678.3279 2 68.97 1 43275 BuCaMH03.raw 7.4529E6 1 1 69 79 PEAKS DB
K.TSADIVINDLSLIHQLPK.N N 82.55 1976.0942 18 0.9 659.7059 3 72.99 1 46603 BuCaMH03.raw 7.9369E6 2 2 443 460 PEAKS DB
T.SFTPYQFQDYSETFAAPVGR.I Y 79.76 2310.0593 20 -1.5 1156.0352 2 73.49 1 47054 BuCaMH03.raw 1.8E6 1 1 487 506 PEAKS DB
K.LNEFFQENENAWYFIR.N N 75.72 2118.9800 16 0.4 1060.4977 2 82.64 1 54427 BuCaMH03.raw 3.5944E6 1 1 164 179 PEAKS DB
L.NEFFQENENAWYFIR.N N 69.66 2005.8959 15 0.5 1003.9557 2 79.06 1 51465 BuCaMH03.raw 5.1838E6 1 1 165 179 PEAKS DB
K.RFDEIIDGFDQLPK.S N 69.25 1691.8518 14 -0.2 564.9578 3 66.71 1 41409 BuCaMH03.raw 2.6804E6 2 2 287 300 PEAKS DB
K.EGWYVNMGPMR.L N 68.49 1338.5850 11 0.8 670.3003 2 58.96 1 34889 BuCaMH03.raw 1.2121E7 1 1 135 145 PEAKS DB
K.NEIQDLC(+57.02)YPSLIK.K N 68.00 1591.7915 13 0.4 796.9034 2 62.11 1 37547 BuCaMH03.raw 7.0247E6 1 1 461 473 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.YEEFLEIAR.N N 66.92 1168.5764 9 2.1 585.2967 2 56.08 1 32599 BuCaMH03.raw 1.8928E6 1 1 71 79 PEAKS DB
R.SPLEEC(+57.02)FR.E N 65.33 1036.4647 8 0.1 519.2397 2 34.43 1 15058 BuCaMH03.raw 2.9904E6 1 1 60 67 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.EFFQENENAWYFIR.N N 65.02 1891.8529 14 -1.7 946.9321 2 79.09 1 51607 BuCaMH03.raw 9.4924E5 1 1 166 179 PEAKS DB
R.ISFEPPLPPK.K N 64.81 1123.6277 10 0.4 562.8214 2 55.18 1 32023 BuCaMH03.raw 2.0577E6 1 1 357 366 PEAKS DB
R.VHGWLDSTIK.S N 62.75 1154.6084 10 -0.1 578.3114 2 36.99 1 17052 BuCaMH03.raw 2.2229E6 2 2 517 526 PEAKS DB
A.DYEEFLEIAR.N N 61.24 1283.6033 10 1.2 642.8097 2 71.33 1 45329 BuCaMH03.raw 4.864E5 1 1 70 79 PEAKS DB
R.FDEIIDGFDQLPK.S N 61.23 1535.7507 13 0.7 768.8832 2 72.44 1 46158 BuCaMH03.raw 1.0313E7 1 1 288 300 PEAKS DB
K.TLSYVTADYVIVC(+57.02)ATSR.A N 60.60 1917.9506 17 0.5 959.9830 2 69.81 1 44066 BuCaMH03.raw 2.4641E6 2 2 336 352 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
F.QENENAWYFIR.N N 60.27 1468.6735 11 0.6 735.3445 2 60.74 1 36464 BuCaMH03.raw 5.201E5 1 1 169 179 PEAKS DB
K.WSLDKYTMGALTSFTPYQFQDYSETFAAPVGR.I Y 59.97 3676.7183 32 -0.6 1226.5793 3 91.66 1 61646 BuCaMH03.raw 1.7061E6 1 1 475 506 PEAKS DB
K.FWEADGIHGGK.S N 53.59 1215.5673 11 0.0 406.1964 3 29.75 1 11639 BuCaMH03.raw 3.2139E6 1 1 390 400 PEAKS DB
total 23 peptides
T_128
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLSQAGHR.V N 97.43 2349.2375 24 0.6 784.0869 3 63.13 1 38339 BuCaMH03.raw 1.3603E7 2 2 90 113 PEAKS DB
K.SMHQAIAEIVHLNAQVTK.I N 92.86 1989.0465 18 1.1 664.0235 3 50.27 1 27750 BuCaMH03.raw 6.3424E6 3 3 301 318 PEAKS DB
R.EADYEEFLEIAR.N N 91.88 1483.6830 12 0.7 742.8493 2 71.75 1 45615 BuCaMH03.raw 5.1224E6 1 1 68 79 PEAKS DB
Y.VLADDSDFFQALDIK.T N 88.26 1695.8354 15 -0.1 848.9249 2 81.35 1 53415 BuCaMH03.raw 5.554E6 1 1 428 442 PEAKS DB
E.ADYEEFLEIAR.N N 84.13 1354.6404 11 0.7 678.3279 2 68.97 1 43275 BuCaMH03.raw 7.4529E6 1 1 69 79 PEAKS DB
K.TSADIVINDLSLIHQLPK.N N 82.55 1976.0942 18 0.9 659.7059 3 72.99 1 46603 BuCaMH03.raw 7.9369E6 2 2 443 460 PEAKS DB
K.LNEFFQENENAWYFIR.N N 75.72 2118.9800 16 0.4 1060.4977 2 82.64 1 54427 BuCaMH03.raw 3.5944E6 1 1 164 179 PEAKS DB
L.NEFFQENENAWYFIR.N N 69.66 2005.8959 15 0.5 1003.9557 2 79.06 1 51465 BuCaMH03.raw 5.1838E6 1 1 165 179 PEAKS DB
K.RFDEIIDGFDQLPK.S N 69.25 1691.8518 14 -0.2 564.9578 3 66.71 1 41409 BuCaMH03.raw 2.6804E6 2 2 287 300 PEAKS DB
K.EGWYVNMGPMR.L N 68.49 1338.5850 11 0.8 670.3003 2 58.96 1 34889 BuCaMH03.raw 1.2121E7 1 1 135 145 PEAKS DB
K.NEIQDLC(+57.02)YPSLIK.K N 68.00 1591.7915 13 0.4 796.9034 2 62.11 1 37547 BuCaMH03.raw 7.0247E6 1 1 461 473 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.YEEFLEIAR.N N 66.92 1168.5764 9 2.1 585.2967 2 56.08 1 32599 BuCaMH03.raw 1.8928E6 1 1 71 79 PEAKS DB
R.SPLEEC(+57.02)FR.E N 65.33 1036.4647 8 0.1 519.2397 2 34.43 1 15058 BuCaMH03.raw 2.9904E6 1 1 60 67 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.EFFQENENAWYFIR.N N 65.02 1891.8529 14 -1.7 946.9321 2 79.09 1 51607 BuCaMH03.raw 9.4924E5 1 1 166 179 PEAKS DB
R.ISFEPPLPPK.K N 64.81 1123.6277 10 0.4 562.8214 2 55.18 1 32023 BuCaMH03.raw 2.0577E6 1 1 357 366 PEAKS DB
R.VHGWLDSTIK.S N 62.75 1154.6084 10 -0.1 578.3114 2 36.99 1 17052 BuCaMH03.raw 2.2229E6 2 2 517 526 PEAKS DB
K.YTMGALTSFTPYQFQDYIETVAAPVGR.V Y 61.65 3025.4531 27 0.4 1513.7345 2 98.03 1 66720 BuCaMH03.raw 9.3511E5 1 1 480 506 PEAKS DB
A.DYEEFLEIAR.N N 61.24 1283.6033 10 1.2 642.8097 2 71.33 1 45329 BuCaMH03.raw 4.864E5 1 1 70 79 PEAKS DB
R.FDEIIDGFDQLPK.S N 61.23 1535.7507 13 0.7 768.8832 2 72.44 1 46158 BuCaMH03.raw 1.0313E7 1 1 288 300 PEAKS DB
K.TLSYVTADYVIVC(+57.02)ATSR.A N 60.60 1917.9506 17 0.5 959.9830 2 69.81 1 44066 BuCaMH03.raw 2.4641E6 2 2 336 352 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
F.QENENAWYFIR.N N 60.27 1468.6735 11 0.6 735.3445 2 60.74 1 36464 BuCaMH03.raw 5.201E5 1 1 169 179 PEAKS DB
K.FWEADGIHGGK.S N 53.59 1215.5673 11 0.0 406.1964 3 29.75 1 11639 BuCaMH03.raw 3.2139E6 1 1 390 400 PEAKS DB
total 22 peptides
T_129
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLSQAGHR.V N 97.43 2349.2375 24 0.6 784.0869 3 63.13 1 38339 BuCaMH03.raw 1.3603E7 2 2 90 113 PEAKS DB
K.SMHQAIAEIVHLNAQVTK.I N 92.86 1989.0465 18 1.1 664.0235 3 50.27 1 27750 BuCaMH03.raw 6.3424E6 3 3 301 318 PEAKS DB
R.EADYEEFLEIAR.N N 91.88 1483.6830 12 0.7 742.8493 2 71.75 1 45615 BuCaMH03.raw 5.1224E6 1 1 68 79 PEAKS DB
Y.VLADDSDFFQALDIK.T N 88.26 1695.8354 15 -0.1 848.9249 2 81.35 1 53415 BuCaMH03.raw 5.554E6 1 1 428 442 PEAKS DB
E.ADYEEFLEIAR.N N 84.13 1354.6404 11 0.7 678.3279 2 68.97 1 43275 BuCaMH03.raw 7.4529E6 1 1 69 79 PEAKS DB
K.TSADIVINDLSLIHQLPK.N N 82.55 1976.0942 18 0.9 659.7059 3 72.99 1 46603 BuCaMH03.raw 7.9369E6 2 2 443 460 PEAKS DB
K.LNEFFQENENAWYFIR.N N 75.72 2118.9800 16 0.4 1060.4977 2 82.64 1 54427 BuCaMH03.raw 3.5944E6 1 1 164 179 PEAKS DB
L.NEFFQENENAWYFIR.N N 69.66 2005.8959 15 0.5 1003.9557 2 79.06 1 51465 BuCaMH03.raw 5.1838E6 1 1 165 179 PEAKS DB
K.RFDEIIDGFDQLPK.S N 69.25 1691.8518 14 -0.2 564.9578 3 66.71 1 41409 BuCaMH03.raw 2.6804E6 2 2 287 300 PEAKS DB
K.EGWYVNMGPMR.L N 68.49 1338.5850 11 0.8 670.3003 2 58.96 1 34889 BuCaMH03.raw 1.2121E7 1 1 135 145 PEAKS DB
K.NEIQDLC(+57.02)YPSLIK.K N 68.00 1591.7915 13 0.4 796.9034 2 62.11 1 37547 BuCaMH03.raw 7.0247E6 1 1 461 473 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.YEEFLEIAR.N N 66.92 1168.5764 9 2.1 585.2967 2 56.08 1 32599 BuCaMH03.raw 1.8928E6 1 1 71 79 PEAKS DB
R.SPLEEC(+57.02)FR.E N 65.33 1036.4647 8 0.1 519.2397 2 34.43 1 15058 BuCaMH03.raw 2.9904E6 1 1 60 67 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.EFFQENENAWYFIR.N N 65.02 1891.8529 14 -1.7 946.9321 2 79.09 1 51607 BuCaMH03.raw 9.4924E5 1 1 166 179 PEAKS DB
R.ISFEPPLPPK.K N 64.81 1123.6277 10 0.4 562.8214 2 55.18 1 32023 BuCaMH03.raw 2.0577E6 1 1 357 366 PEAKS DB
R.VHGWLDSTIK.S N 62.75 1154.6084 10 -0.1 578.3114 2 36.99 1 17052 BuCaMH03.raw 2.2229E6 2 2 517 526 PEAKS DB
K.YTMGALTSFTPYQFQDYIETVAAPVGR.V Y 61.65 3025.4531 27 0.4 1513.7345 2 98.03 1 66720 BuCaMH03.raw 9.3511E5 1 1 480 506 PEAKS DB
A.DYEEFLEIAR.N N 61.24 1283.6033 10 1.2 642.8097 2 71.33 1 45329 BuCaMH03.raw 4.864E5 1 1 70 79 PEAKS DB
R.FDEIIDGFDQLPK.S N 61.23 1535.7507 13 0.7 768.8832 2 72.44 1 46158 BuCaMH03.raw 1.0313E7 1 1 288 300 PEAKS DB
K.TLSYVTADYVIVC(+57.02)ATSR.A N 60.60 1917.9506 17 0.5 959.9830 2 69.81 1 44066 BuCaMH03.raw 2.4641E6 2 2 336 352 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
F.QENENAWYFIR.N N 60.27 1468.6735 11 0.6 735.3445 2 60.74 1 36464 BuCaMH03.raw 5.201E5 1 1 169 179 PEAKS DB
K.FWEADGIHGGK.S N 53.59 1215.5673 11 0.0 406.1964 3 29.75 1 11639 BuCaMH03.raw 3.2139E6 1 1 390 400 PEAKS DB
total 22 peptides
T_6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VYGLVNHLNMIYK.T Y 95.55 1562.8279 13 0.2 782.4214 2 53.03 1 29989 BuCaMH03.raw 1.7353E7 2 2 232 244 PEAKS DB
K.YIELYMAVDNR.M N 86.42 1385.6649 11 0.7 693.8402 2 60.14 1 37661 BuCaMH03.raw 2.1755E8 18 18 206 216 PEAKS DB
C.LMYESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 78.99 2881.2283 24 -0.2 961.4165 3 39.09 1 18706 BuCaMH03.raw 1.8302E7 2 2 364 387 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
L.MYESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 75.75 2768.1443 23 -0.6 693.0429 4 32.28 1 13474 BuCaMH03.raw 2.6278E7 2 2 365 387 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.KSVAVVQDYSK.R N 75.23 1222.6558 11 -0.2 612.3350 2 15.59 1 3167 BuCaMH03.raw 4.4932E6 2 2 320 330 PEAKS DB
K.YIELYM(+15.99)AVDNR.M N 72.96 1401.6598 11 -0.6 701.8367 2 49.91 1 27539 BuCaMH03.raw 2.5137E6 2 2 206 216 Oxidation (M) M6:Oxidation (M):1000.00 PEAKS DB
R.NSC(+57.02)FTLNQR.G N 71.24 1138.5189 9 -0.7 570.2664 2 27.05 1 9901 BuCaMH03.raw 2.443E7 1 1 531 539 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALMGPNVK.A N 70.69 1915.9318 17 0.6 639.6516 3 55.90 1 32502 BuCaMH03.raw 1.0403E6 1 1 511 527 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
V.C(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 67.70 2296.0173 20 -0.4 1149.0155 2 62.88 1 38333 BuCaMH03.raw 1.54E6 1 1 576 595 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
Y.IELYMAVDNR.M N 65.94 1222.6016 10 0.3 612.3082 2 51.87 1 29293 BuCaMH03.raw 6.9266E7 1 1 207 216 PEAKS DB
P.TLTNQC(+57.02)IALMGPNVK.A N 64.79 1658.8484 15 1.0 830.4323 2 51.45 1 28756 BuCaMH03.raw 1.0501E6 1 1 513 527 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
V.YGLVNHLNMIYK.T Y 62.22 1463.7595 12 0.0 732.8870 2 48.33 1 26042 BuCaMH03.raw 1.7972E6 1 1 233 244 PEAKS DB
M.YESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 60.65 2637.1038 22 0.9 660.2838 4 28.14 1 10623 BuCaMH03.raw 8.8375E5 1 1 366 387 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
K.SVAVVQDYSK.R N 60.55 1094.5608 10 -0.5 548.2874 2 26.31 1 9703 BuCaMH03.raw 3.8359E7 1 1 321 330 PEAKS DB
Y.IELYM(+15.99)AVDNR.M N 59.55 1238.5966 10 0.8 620.3060 2 51.87 1 29062 BuCaMH03.raw 1.1103E6 1 1 207 216 Oxidation (M) M5:Oxidation (M):1000.00 PEAKS DB
R.ETVLLPHKR.N N 59.06 1091.6451 9 0.9 546.8303 2 12.59 1 1892 BuCaMH03.raw 1.9337E6 1 1 282 290 PEAKS DB
K.IEPDVDATLK.S N 58.89 1099.5760 10 0.0 550.7953 2 36.77 1 17181 BuCaMH03.raw 6.4067E7 1 1 266 275 PEAKS DB
R.VC(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 58.49 2395.0857 21 0.6 799.3696 3 64.16 1 39325 BuCaMH03.raw 4.0264E6 1 1 575 595 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.ETVLLPHK.R N 58.18 935.5440 8 0.4 468.7795 2 22.25 1 6754 BuCaMH03.raw 9.3762E6 1 1 282 289 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 472 479 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.ELYMAVDNR.M N 55.87 1109.5176 9 0.7 555.7665 2 36.61 1 16797 BuCaMH03.raw 7.7591E6 1 1 208 216 PEAKS DB
K.KYIELYMAVDNR.M N 54.08 1513.7599 12 0.1 505.5940 3 47.31 1 25389 BuCaMH03.raw 4.4357E5 1 1 205 216 PEAKS DB
S.C(+57.02)FTLNQR.G N 53.69 937.4440 7 -0.2 469.7292 2 25.79 1 9047 BuCaMH03.raw 1.2157E6 1 1 533 539 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 23 peptides
T_33
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VAAIC(+57.02)FAGAPYNNSNFMVASK.I Y 99.75 2231.0503 21 -0.3 1116.5321 2 66.90 1 41542 BuCaMH03.raw 6.6548E8 3 3 67 87 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNNSNFMVASK.I Y 95.58 2060.9448 19 0.5 1031.4802 2 62.66 1 38110 BuCaMH03.raw 1.5008E8 2 2 69 87 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYDC(+57.02)SEGKLTC(+57.02)KDTAGTC(+57.02)AR.I Y 84.63 2543.0728 22 0.0 636.7755 4 22.48 1 6906 BuCaMH03.raw 3.3749E6 1 1 38 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
V.AAIC(+57.02)FAGAPYNNSNFMVASK.I Y 84.58 2131.9819 20 0.3 1066.9985 2 63.68 1 39029 BuCaMH03.raw 1.0774E8 2 2 68 87 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.VAAIC(+57.02)FAGAPYNNSNFMVASKIKC(+57.02)E Y 82.10 2761.3025 25 1.2 921.4426 3 62.54 1 37961 BuCaMH03.raw 3.9735E6 1 1 67 91 Carbamidomethylation C5:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDR.C N 78.80 1157.5312 12 -0.3 579.7727 2 27.28 1 10243 BuCaMH03.raw 3.2115E9 2 2 3 14 PEAKS DB
G.GGGTPVDDLDR.C N 76.90 1100.5098 11 0.1 551.2622 2 27.24 1 10065 BuCaMH03.raw 3.4495E7 1 1 4 14 PEAKS DB
A.GAPYNNSNFMVASK.I Y 73.09 1498.6875 14 0.0 750.3510 2 38.75 1 18464 BuCaMH03.raw 3.7326E7 1 1 74 87 PEAKS DB
F.AGAPYNNSNFM(+15.99)VASK.I Y 71.28 1585.7195 15 0.7 793.8676 2 40.01 1 19307 BuCaMH03.raw 3.1461E6 2 2 73 87 Oxidation (M) M11:Oxidation (M):1000.00 PEAKS DB
F.AGAPYNNSNFMVASK.I Y 71.02 1569.7246 15 -0.2 785.8694 2 39.97 1 19594 BuCaMH03.raw 5.5867E7 1 1 73 87 PEAKS DB
A.GAPYNNSNFM(+15.99)VASK.I Y 66.24 1514.6824 14 -0.4 758.3481 2 38.75 1 18546 BuCaMH03.raw 1.9449E6 1 1 74 87 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
K.TYSYDC(+57.02)SEGKLTC(+57.02)K.D N 65.46 1710.7229 14 0.1 571.2483 3 23.16 1 7349 BuCaMH03.raw 2.7246E6 1 1 38 51 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYDC(+57.02)SEGK.L N 61.86 1208.4656 10 0.1 605.2401 2 15.61 1 4034 BuCaMH03.raw 6.0668E8 1 1 38 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LASC(+57.02)RPYYK.T N 58.27 1156.5698 9 -0.1 579.2921 2 12.61 1 1896 BuCaMH03.raw 4.5113E6 1 1 29 37 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.VAAIC(+57.02)FAGAPYNNSNFM(+15.99)VASK.I Y 55.07 2247.0452 21 0.2 750.0225 3 66.90 1 41828 BuCaMH03.raw 3.5394E6 1 1 67 87 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;M17:Oxidation (M):1000.00 PEAKS DB
G.GGTPVDDLDR.C N 54.58 1043.4883 10 -0.6 522.7511 2 27.32 1 10090 BuCaMH03.raw 4.8161E6 1 1 5 14 PEAKS DB
K.VHDDC(+57.02)YGEAEKLASC(+57.02)RPYYK.T N 53.00 2460.0837 20 0.9 616.0287 4 34.87 1 15300 BuCaMH03.raw 4.6326E6 1 1 18 37 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
total 17 peptides
ABN72537.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DRPQC(+57.02)ILNKPLITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 97.02 4362.0542 38 -2.6 1091.5179 4 83.53 1 55065 BuCaMH03.raw 1.1448E8 2 2 392 429 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
R.IDFNGNTVGLAALGSLC(+57.02)SVK.Y N 84.40 2035.0408 20 0.6 1018.5283 2 79.20 1 51554 BuCaMH03.raw 1.4604E7 1 1 300 319 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTILR.R N 80.71 1558.9082 13 1.0 780.4622 2 98.30 1 67045 BuCaMH03.raw 2.3113E7 1 1 232 244 PEAKS DB
K.YSVAVIQDYSK.R N 71.25 1271.6398 11 -0.2 636.8270 2 45.55 1 23713 BuCaMH03.raw 1.1049E7 1 1 320 330 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALMGPNVK.V N 70.69 1915.9318 17 0.6 639.6516 3 55.90 1 32502 BuCaMH03.raw 1.0403E6 1 1 511 527 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.G N 68.01 1139.5029 9 -0.1 570.7587 2 38.10 1 18031 BuCaMH03.raw 1.3816E6 1 1 531 539 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
V.C(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 67.70 2296.0173 20 -0.4 1149.0155 2 62.88 1 38333 BuCaMH03.raw 1.54E6 1 1 576 595 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
P.TLTNQC(+57.02)IALMGPNVK.V N 64.79 1658.8484 15 1.0 830.4323 2 51.45 1 28756 BuCaMH03.raw 1.0501E6 1 1 513 527 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.TSMVASTMAHEMGHNLGINHDR.A N 64.46 2408.0784 22 0.4 603.0271 4 38.14 1 17887 BuCaMH03.raw 8.2173E6 1 1 332 353 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPR.D N 62.34 1639.6606 14 0.5 820.8380 2 31.45 1 12962 BuCaMH03.raw 8.184E5 1 1 416 429 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.DIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 61.70 2813.2095 25 1.2 938.7449 3 76.88 1 49781 BuCaMH03.raw 1.0195E7 1 1 405 429 Carbamidomethylation C8:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.RVYELVNILNTILR.R N 61.38 1715.0094 14 0.9 572.6776 3 87.25 1 57914 BuCaMH03.raw 9.6658E6 1 1 231 244 PEAKS DB
R.DKINVQSDVK.A N 59.76 1144.6088 10 0.4 573.3119 2 13.87 1 2502 BuCaMH03.raw 4.1024E6 1 1 262 271 PEAKS DB
G.VC(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 58.49 2395.0857 21 0.6 799.3696 3 64.16 1 39325 BuCaMH03.raw 4.0264E6 1 1 575 595 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.YSVAVIQDYSKR.T N 57.88 1427.7408 12 -0.5 714.8773 2 37.41 1 17503 BuCaMH03.raw 4.5095E5 1 1 320 331 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 472 479 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.NDNAQLLTR.I N 55.52 1043.5360 9 0.1 522.7753 2 23.63 1 7605 BuCaMH03.raw 8.9599E6 1 1 291 299 PEAKS DB
L.NFHIALIGLEIWSK.R N 53.97 1639.9086 14 0.2 547.6436 3 80.89 1 53058 BuCaMH03.raw 1.4388E5 1 1 247 260 PEAKS DB
K.INVQSDVK.A N 53.76 901.4869 8 0.2 451.7508 2 17.18 1 3871 BuCaMH03.raw 3.0691E6 1 1 264 271 PEAKS DB
S.C(+57.02)FTLNQR.G N 53.69 937.4440 7 -0.2 469.7292 2 25.79 1 9047 BuCaMH03.raw 1.2157E6 1 1 533 539 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.KPLITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 53.23 3365.5730 30 -0.6 1122.8643 3 78.25 1 50839 BuCaMH03.raw 1.302E6 1 1 400 429 Carbamidomethylation C13:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00;C26:Carbamidomethylation:1000.00 PEAKS DB
total 21 peptides
A8QL49.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DRPQC(+57.02)ILNKPLITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 97.02 4362.0542 38 -2.6 1091.5179 4 83.53 1 55065 BuCaMH03.raw 1.1448E8 2 2 392 429 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00;C32:Carbamidomethylation:1000.00;C34:Carbamidomethylation:1000.00 PEAKS DB
R.IDFNGNTVGLAALGSLC(+57.02)SVK.Y N 84.40 2035.0408 20 0.6 1018.5283 2 79.20 1 51554 BuCaMH03.raw 1.4604E7 1 1 300 319 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
R.VYELVNILNTILR.R N 80.71 1558.9082 13 1.0 780.4622 2 98.30 1 67045 BuCaMH03.raw 2.3113E7 1 1 232 244 PEAKS DB
K.YSVAVIQDYSK.R N 71.25 1271.6398 11 -0.2 636.8270 2 45.55 1 23713 BuCaMH03.raw 1.1049E7 1 1 320 330 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALMGPNVK.V N 70.69 1915.9318 17 0.6 639.6516 3 55.90 1 32502 BuCaMH03.raw 1.0403E6 1 1 511 527 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.G N 68.01 1139.5029 9 -0.1 570.7587 2 38.10 1 18031 BuCaMH03.raw 1.3816E6 1 1 531 539 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
V.C(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 67.70 2296.0173 20 -0.4 1149.0155 2 62.88 1 38333 BuCaMH03.raw 1.54E6 1 1 576 595 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
P.TLTNQC(+57.02)IALMGPNVK.V N 64.79 1658.8484 15 1.0 830.4323 2 51.45 1 28756 BuCaMH03.raw 1.0501E6 1 1 513 527 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.TSMVASTMAHEMGHNLGINHDR.A N 64.46 2408.0784 22 0.4 603.0271 4 38.14 1 17887 BuCaMH03.raw 8.2173E6 1 1 332 353 PEAKS DB
Y.FVEVGEEC(+57.02)DC(+57.02)GSPR.D N 62.34 1639.6606 14 0.5 820.8380 2 31.45 1 12962 BuCaMH03.raw 8.184E5 1 1 416 429 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.DIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 61.70 2813.2095 25 1.2 938.7449 3 76.88 1 49781 BuCaMH03.raw 1.0195E7 1 1 405 429 Carbamidomethylation C8:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.RVYELVNILNTILR.R N 61.38 1715.0094 14 0.9 572.6776 3 87.25 1 57914 BuCaMH03.raw 9.6658E6 1 1 231 244 PEAKS DB
R.DKINVQSDVK.A N 59.76 1144.6088 10 0.4 573.3119 2 13.87 1 2502 BuCaMH03.raw 4.1024E6 1 1 262 271 PEAKS DB
G.VC(+57.02)NC(+57.02)LILPDDPNYGMVETGTK.C N 58.49 2395.0857 21 0.6 799.3696 3 64.16 1 39325 BuCaMH03.raw 4.0264E6 1 1 575 595 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.YSVAVIQDYSKR.T N 57.88 1427.7408 12 -0.5 714.8773 2 37.41 1 17503 BuCaMH03.raw 4.5095E5 1 1 320 331 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 472 479 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.NDNAQLLTR.I N 55.52 1043.5360 9 0.1 522.7753 2 23.63 1 7605 BuCaMH03.raw 8.9599E6 1 1 291 299 PEAKS DB
L.NFHIALIGLEIWSK.R N 53.97 1639.9086 14 0.2 547.6436 3 80.89 1 53058 BuCaMH03.raw 1.4388E5 1 1 247 260 PEAKS DB
K.INVQSDVK.A N 53.76 901.4869 8 0.2 451.7508 2 17.18 1 3871 BuCaMH03.raw 3.0691E6 1 1 264 271 PEAKS DB
S.C(+57.02)FTLNQR.G N 53.69 937.4440 7 -0.2 469.7292 2 25.79 1 9047 BuCaMH03.raw 1.2157E6 1 1 533 539 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.KPLITDIVAPAIC(+57.02)GNYFVEVGEEC(+57.02)DC(+57.02)GSPR.D Y 53.23 3365.5730 30 -0.6 1122.8643 3 78.25 1 50839 BuCaMH03.raw 1.302E6 1 1 400 429 Carbamidomethylation C13:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00;C26:Carbamidomethylation:1000.00 PEAKS DB
total 21 peptides
T_11
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VSPDAC(+57.02)FSLNHISQGC(+57.02)GFC(+57.02)R.M N 97.28 2310.9932 20 -1.5 1156.5021 2 51.24 1 28545 BuCaMH03.raw 9.4127E7 2 2 202 221 Carbamidomethylation C6:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALWGPGAK.V N 96.95 1885.9178 17 1.0 943.9672 2 61.17 1 36745 BuCaMH03.raw 3.4505E7 2 2 185 201 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.VLDDPDNGMVEPGTK.C N 94.02 1585.7294 15 0.8 793.8726 2 36.89 1 17056 BuCaMH03.raw 3.3063E6 1 1 254 268 PEAKS DB
K.RDEPLYEFSFC(+57.02)SVQEHR.R Y 91.56 2197.9851 17 0.6 733.6694 3 51.10 1 28374 BuCaMH03.raw 6.3865E6 1 1 44 60 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
K.IVLDDPDNGMVEPGTK.C N 86.01 1698.8135 16 0.1 850.4141 2 47.31 1 25449 BuCaMH03.raw 5.6917E7 1 1 253 268 PEAKS DB
V.SPDAC(+57.02)FSLNHISQGC(+57.02)GFC(+57.02)R.M N 80.77 2211.9248 19 -0.3 1106.9694 2 49.02 1 26738 BuCaMH03.raw 1.0185E7 2 2 203 221 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.IVLDDPDNGM(+15.99)VEPGTK.C N 78.87 1714.8083 16 0.3 858.4117 2 47.32 1 25299 BuCaMH03.raw 3.3217E6 2 2 253 268 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
R.DEPLYEFSFC(+57.02)SVQEHR.R Y 73.36 2041.8839 16 0.8 681.6358 3 63.30 1 38612 BuCaMH03.raw 1.1308E6 1 1 45 60 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
P.DAC(+57.02)FSLNHISQGC(+57.02)GFC(+57.02)R.M N 71.16 2027.8400 17 1.5 676.9550 3 50.33 1 27777 BuCaMH03.raw 3.3793E6 1 1 205 221 Carbamidomethylation C3:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.VSPDAC(+57.02)FSLNHISQGC(+57.02)GF.C N 71.10 1994.8615 18 0.0 998.4380 2 63.68 1 38988 BuCaMH03.raw 0 0 0 202 219 Carbamidomethylation C6:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
F.SLNHISQGC(+57.02)GFC(+57.02)R.M N 69.13 1534.6769 13 0.0 512.5662 3 23.17 1 7446 BuCaMH03.raw 6.8367E5 1 1 209 221 Carbamidomethylation C9:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
P.TLTNQC(+57.02)IALWGPGAK.V N 62.29 1628.8345 15 0.1 815.4246 2 57.13 1 33455 BuCaMH03.raw 7.9432E6 1 1 187 201 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 146 153 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 13 peptides
T_81
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.LNLIQFSNMIQC(+57.02)ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 91.32 3930.7600 32 0.0 787.1593 5 63.87 1 39030 BuCaMH03.raw 4.7504E8 3 3 44 75 Carbamidomethylation C12:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
R.PTWHYANYGC(+57.02)YC(+57.02)GK.G Y 84.41 1775.7184 14 0.8 592.9139 3 35.11 1 15457 BuCaMH03.raw 3.4783E8 3 3 62 75 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
W.HYANYGC(+57.02)YC(+57.02)GK.G Y 81.27 1391.5387 11 0.3 696.7769 2 14.14 1 2644 BuCaMH03.raw 2.1221E7 4 4 65 75 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.GGGGTPVDDLDR.C N 78.80 1157.5312 12 -0.3 579.7727 2 27.28 1 10243 BuCaMH03.raw 3.2115E9 2 2 76 87 PEAKS DB
L.NLIQFSNMIQC(+57.02)ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 77.92 3817.6758 31 0.0 955.4262 4 117.13 1 75083 BuCaMH03.raw 2.3113E10 4 4 45 75 Carbamidomethylation C11:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00;C29:Carbamidomethylation:1000.00 PEAKS DB
G.GGGTPVDDLDR.C N 76.90 1100.5098 11 0.1 551.2622 2 27.24 1 10065 BuCaMH03.raw 3.4495E7 1 1 77 87 PEAKS DB
C.ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 75.53 2469.0491 20 0.4 618.2698 4 25.24 1 8842 BuCaMH03.raw 1.5919E7 1 1 56 75 Carbamidomethylation C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
F.SNMIQC(+57.02)ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 73.54 3202.3379 26 -0.1 801.5917 4 33.99 1 14982 BuCaMH03.raw 1.0099E8 1 1 50 75 Carbamidomethylation C6:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
P.TWHYANYGC(+57.02)YC(+57.02)GK.G Y 69.81 1678.6656 13 0.0 840.3401 2 32.26 1 13415 BuCaMH03.raw 3.4421E7 2 2 63 75 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
N.HNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 66.71 2283.9690 18 0.8 762.3309 3 27.71 1 10295 BuCaMH03.raw 1.7431E7 4 4 58 75 Carbamidomethylation C14:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
T.RPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 61.38 1931.8196 15 0.4 483.9623 4 28.24 1 10651 BuCaMH03.raw 1.7436E6 1 1 61 75 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
T.WHYANYGC(+57.02)YC(+57.02)GK.G Y 60.87 1577.6180 12 0.3 789.8165 2 30.69 1 12350 BuCaMH03.raw 4.2298E6 1 1 64 75 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.LNLIQFSNMIQC(+57.02)ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GKGGGGTPVDDLDR.C Y 60.53 5070.2808 44 0.3 1015.0638 5 64.33 1 39517 BuCaMH03.raw 2.074E7 1 1 44 87 Carbamidomethylation C12:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00;C30:Carbamidomethylation:1000.00 PEAKS DB
A.NHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 59.99 2398.0120 19 0.6 800.3451 3 26.35 1 9602 BuCaMH03.raw 3.1191E6 1 1 57 75 Carbamidomethylation C15:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
H.YANYGC(+57.02)YC(+57.02)GK.G N 57.76 1254.4797 10 1.1 628.2479 2 22.28 1 7058 BuCaMH03.raw 3.6803E7 1 1 66 75 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.LNLIQFSNMIQC(+57.02)ANHNTR.P Y 57.52 2173.0520 18 0.9 725.3586 3 66.28 1 41049 BuCaMH03.raw 1.6904E6 1 1 44 61 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
Y.ANYGC(+57.02)YC(+57.02)GK.G N 54.65 1091.4165 9 0.5 546.7158 2 14.01 1 2519 BuCaMH03.raw 4.3578E6 1 1 67 75 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.GGTPVDDLDR.C N 54.58 1043.4883 10 -0.6 522.7511 2 27.32 1 10090 BuCaMH03.raw 4.8161E6 1 1 78 87 PEAKS DB
N.MIQC(+57.02)ANHNTRPTWHYANYGC(+57.02)YC(+57.02)GK.G Y 53.64 3001.2629 24 -0.3 751.3228 4 30.26 1 12339 BuCaMH03.raw 5.4667E7 1 1 52 75 Carbamidomethylation C4:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
total 19 peptides
P15816.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S N 122.18 1790.8080 16 -0.3 896.4110 2 41.38 1 20692 BuCaMH03.raw 1.6329E9 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.PVIEQGC(+57.02)AATC(+57.02)PEFR.S N 93.92 1733.7865 15 0.1 867.9006 2 40.50 1 19840 BuCaMH03.raw 1.1911E6 1 1 57 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
P.VIEQGC(+57.02)AATC(+57.02)PEFR.S N 88.61 1636.7338 14 0.1 819.3742 2 34.87 1 15468 BuCaMH03.raw 2.1479E9 2 2 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.SLLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 82.48 1493.5698 12 0.1 747.7922 2 27.93 1 10590 BuCaMH03.raw 1.9154E9 2 2 76 87 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)AATC(+57.02)PEFR.S N 73.44 1537.6653 13 0.2 769.8401 2 30.10 1 12233 BuCaMH03.raw 5.1231E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
I.EQGC(+57.02)AATC(+57.02)PEFR.S N 67.86 1424.5813 12 0.6 713.2983 2 25.26 1 8777 BuCaMH03.raw 7.8103E6 1 1 60 71 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
V.SC(+57.02)EQFC(+57.02)PIR.G Y 56.95 1195.5114 9 0.1 598.7630 2 31.99 1 13537 BuCaMH03.raw 1.6077E9 1 1 47 55 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
Q.GC(+57.02)AATC(+57.02)PEFR.S N 56.90 1167.4801 10 1.2 584.7480 2 22.89 1 7277 BuCaMH03.raw 5.054E5 1 1 62 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
F.C(+57.02)PIRGPVIEQGC(+57.02)AATC(+57.02)PEFR.S N 54.87 2317.0764 20 2.5 773.3680 3 59.71 1 35597 BuCaMH03.raw 1.0593E6 1 1 52 71 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
S.LLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 54.64 1406.5377 11 0.0 704.2761 2 19.18 1 5296 BuCaMH03.raw 2.3152E7 1 1 77 87 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 10 peptides
CAA35774.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.GPVIEQGC(+57.02)AATC(+57.02)PEFR.S N 122.18 1790.8080 16 -0.3 896.4110 2 41.38 1 20692 BuCaMH03.raw 1.6329E9 1 1 56 71 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.PVIEQGC(+57.02)AATC(+57.02)PEFR.S N 93.92 1733.7865 15 0.1 867.9006 2 40.50 1 19840 BuCaMH03.raw 1.1911E6 1 1 57 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
P.VIEQGC(+57.02)AATC(+57.02)PEFR.S N 88.61 1636.7338 14 0.1 819.3742 2 34.87 1 15468 BuCaMH03.raw 2.1479E9 2 2 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.SLLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 82.48 1493.5698 12 0.1 747.7922 2 27.93 1 10590 BuCaMH03.raw 1.9154E9 2 2 76 87 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)AATC(+57.02)PEFR.S N 73.44 1537.6653 13 0.2 769.8401 2 30.10 1 12233 BuCaMH03.raw 5.1231E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
I.EQGC(+57.02)AATC(+57.02)PEFR.S N 67.86 1424.5813 12 0.6 713.2983 2 25.26 1 8777 BuCaMH03.raw 7.8103E6 1 1 60 71 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
V.SC(+57.02)EQFC(+57.02)PIR.G Y 56.95 1195.5114 9 0.1 598.7630 2 31.99 1 13537 BuCaMH03.raw 1.6077E9 1 1 47 55 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
Q.GC(+57.02)AATC(+57.02)PEFR.S N 56.90 1167.4801 10 1.2 584.7480 2 22.89 1 7277 BuCaMH03.raw 5.054E5 1 1 62 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
F.C(+57.02)PIRGPVIEQGC(+57.02)AATC(+57.02)PEFR.S N 54.87 2317.0764 20 2.5 773.3680 3 59.71 1 35597 BuCaMH03.raw 1.0593E6 1 1 52 71 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
S.LLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 54.64 1406.5377 11 0.0 704.2761 2 19.18 1 5296 BuCaMH03.raw 2.3152E7 1 1 77 87 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 10 peptides
T_111
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HSDSNAFLHLFPDSFR.I N 95.96 1888.8856 16 0.0 473.2287 4 62.79 1 38132 BuCaMH03.raw 1.8811E7 2 2 398 413 PEAKS DB
K.TFHGLGVIDWENWRPQWDR.N N 82.43 2411.1560 19 0.2 804.7261 3 72.59 1 46304 BuCaMH03.raw 4.6736E7 2 2 143 161 PEAKS DB
R.KHSDSNAFLHLFPDSFR.I N 79.67 2016.9806 17 -0.3 505.2523 4 55.38 1 31919 BuCaMH03.raw 9.1159E6 2 2 397 413 PEAKS DB
S.DSNAFLHLFPDSFR.I N 77.76 1664.7947 14 -0.3 555.9387 3 76.68 1 49658 BuCaMH03.raw 9.9155E5 1 1 400 413 PEAKS DB
R.PGGYWGYYLYPDC(+57.02)YNYNYK.K N 76.63 2455.0256 19 0.5 1228.5208 2 75.00 1 48496 BuCaMH03.raw 1.505E7 1 1 217 235 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.TFHGLGVIDWENWR.P N 73.74 1728.8372 14 0.7 577.2867 3 70.27 1 44786 BuCaMH03.raw 1.9216E7 2 2 143 156 PEAKS DB
T.FHGLGVIDWENWRPQWDR.N N 72.06 2310.1082 18 0.7 578.5347 4 72.04 1 45863 BuCaMH03.raw 8.7408E5 1 1 144 161 PEAKS DB
R.NDQLLWLWR.D N 63.60 1242.6509 9 0.8 622.3332 2 79.40 1 51700 BuCaMH03.raw 5.3353E7 1 1 253 261 PEAKS DB
K.C(+57.02)PNIEISR.N N 60.84 987.4808 8 0.7 494.7480 2 26.63 1 9851 BuCaMH03.raw 7.2279E6 1 1 245 252 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.QLHPQLSEAAIK.R Y 60.71 1333.7354 12 0.4 667.8752 2 28.11 1 10546 BuCaMH03.raw 2.4195E6 1 1 179 190 PEAKS DB
H.SDSNAFLHLFPDSFR.I N 59.37 1751.8267 15 0.6 584.9498 3 72.39 1 46085 BuCaMH03.raw 4.6921E6 1 1 399 413 PEAKS DB
K.GLYC(+57.02)EEHYK.K Y 58.66 1197.5125 9 1.8 599.7646 2 15.62 1 3255 BuCaMH03.raw 0 0 0 453 461 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.IC(+57.02)SHYLC(+57.02)K.R Y 56.16 1079.4893 8 0.4 540.7521 2 12.67 1 1954 BuCaMH03.raw 4.476E5 1 1 382 389 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.QLHPQLSEAAIKR.L Y 54.60 1489.8364 13 0.5 497.6197 3 21.94 1 6625 BuCaMH03.raw 1.7007E6 1 1 179 191 PEAKS DB
F.HGLGVIDWENWRPQWDR.N N 54.37 2163.0398 17 1.0 541.7678 4 67.50 1 42023 BuCaMH03.raw 1.0462E6 1 1 145 161 PEAKS DB
P.MYPNEPFLVFWNAPTTQC(+57.02)QMR.Y Y 53.83 2629.1917 21 0.9 1315.6042 2 88.26 1 58806 BuCaMH03.raw 6.7175E6 1 1 48 68 Carbamidomethylation C18:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
T_144
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VLLPSFLAAGGDGYYMLR.G Y 88.95 1942.0022 18 0.4 972.0088 2 88.51 1 59043 BuCaMH03.raw 7.3409E6 2 2 510 527 PEAKS DB
K.YLGYLNVIFDDK.G N 79.95 1458.7394 12 0.2 730.3771 2 80.21 1 52452 BuCaMH03.raw 3.1502E6 1 1 300 311 PEAKS DB
R.HGQGSGELLQVSGIK.V N 77.18 1508.7947 15 -0.2 755.4045 2 35.50 1 15903 BuCaMH03.raw 9.0487E5 1 1 457 471 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFK.G N 77.09 2490.2219 21 0.7 1246.1191 2 98.05 1 66828 BuCaMH03.raw 1.3741E5 1 1 91 111 PEAKS DB
R.VPTYVPLEMEK.T N 71.52 1304.6686 11 0.5 653.3419 2 52.81 1 29825 BuCaMH03.raw 1.5662E6 1 1 496 506 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 70.15 2420.1365 20 0.4 807.7197 3 72.44 1 46256 BuCaMH03.raw 6.1847E6 1 1 369 388 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.GDSSNHNSGDLDISIVSDYIK.R Y 69.90 2235.0291 21 -0.3 1118.5215 2 65.18 1 40220 BuCaMH03.raw 4.3844E5 1 1 528 548 PEAKS DB
R.EVVQFMNSLR.Y N 58.75 1221.6176 10 0.6 611.8164 2 55.10 1 31782 BuCaMH03.raw 3.5633E6 1 1 114 123 PEAKS DB
R.YDAMALGNHEFDNGLNGLLDPLLK.N N 58.04 2629.2847 24 1.2 877.4366 3 86.36 1 57223 BuCaMH03.raw 1.9298E7 1 1 124 147 PEAKS DB
K.ISGYILPYK.I N 57.37 1052.5906 9 0.8 527.3030 2 49.87 1 27392 BuCaMH03.raw 3.3176E5 1 1 168 176 PEAKS DB
V.LLPSFLAAGGDGYYMLR.G Y 55.79 1842.9338 17 0.3 922.4744 2 82.64 1 54460 BuCaMH03.raw 7.3139E5 1 1 511 527 PEAKS DB
K.VVYDLSQKPGK.R N 54.90 1232.6764 11 0.7 411.8997 3 21.73 1 6594 BuCaMH03.raw 0 0 0 472 482 PEAKS DB
K.YLGYLNVIFDDKGK.V N 53.57 1643.8558 14 1.1 548.9598 3 67.37 1 41965 BuCaMH03.raw 3.7401E5 1 1 300 313 PEAKS DB
total 13 peptides
T_146
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VLLPSFLAAGGDGYYMLR.G Y 88.95 1942.0022 18 0.4 972.0088 2 88.51 1 59043 BuCaMH03.raw 7.3409E6 2 2 510 527 PEAKS DB
K.YLGYLNVIFDDK.G N 79.95 1458.7394 12 0.2 730.3771 2 80.21 1 52452 BuCaMH03.raw 3.1502E6 1 1 300 311 PEAKS DB
R.HGQGSGELLQVSGIK.V N 77.18 1508.7947 15 -0.2 755.4045 2 35.50 1 15903 BuCaMH03.raw 9.0487E5 1 1 457 471 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFK.G N 77.09 2490.2219 21 0.7 1246.1191 2 98.05 1 66828 BuCaMH03.raw 1.3741E5 1 1 91 111 PEAKS DB
R.VPTYVPLEMEK.T N 71.52 1304.6686 11 0.5 653.3419 2 52.81 1 29825 BuCaMH03.raw 1.5662E6 1 1 496 506 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 70.15 2420.1365 20 0.4 807.7197 3 72.44 1 46256 BuCaMH03.raw 6.1847E6 1 1 369 388 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.GDSSNHNSGDLDISIVSDYIK.R Y 69.90 2235.0291 21 -0.3 1118.5215 2 65.18 1 40220 BuCaMH03.raw 4.3844E5 1 1 528 548 PEAKS DB
R.EVVQFMNSLR.Y N 58.75 1221.6176 10 0.6 611.8164 2 55.10 1 31782 BuCaMH03.raw 3.5633E6 1 1 114 123 PEAKS DB
R.YDAMALGNHEFDNGLNGLLDPLLK.N N 58.04 2629.2847 24 1.2 877.4366 3 86.36 1 57223 BuCaMH03.raw 1.9298E7 1 1 124 147 PEAKS DB
K.ISGYILPYK.I N 57.37 1052.5906 9 0.8 527.3030 2 49.87 1 27392 BuCaMH03.raw 3.3176E5 1 1 168 176 PEAKS DB
V.LLPSFLAAGGDGYYMLR.G Y 55.79 1842.9338 17 0.3 922.4744 2 82.64 1 54460 BuCaMH03.raw 7.3139E5 1 1 511 527 PEAKS DB
K.VVYDLSQKPGK.R N 54.90 1232.6764 11 0.7 411.8997 3 21.73 1 6594 BuCaMH03.raw 0 0 0 472 482 PEAKS DB
K.YLGYLNVIFDDKGK.V N 53.57 1643.8558 14 1.1 548.9598 3 67.37 1 41965 BuCaMH03.raw 3.7401E5 1 1 300 313 PEAKS DB
total 13 peptides
T_147
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VLLPSFLAAGGDGYYMLR.G Y 88.95 1942.0022 18 0.4 972.0088 2 88.51 1 59043 BuCaMH03.raw 7.3409E6 2 2 510 527 PEAKS DB
K.YLGYLNVIFDDK.G N 79.95 1458.7394 12 0.2 730.3771 2 80.21 1 52452 BuCaMH03.raw 3.1502E6 1 1 300 311 PEAKS DB
R.HGQGSGELLQVSGIK.V N 77.18 1508.7947 15 -0.2 755.4045 2 35.50 1 15903 BuCaMH03.raw 9.0487E5 1 1 457 471 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFK.G N 77.09 2490.2219 21 0.7 1246.1191 2 98.05 1 66828 BuCaMH03.raw 1.3741E5 1 1 91 111 PEAKS DB
R.VPTYVPLEMEK.T N 71.52 1304.6686 11 0.5 653.3419 2 52.81 1 29825 BuCaMH03.raw 1.5662E6 1 1 496 506 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 70.15 2420.1365 20 0.4 807.7197 3 72.44 1 46256 BuCaMH03.raw 6.1847E6 1 1 369 388 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.GDSSNHNSGDLDISIVSDYIK.R Y 69.90 2235.0291 21 -0.3 1118.5215 2 65.18 1 40220 BuCaMH03.raw 4.3844E5 1 1 528 548 PEAKS DB
R.EVVQFMNSLR.Y N 58.75 1221.6176 10 0.6 611.8164 2 55.10 1 31782 BuCaMH03.raw 3.5633E6 1 1 114 123 PEAKS DB
R.YDAMALGNHEFDNGLNGLLDPLLK.N N 58.04 2629.2847 24 1.2 877.4366 3 86.36 1 57223 BuCaMH03.raw 1.9298E7 1 1 124 147 PEAKS DB
K.ISGYILPYK.I N 57.37 1052.5906 9 0.8 527.3030 2 49.87 1 27392 BuCaMH03.raw 3.3176E5 1 1 168 176 PEAKS DB
V.LLPSFLAAGGDGYYMLR.G Y 55.79 1842.9338 17 0.3 922.4744 2 82.64 1 54460 BuCaMH03.raw 7.3139E5 1 1 511 527 PEAKS DB
K.VVYDLSQKPGK.R N 54.90 1232.6764 11 0.7 411.8997 3 21.73 1 6594 BuCaMH03.raw 0 0 0 472 482 PEAKS DB
K.YLGYLNVIFDDKGK.V N 53.57 1643.8558 14 1.1 548.9598 3 67.37 1 41965 BuCaMH03.raw 3.7401E5 1 1 300 313 PEAKS DB
total 13 peptides
T_143
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VLLPSFLAAGGDGYYMLR.G Y 88.95 1942.0022 18 0.4 972.0088 2 88.51 1 59043 BuCaMH03.raw 7.3409E6 2 2 510 527 PEAKS DB
K.YLGYLNVIFDDK.G N 79.95 1458.7394 12 0.2 730.3771 2 80.21 1 52452 BuCaMH03.raw 3.1502E6 1 1 300 311 PEAKS DB
R.HGQGSGELLQVSGIK.V N 77.18 1508.7947 15 -0.2 755.4045 2 35.50 1 15903 BuCaMH03.raw 9.0487E5 1 1 457 471 PEAKS DB
R.NVLLLDAGDQYQGTVWFNYFK.G N 77.09 2490.2219 21 0.7 1246.1191 2 98.05 1 66828 BuCaMH03.raw 1.3741E5 1 1 91 111 PEAKS DB
R.VPTYVPLEMEK.T N 71.52 1304.6686 11 0.5 653.3419 2 52.81 1 29825 BuCaMH03.raw 1.5662E6 1 1 496 506 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 70.15 2420.1365 20 0.4 807.7197 3 72.44 1 46256 BuCaMH03.raw 6.1847E6 1 1 369 388 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.GDSSNHNSGDLDISIVSDYIK.R Y 69.90 2235.0291 21 -0.3 1118.5215 2 65.18 1 40220 BuCaMH03.raw 4.3844E5 1 1 528 548 PEAKS DB
R.EVVQFMNSLR.Y N 58.75 1221.6176 10 0.6 611.8164 2 55.10 1 31782 BuCaMH03.raw 3.5633E6 1 1 114 123 PEAKS DB
R.YDAMALGNHEFDNGLNGLLDPLLK.N N 58.04 2629.2847 24 1.2 877.4366 3 86.36 1 57223 BuCaMH03.raw 1.9298E7 1 1 124 147 PEAKS DB
K.ISGYILPYK.I N 57.37 1052.5906 9 0.8 527.3030 2 49.87 1 27392 BuCaMH03.raw 3.3176E5 1 1 168 176 PEAKS DB
V.LLPSFLAAGGDGYYMLR.G Y 55.79 1842.9338 17 0.3 922.4744 2 82.64 1 54460 BuCaMH03.raw 7.3139E5 1 1 511 527 PEAKS DB
K.VVYDLSQKPGK.R N 54.90 1232.6764 11 0.7 411.8997 3 21.73 1 6594 BuCaMH03.raw 0 0 0 472 482 PEAKS DB
K.YLGYLNVIFDDKGK.V N 53.57 1643.8558 14 1.1 548.9598 3 67.37 1 41965 BuCaMH03.raw 3.7401E5 1 1 300 313 PEAKS DB
total 13 peptides
0402253A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEKK.H N 96.62 1917.7444 15 -0.1 959.8794 2 12.59 1 1877 BuCaMH03.raw 1.3627E8 3 3 44 58 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.K N 90.97 1789.6494 14 -0.2 895.8318 2 17.70 1 4370 BuCaMH03.raw 2.9791E8 4 4 44 57 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEM(+15.99)IR.Y N 78.21 1295.6366 10 -0.2 648.8254 2 78.80 1 54312 BuCaMH03.raw 4.9087E8 4 4 1 10 Oxidation (M) M8:Oxidation (M):52.04 PEAKS DB
NLINFM(+15.99)EMIR.Y N 74.92 1295.6366 10 0.0 648.8256 2 67.65 1 42306 BuCaMH03.raw 3.5844E8 3 3 1 10 Oxidation (M) M6:Oxidation (M):32.28 PEAKS DB
NLINFM(+15.99)EM(+15.99)IR.Y N 74.44 1311.6315 10 0.7 656.8235 2 83.18 1 54954 BuCaMH03.raw 8.4715E6 1 1 1 10 Oxidation (M) M6:Oxidation (M):1000.00;M8:Oxidation (M):1000.00 PEAKS DB
C.C(+57.02)YVHDNC(+57.02)YGDAEK.K N 73.17 1629.6188 13 -0.3 544.2134 3 14.86 1 2919 BuCaMH03.raw 1.0574E7 2 2 45 57 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEMIR.Y N 73.01 1279.6417 10 0.6 640.8285 2 88.88 1 59453 BuCaMH03.raw 1.4319E10 1 1 1 10 PEAKS DB
C.YVHDNC(+57.02)YGDAEK.K N 69.88 1469.5881 12 0.7 735.8019 2 12.57 1 1878 BuCaMH03.raw 7.7179E6 2 2 46 57 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEMIRYTIPC(+57.02)EK.T N 61.55 2171.0576 17 0.4 724.6934 3 87.62 1 58648 BuCaMH03.raw 5.837E7 2 2 1 17 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGGTC(+57.02)R.I Y 60.68 1398.6384 13 -0.2 700.3264 2 37.66 1 17679 BuCaMH03.raw 0 0 0 76 88 Carbamidomethylation C4:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)YVHDNC(+57.02)YGDAEKK.H N 60.63 1757.7137 14 -0.5 586.9116 3 12.57 1 1871 BuCaMH03.raw 2.5293E6 1 1 45 58 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.49 1181.5936 9 0.4 591.8043 2 64.15 1 39326 BuCaMH03.raw 1.3572E6 1 1 2 10 Oxidation (M) M5:Oxidation (M):36.05 PEAKS DB
N.LINFMEMIR.Y N 56.00 1165.5988 9 0.3 583.8068 2 78.38 1 51198 BuCaMH03.raw 3.6549E8 1 1 2 10 PEAKS DB
N.LINFMEM(+15.99)IR.Y N 55.71 1181.5936 9 -0.6 591.8037 2 78.37 1 50945 BuCaMH03.raw 5.8354E6 2 2 2 10 Oxidation (M) M7:Oxidation (M):36.05 PEAKS DB
R.YTIPC(+57.02)EK.T N 54.55 909.4266 7 0.4 455.7207 2 24.68 1 8545 BuCaMH03.raw 6.5047E8 1 1 11 17 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 15 peptides
0412250A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEKK.H N 96.62 1917.7444 15 -0.1 959.8794 2 12.59 1 1877 BuCaMH03.raw 1.3627E8 3 3 44 58 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)YVHDNC(+57.02)YGDAEK.K N 90.97 1789.6494 14 -0.2 895.8318 2 17.70 1 4370 BuCaMH03.raw 2.9791E8 4 4 44 57 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEM(+15.99)IR.Y N 78.21 1295.6366 10 -0.2 648.8254 2 78.80 1 54312 BuCaMH03.raw 4.9087E8 4 4 1 10 Oxidation (M) M8:Oxidation (M):52.04 PEAKS DB
NLINFM(+15.99)EMIR.Y N 74.92 1295.6366 10 0.0 648.8256 2 67.65 1 42306 BuCaMH03.raw 3.5844E8 3 3 1 10 Oxidation (M) M6:Oxidation (M):32.28 PEAKS DB
NLINFM(+15.99)EM(+15.99)IR.Y N 74.44 1311.6315 10 0.7 656.8235 2 83.18 1 54954 BuCaMH03.raw 8.4715E6 1 1 1 10 Oxidation (M) M6:Oxidation (M):1000.00;M8:Oxidation (M):1000.00 PEAKS DB
C.C(+57.02)YVHDNC(+57.02)YGDAEK.K N 73.17 1629.6188 13 -0.3 544.2134 3 14.86 1 2919 BuCaMH03.raw 1.0574E7 2 2 45 57 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEMIR.Y N 73.01 1279.6417 10 0.6 640.8285 2 88.88 1 59453 BuCaMH03.raw 1.4319E10 1 1 1 10 PEAKS DB
C.YVHDNC(+57.02)YGDAEK.K N 69.88 1469.5881 12 0.7 735.8019 2 12.57 1 1878 BuCaMH03.raw 7.7179E6 2 2 46 57 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
NLINFMEMIRYTIPC(+57.02)EK.T N 61.55 2171.0576 17 0.4 724.6934 3 87.62 1 58648 BuCaMH03.raw 5.837E7 2 2 1 17 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
R.TIIC(+57.02)YGAAGGTC(+57.02)R.I Y 60.68 1398.6384 13 -0.2 700.3264 2 37.66 1 17679 BuCaMH03.raw 0 0 0 76 88 Carbamidomethylation C4:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)YVHDNC(+57.02)YGDAEKK.H N 60.63 1757.7137 14 -0.5 586.9116 3 12.57 1 1871 BuCaMH03.raw 2.5293E6 1 1 45 58 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.LINFM(+15.99)EMIR.Y N 56.49 1181.5936 9 0.4 591.8043 2 64.15 1 39326 BuCaMH03.raw 1.3572E6 1 1 2 10 Oxidation (M) M5:Oxidation (M):36.05 PEAKS DB
N.LINFMEMIR.Y N 56.00 1165.5988 9 0.3 583.8068 2 78.38 1 51198 BuCaMH03.raw 3.6549E8 1 1 2 10 PEAKS DB
N.LINFMEM(+15.99)IR.Y N 55.71 1181.5936 9 -0.6 591.8037 2 78.37 1 50945 BuCaMH03.raw 5.8354E6 2 2 2 10 Oxidation (M) M7:Oxidation (M):36.05 PEAKS DB
R.YTIPC(+57.02)EK.T N 54.55 909.4266 7 0.4 455.7207 2 24.68 1 8545 BuCaMH03.raw 6.5047E8 1 1 11 17 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 15 peptides
T_12
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
I.VLGDPDNGMVEPGTK.C Y 90.53 1527.7239 15 0.2 764.8694 2 37.98 1 17950 BuCaMH03.raw 3.0399E6 1 1 164 178 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IDLWGPGAK.E Y 86.02 1929.9077 17 -0.8 965.9603 2 83.33 1 55002 BuCaMH03.raw 2.3497E7 3 3 95 111 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.ESPDTC(+57.02)FLLNHISQGC(+57.02)GFC(+57.02)R.M Y 85.77 2397.0300 20 1.2 800.0182 3 60.59 1 36289 BuCaMH03.raw 4.5929E7 1 1 112 131 Carbamidomethylation C6:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.IVLGDPDNGMVEPGTK.C Y 82.84 1640.8080 16 0.3 821.4115 2 47.44 1 25271 BuCaMH03.raw 2.0532E7 1 1 163 178 PEAKS DB
K.IVLGDPDNGM(+15.99)VEPGTK.C Y 81.83 1656.8029 16 0.6 829.4092 2 47.47 1 25344 BuCaMH03.raw 1.1917E6 1 1 163 178 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
P.DTC(+57.02)FLLNHISQGC(+57.02)GFC(+57.02)R.M Y 76.61 2083.9026 17 0.1 695.6415 3 59.22 1 35196 BuCaMH03.raw 5.8212E5 1 1 115 131 Carbamidomethylation C3:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
E.SPDTC(+57.02)FLLNHISQGC(+57.02)GFC(+57.02)R.M Y 68.48 2267.9873 19 -0.1 757.0030 3 58.69 1 34768 BuCaMH03.raw 2.3221E6 1 1 113 131 Carbamidomethylation C5:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 56 63 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
XP_026559083.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.EVALDMSQFENIAVR.R N 103.31 1720.8453 15 0.1 861.4301 2 73.22 1 46870 BuCaMH03.raw 8.4278E5 1 1 207 221 PEAKS DB
R.LSALKDFVSVLVQHFAGR.L N 99.00 1986.1050 18 0.5 663.0426 3 87.38 1 58049 BuCaMH03.raw 6.5502E6 2 2 333 350 PEAKS DB
I.YMADIESAVLYSLR.I N 60.87 1629.8073 14 0.2 815.9111 2 81.59 1 53679 BuCaMH03.raw 5.1598E5 1 1 306 319 PEAKS DB
K.IYMADIESAVLYSLR.I N 59.73 1742.8912 15 0.4 872.4532 2 90.36 1 60545 BuCaMH03.raw 7.4102E5 1 1 305 319 PEAKS DB
K.AFAPLWK.G Y 54.26 831.4643 7 -0.5 416.7392 2 52.75 1 29875 BuCaMH03.raw 4.7046E3 1 1 79 85 PEAKS DB
total 5 peptides
T_16
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.DRPPC(+57.02)ILNKPLSK.N Y 83.20 1536.8446 13 -1.0 385.2180 4 25.81 1 9117 BuCaMH03.raw 5.7608E7 2 2 108 120 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.LMYESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 78.99 2881.2283 24 -0.2 961.4165 3 39.09 1 18706 BuCaMH03.raw 1.8302E7 2 2 80 103 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
L.MYESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 75.75 2768.1443 23 -0.6 693.0429 4 32.28 1 13474 BuCaMH03.raw 2.6278E7 2 2 81 103 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
K.KSVAVVQDYSK.R N 75.23 1222.6558 11 -0.2 612.3350 2 15.59 1 3167 BuCaMH03.raw 4.4932E6 2 2 36 46 PEAKS DB
M.YESISDEPHSEFSSC(+57.02)SVQEHQR.Y N 60.65 2637.1038 22 0.9 660.2838 4 28.14 1 10623 BuCaMH03.raw 8.8375E5 1 1 82 103 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
K.SVAVVQDYSK.R N 60.55 1094.5608 10 -0.5 548.2874 2 26.31 1 9703 BuCaMH03.raw 3.8359E7 1 1 37 46 PEAKS DB
K.DDC(+57.02)DLPER.C N 56.58 1018.4025 8 0.5 510.2088 2 20.35 1 5679 BuCaMH03.raw 2.5284E6 1 1 188 195 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 7 peptides
CAP74383.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.C(+57.02)IEFSYGGC(+57.02)GGNANNFK.S Y 109.55 1893.7773 17 0.5 947.8964 2 48.13 1 25971 BuCaMH03.raw 2.7802E9 12 12 56 72 Carbamidomethylation C1:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
F.SYGGC(+57.02)GGNANNFK.S Y 87.30 1344.5516 13 0.5 673.2834 2 16.40 1 3550 BuCaMH03.raw 2.5827E7 1 1 60 72 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.IEFSYGGC(+57.02)GGNANNFK.S Y 83.14 1733.7467 16 0.1 867.8807 2 45.39 1 23967 BuCaMH03.raw 8.889E7 2 2 57 72 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
S.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
B4ESA4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.C(+57.02)IEFSYGGC(+57.02)GGNANNFK.S Y 109.55 1893.7773 17 0.5 947.8964 2 48.13 1 25971 BuCaMH03.raw 2.7802E9 12 12 56 72 Carbamidomethylation C1:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
F.SYGGC(+57.02)GGNANNFK.S Y 87.30 1344.5516 13 0.5 673.2834 2 16.40 1 3550 BuCaMH03.raw 2.5827E7 1 1 60 72 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.IEFSYGGC(+57.02)GGNANNFK.S Y 83.14 1733.7467 16 0.1 867.8807 2 45.39 1 23967 BuCaMH03.raw 8.889E7 2 2 57 72 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
S.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_026571757.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.NGPVEGAFTVYSDFLMYK.S Y 96.86 2036.9553 18 0.2 1019.4852 2 87.81 1 58471 BuCaMH03.raw 5.2409E6 1 1 247 264 PEAKS DB
R.FEFAGDLVLPQNFDSR.Q Y 88.64 1853.8948 16 0.5 927.9551 2 79.13 1 51518 BuCaMH03.raw 1.5339E7 1 1 72 87 PEAKS DB
K.GLVSGGLYDSHVGC(+57.02)RPY.S Y 64.27 1835.8624 17 0.2 612.9615 3 43.97 1 22620 BuCaMH03.raw 8.6384E5 1 1 166 182 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.DQGSC(+57.02)GSC(+57.02)WAFGAVEAMSDR.V Y 59.94 2189.8564 20 0.3 1095.9358 2 73.83 1 47278 BuCaMH03.raw 1.5931E6 1 1 101 120 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
L.C(+57.02)GTFLHGPK.L Y 56.81 1015.4909 9 0.3 508.7529 2 17.26 1 3956 BuCaMH03.raw 2.5885E5 1 1 59 67 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026555793.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.MQIWLMHDIGGPQR.E Y 87.05 1680.8229 14 0.2 841.4189 2 59.44 1 35311 BuCaMH03.raw 2.1166E7 2 2 241 254 PEAKS DB
K.SSIFGSVEIVNLNPEK.V N 79.12 1731.9043 16 2.2 866.9613 2 72.81 1 46448 BuCaMH03.raw 4.2647E7 1 1 222 237 PEAKS DB
M.QIWLMHDIGGPQR.E Y 76.99 1549.7823 13 0.1 775.8986 2 51.22 1 28527 BuCaMH03.raw 1.7276E7 2 2 242 254 PEAKS DB
R.KSSIFGSVEIVNLNPEK.V N 70.79 1859.9993 17 1.1 931.0079 2 59.81 1 35636 BuCaMH03.raw 2.1478E6 1 1 221 237 PEAKS DB
R.ETC(+57.02)TGHSIAQLR.E Y 61.00 1371.6565 12 0.9 458.2265 3 18.72 1 4728 BuCaMH03.raw 1.1618E7 2 2 255 266 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Q.IWLMHDIGGPQR.E Y 59.67 1421.7238 12 -0.7 474.9149 3 49.30 1 26852 BuCaMH03.raw 2.4159E6 1 1 243 254 PEAKS DB
E.TC(+57.02)TGHSIAQLR.E Y 56.92 1242.6139 11 -0.6 415.2117 3 14.86 1 3039 BuCaMH03.raw 1.9581E6 1 1 256 266 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)TGHSIAQLR.E N 53.80 1141.5662 10 -0.1 381.5293 3 12.93 1 2105 BuCaMH03.raw 6.8899E4 1 1 257 266 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
AAL30054.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.VIEQGC(+57.02)VATC(+57.02)PQFR.S Y 82.95 1663.7810 14 0.4 832.8981 2 37.98 1 18196 BuCaMH03.raw 8.891E7 1 1 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.SLLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 82.48 1493.5698 12 0.1 747.7922 2 27.93 1 10590 BuCaMH03.raw 1.9154E9 2 2 76 87 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.TC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 74.64 2637.2236 23 0.3 1319.6195 2 62.25 1 37664 BuCaMH03.raw 1.5001E8 2 2 23 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)VATC(+57.02)PQFR.S Y 74.26 1564.7126 13 -0.6 783.3632 2 34.05 1 14772 BuCaMH03.raw 1.3902E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.RTC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 60.08 2793.3247 24 0.1 932.1156 3 52.60 1 29613 BuCaMH03.raw 1.7261E8 1 1 22 45 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
L.ISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 58.97 2263.0613 20 -0.5 1132.5374 2 52.19 1 29233 BuCaMH03.raw 1.7471E7 2 2 26 45 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
C.LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 54.83 2376.1453 21 0.1 793.0558 3 58.09 1 34215 BuCaMH03.raw 2.684E6 1 1 25 45 Carbamidomethylation C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
S.LLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 54.64 1406.5377 11 0.0 704.2761 2 19.18 1 5296 BuCaMH03.raw 2.3152E7 1 1 77 87 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
Q8AY56.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.VIEQGC(+57.02)VATC(+57.02)PQFR.S Y 82.95 1663.7810 14 0.4 832.8981 2 37.98 1 18196 BuCaMH03.raw 8.891E7 1 1 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.SLLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 82.48 1493.5698 12 0.1 747.7922 2 27.93 1 10590 BuCaMH03.raw 1.9154E9 2 2 76 87 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.TC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 74.64 2637.2236 23 0.3 1319.6195 2 62.25 1 37664 BuCaMH03.raw 1.5001E8 2 2 23 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)VATC(+57.02)PQFR.S Y 74.26 1564.7126 13 -0.6 783.3632 2 34.05 1 14772 BuCaMH03.raw 1.3902E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.RTC(+57.02)LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 60.08 2793.3247 24 0.1 932.1156 3 52.60 1 29613 BuCaMH03.raw 1.7261E8 1 1 22 45 Carbamidomethylation C3:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
L.ISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 58.97 2263.0613 20 -0.5 1132.5374 2 52.19 1 29233 BuCaMH03.raw 1.7471E7 2 2 26 45 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
C.LISPSSTPQTC(+57.02)PQGQDIC(+57.02)FLK.A Y 54.83 2376.1453 21 0.1 793.0558 3 58.09 1 34215 BuCaMH03.raw 2.684E6 1 1 25 45 Carbamidomethylation C11:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
S.LLC(+57.02)C(+57.02)TTDNC(+57.02)NH N 54.64 1406.5377 11 0.0 704.2761 2 19.18 1 5296 BuCaMH03.raw 2.3152E7 1 1 77 87 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 8 peptides
ETE59846.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.FVNANQETISHIVK.V N 82.82 1598.8417 14 0.4 800.4284 2 36.65 1 16914 BuCaMH03.raw 2.325E6 1 1 222 235 PEAKS DB
K.LIDLELLHKYEELLEK.C Y 77.85 1997.1084 16 -0.2 666.7100 3 79.40 1 51813 BuCaMH03.raw 1.9868E6 1 1 343 358 PEAKS DB
L.IDLELLHKYEELLEK.C Y 65.17 1884.0244 15 0.8 629.0159 3 74.42 1 47774 BuCaMH03.raw 4.1076E6 1 1 344 358 PEAKS DB
K.ESFLFTLTR.N N 64.62 1112.5865 9 -0.5 557.3003 2 68.54 1 42869 BuCaMH03.raw 3.8022E6 1 1 327 335 PEAKS DB
R.DDYKESFLFTLTR.N N 56.79 1633.7987 13 0.3 817.9069 2 68.43 1 42961 BuCaMH03.raw 1.9548E6 2 2 323 335 PEAKS DB
K.DAISSNVGHC(+57.02)C(+57.02)EK.P Y 56.12 1475.6133 13 0.2 738.8141 2 12.77 1 2024 BuCaMH03.raw 0 0 0 268 280 Carbamidomethylation C10:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.GDSVEVLVDR.A Y 55.99 1087.5509 10 -0.2 544.7826 2 40.00 1 19317 BuCaMH03.raw 7.8771E5 1 1 247 256 PEAKS DB
K.YGINDC(+57.02)C(+57.02)AK.A N 55.32 1099.4426 9 1.3 550.7293 2 18.90 1 4831 BuCaMH03.raw 6.6309E5 1 1 112 120 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)NLDSNHQVSC(+57.02)ALENTDK.V Y 55.15 2263.9255 19 0.7 755.6497 3 29.16 1 11233 BuCaMH03.raw 1.3055E6 1 1 436 454 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
XP_034296605.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.LQWLMDQALQGDIIK.T N 76.36 1770.9338 15 0.5 886.4746 2 80.09 1 52433 BuCaMH03.raw 3.2396E5 1 1 799 813 PEAKS DB
R.NPYGYQLAWK.F N 70.15 1238.6084 10 -0.7 620.3110 2 51.24 1 28651 BuCaMH03.raw 8.0714E5 1 1 827 836 PEAKS DB
K.ALDLTLYLK.H N 65.37 1048.6168 9 -0.1 525.3156 2 69.67 1 43911 BuCaMH03.raw 1.2666E6 1 1 642 650 PEAKS DB
A.SLINNVFQLVSAGK.L Y 65.06 1488.8300 14 0.8 745.4229 2 84.21 1 55425 BuCaMH03.raw 1.3683E6 1 1 623 636 PEAKS DB
K.QDLAAIPDFQSGAMENWGLTTYR.E N 64.54 2583.2063 23 1.3 862.0771 3 83.98 1 55332 BuCaMH03.raw 9.1463E5 1 1 291 313 PEAKS DB
R.VLASTQFEPTAAR.M N 61.32 1389.7252 13 0.6 695.8703 2 38.08 1 17978 BuCaMH03.raw 5.7735E5 1 1 161 173 PEAKS DB
total 6 peptides
XP_034296606.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.LQWLMDQALQGDIIK.T N 76.36 1770.9338 15 0.5 886.4746 2 80.09 1 52433 BuCaMH03.raw 3.2396E5 1 1 799 813 PEAKS DB
R.NPYGYQLAWK.F N 70.15 1238.6084 10 -0.7 620.3110 2 51.24 1 28651 BuCaMH03.raw 8.0714E5 1 1 827 836 PEAKS DB
K.ALDLTLYLK.H N 65.37 1048.6168 9 -0.1 525.3156 2 69.67 1 43911 BuCaMH03.raw 1.2666E6 1 1 642 650 PEAKS DB
A.SLINNVFQLVSAGK.L Y 65.06 1488.8300 14 0.8 745.4229 2 84.21 1 55425 BuCaMH03.raw 1.3683E6 1 1 623 636 PEAKS DB
K.QDLAAIPDFQSGAMENWGLTTYR.E N 64.54 2583.2063 23 1.3 862.0771 3 83.98 1 55332 BuCaMH03.raw 9.1463E5 1 1 291 313 PEAKS DB
R.VLASTQFEPTAAR.M N 61.32 1389.7252 13 0.6 695.8703 2 38.08 1 17978 BuCaMH03.raw 5.7735E5 1 1 161 173 PEAKS DB
total 6 peptides
XP_034296607.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.LQWLMDQALQGDIIK.T N 76.36 1770.9338 15 0.5 886.4746 2 80.09 1 52433 BuCaMH03.raw 3.2396E5 1 1 799 813 PEAKS DB
R.NPYGYQLAWK.F N 70.15 1238.6084 10 -0.7 620.3110 2 51.24 1 28651 BuCaMH03.raw 8.0714E5 1 1 827 836 PEAKS DB
K.ALDLTLYLK.H N 65.37 1048.6168 9 -0.1 525.3156 2 69.67 1 43911 BuCaMH03.raw 1.2666E6 1 1 642 650 PEAKS DB
A.SLINNVFQLVSAGK.L Y 65.06 1488.8300 14 0.8 745.4229 2 84.21 1 55425 BuCaMH03.raw 1.3683E6 1 1 623 636 PEAKS DB
K.QDLAAIPDFQSGAMENWGLTTYR.E N 64.54 2583.2063 23 1.3 862.0771 3 83.98 1 55332 BuCaMH03.raw 9.1463E5 1 1 291 313 PEAKS DB
R.VLASTQFEPTAAR.M N 61.32 1389.7252 13 0.6 695.8703 2 38.08 1 17978 BuCaMH03.raw 5.7735E5 1 1 161 173 PEAKS DB
total 6 peptides
XP_026570202.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HSWANNLAVLEC(+57.02)LQDVR.E Y 82.21 2023.9897 17 0.6 675.6710 3 67.82 1 42379 BuCaMH03.raw 5.9885E5 1 1 115 131 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
R.QVSSEC(+57.02)QGEMLDYR.R Y 70.47 1700.7134 14 -0.6 851.3635 2 36.48 1 16709 BuCaMH03.raw 2.4546E5 1 1 400 413 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.SYLLMC(+57.02)LESAVHR.G Y 63.89 1577.7694 13 -0.3 526.9302 3 63.71 1 38985 BuCaMH03.raw 1.047E5 1 1 385 397 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.MLMEDFSLSPEIILGC(+57.02)R.T Y 62.19 2009.9624 17 -0.7 1005.9877 2 91.61 1 61584 BuCaMH03.raw 1.1397E6 1 1 415 431 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.LLELQYFISR.D Y 54.07 1280.7129 10 0.6 641.3641 2 75.24 1 48507 BuCaMH03.raw 2.4604E5 1 1 532 541 PEAKS DB
K.MTAIIFSDYR.L Y 53.61 1215.5958 10 0.2 608.8053 2 58.74 1 34721 BuCaMH03.raw 4.4716E5 1 1 209 218 PEAKS DB
total 6 peptides
XP_026535930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HSWANNLAVLEC(+57.02)LQDVR.E Y 82.21 2023.9897 17 0.6 675.6710 3 67.82 1 42379 BuCaMH03.raw 5.9885E5 1 1 111 127 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
R.QVSSEC(+57.02)QGEMLDYR.R Y 70.47 1700.7134 14 -0.6 851.3635 2 36.48 1 16709 BuCaMH03.raw 2.4546E5 1 1 396 409 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.SYLLMC(+57.02)LESAVHR.G Y 63.89 1577.7694 13 -0.3 526.9302 3 63.71 1 38985 BuCaMH03.raw 1.047E5 1 1 381 393 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.MLMEDFSLSPEIILGC(+57.02)R.T Y 62.19 2009.9624 17 -0.7 1005.9877 2 91.61 1 61584 BuCaMH03.raw 1.1397E6 1 1 411 427 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.LLELQYFISR.D Y 54.07 1280.7129 10 0.6 641.3641 2 75.24 1 48507 BuCaMH03.raw 2.4604E5 1 1 528 537 PEAKS DB
K.MTAIIFSDYR.L Y 53.61 1215.5958 10 0.2 608.8053 2 58.74 1 34721 BuCaMH03.raw 4.4716E5 1 1 205 214 PEAKS DB
total 6 peptides
T_22
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)PFHTC(+57.02)PNSETC(+57.02)PDGK.N Y 105.52 2006.7921 17 -0.4 1004.4030 2 19.73 1 5324 BuCaMH03.raw 3.4203E8 4 4 34 50 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.KC(+57.02)AATC(+57.02)PSDILSVTILC(+57.02)C(+57.02)TTDNC(+57.02)ND Y 66.84 2888.2119 25 0.2 1445.1135 2 74.22 1 48000 BuCaMH03.raw 3.6043E7 1 1 73 97 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)AATC(+57.02)PSDILSVTILC(+57.02)C(+57.02)TTDNC(+57.02)ND Y 64.36 2760.1169 24 0.5 1381.0664 2 87.75 1 58749 BuCaMH03.raw 1.6429E8 2 2 74 97 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PFHTC(+57.02)PNSETC(+57.02)PDGKNIC(+57.02)VKLSWLAVR.G Y 54.42 3446.5991 29 -0.9 862.6562 4 53.70 1 30664 BuCaMH03.raw 3.1014E6 2 2 34 62 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
Q9YGI8.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)PSGQLLC(+57.02)LK.K Y 82.21 1275.6315 11 0.4 638.8232 2 43.47 1 22037 BuCaMH03.raw 5.9298E8 1 1 37 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.KNEIIQC(+57.02)C(+57.02)AK.D Y 73.30 1262.6111 10 -0.9 632.3123 2 12.57 1 1868 BuCaMH03.raw 1.5666E7 1 1 72 81 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)PSGQLLC(+57.02)LK.K Y 70.51 1174.5839 10 1.0 588.2998 2 41.74 1 20969 BuCaMH03.raw 5.3383E7 1 1 38 47 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.WEIGNPSGK.E Y 66.05 986.4821 9 -0.5 494.2481 2 34.15 1 15030 BuCaMH03.raw 9.4483E8 1 1 49 57 PEAKS DB
K.NEIIQC(+57.02)C(+57.02)AK.D Y 58.17 1134.5161 9 0.2 568.2654 2 19.18 1 5077 BuCaMH03.raw 5.5334E7 1 1 73 81 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
CAA06887.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)PSGQLLC(+57.02)LK.K Y 82.21 1275.6315 11 0.4 638.8232 2 43.47 1 22037 BuCaMH03.raw 5.9298E8 1 1 37 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.KNEIIQC(+57.02)C(+57.02)AK.D Y 73.30 1262.6111 10 -0.9 632.3123 2 12.57 1 1868 BuCaMH03.raw 1.5666E7 1 1 72 81 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)PSGQLLC(+57.02)LK.K Y 70.51 1174.5839 10 1.0 588.2998 2 41.74 1 20969 BuCaMH03.raw 5.3383E7 1 1 38 47 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.WEIGNPSGK.E Y 66.05 986.4821 9 -0.5 494.2481 2 34.15 1 15030 BuCaMH03.raw 9.4483E8 1 1 49 57 PEAKS DB
K.NEIIQC(+57.02)C(+57.02)AK.D Y 58.17 1134.5161 9 0.2 568.2654 2 19.18 1 5077 BuCaMH03.raw 5.5334E7 1 1 73 81 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026521896.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.NLHNC(+57.02)VNLILLADHGMEAISC(+57.02)NR.L N 85.12 2663.2729 23 -0.1 666.8254 4 67.62 1 42179 BuCaMH03.raw 1.0977E6 1 1 340 362 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.FGPVSGQIIK.S Y 64.29 1044.5967 10 0.1 523.3057 2 43.11 1 21815 BuCaMH03.raw 7.8843E5 1 1 311 320 PEAKS DB
K.SPDNLWVEER.M N 64.17 1243.5833 10 -0.3 622.7987 2 43.64 1 22314 BuCaMH03.raw 5.2781E5 1 1 799 808 PEAKS DB
K.DFYTFDSEAIVK.N N 54.12 1433.6714 12 1.4 717.8440 2 67.17 1 41791 BuCaMH03.raw 7.0826E5 1 1 393 404 PEAKS DB
total 4 peptides
XP_026521895.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.NLHNC(+57.02)VNLILLADHGMEAISC(+57.02)NR.L N 85.12 2663.2729 23 -0.1 666.8254 4 67.62 1 42179 BuCaMH03.raw 1.0977E6 1 1 376 398 Carbamidomethylation C5:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
K.FGPVSGQIIK.S Y 64.29 1044.5967 10 0.1 523.3057 2 43.11 1 21815 BuCaMH03.raw 7.8843E5 1 1 347 356 PEAKS DB
K.SPDNLWVEER.M N 64.17 1243.5833 10 -0.3 622.7987 2 43.64 1 22314 BuCaMH03.raw 5.2781E5 1 1 835 844 PEAKS DB
K.DFYTFDSEAIVK.N N 54.12 1433.6714 12 1.4 717.8440 2 67.17 1 41791 BuCaMH03.raw 7.0826E5 1 1 429 440 PEAKS DB
total 4 peptides
T_176
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DTYVTC(+57.02)EEGYVC(+57.02)YTYYSVKPPNR.F Y 103.99 2863.2468 23 0.4 955.4233 3 58.62 1 34612 BuCaMH03.raw 6.9416E8 4 4 30 52 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
T.IIC(+57.02)HSRDTYVTC(+57.02)EEGYVC(+57.02)YTYYSVKPPNR.F Y 75.28 3629.6377 29 0.9 908.4175 4 46.60 1 24863 BuCaMH03.raw 2.4476E7 1 1 24 52 Carbamidomethylation C3:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
Y.TYYSVKPPNR.F Y 61.37 1223.6299 10 -0.1 408.8839 3 20.05 1 5479 BuCaMH03.raw 3.3234E6 1 1 43 52 PEAKS DB
I.C(+57.02)HSRDTYVTC(+57.02)EEGYVC(+57.02)YTYYSVKPPNR.F Y 55.70 3403.4695 27 -0.4 681.7009 5 45.65 1 23777 BuCaMH03.raw 6.361E5 1 1 26 52 Carbamidomethylation C1:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
T_83
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.HQGLPESYNFDFVTMKPVL Y 82.29 2221.0876 19 0.6 741.3703 3 74.84 1 48178 BuCaMH03.raw 1.3326E6 1 1 535 553 PEAKS DB
K.YGLDFSYEMAPR.A Y 81.73 1447.6442 12 0.0 724.8293 2 63.81 1 39095 BuCaMH03.raw 9.0867E5 1 1 427 438 PEAKS DB
K.QVVPESLFAWER.V Y 65.87 1459.7460 12 0.8 730.8809 2 71.71 1 45618 BuCaMH03.raw 5.1221E5 1 1 319 330 PEAKS DB
A.DLHYATVYWLEAEK.S Y 60.70 1736.8409 14 0.6 579.9546 3 65.47 1 40425 BuCaMH03.raw 3.8121E5 1 1 37 50 PEAKS DB
R.NAGYIIAQLDGLYMGNLEWAK.R Y 56.62 2339.1619 21 0.1 780.7280 3 95.03 1 64340 BuCaMH03.raw 3.2773E5 1 1 159 179 PEAKS DB
K.TWAQIFEK.Q Y 53.01 1021.5233 8 0.5 511.7692 2 55.61 1 32227 BuCaMH03.raw 7.2599E5 1 1 343 350 PEAKS DB
total 6 peptides
XP_034277309.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.FHGLGVIDWENWR.P Y 78.08 1627.7896 13 0.2 543.6039 3 69.32 1 43607 BuCaMH03.raw 2.5945E6 1 1 142 154 PEAKS DB
K.FHGLGVIDWENWRPQWDR.N N 72.06 2310.1082 18 0.7 578.5347 4 72.04 1 45863 BuCaMH03.raw 8.7408E5 1 1 142 159 PEAKS DB
R.NDQLLWLWR.D N 63.60 1242.6509 9 0.8 622.3332 2 79.40 1 51700 BuCaMH03.raw 5.3353E7 1 1 251 259 PEAKS DB
K.C(+57.02)PNIEISR.N N 60.84 987.4808 8 0.7 494.7480 2 26.63 1 9851 BuCaMH03.raw 7.2279E6 1 1 243 250 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
F.HGLGVIDWENWRPQWDR.N N 54.37 2163.0398 17 1.0 541.7678 4 67.50 1 42023 BuCaMH03.raw 1.0462E6 1 1 143 159 PEAKS DB
K.DYALPVFVYAR.P N 53.97 1312.6815 11 0.9 657.3486 2 77.76 1 50512 BuCaMH03.raw 5.5419E6 1 1 301 311 PEAKS DB
total 6 peptides
XP_034264771.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SSIFGSVEIVNLNPEK.V N 79.12 1731.9043 16 2.2 866.9613 2 72.81 1 46448 BuCaMH03.raw 4.2647E7 1 1 222 237 PEAKS DB
R.KSSIFGSVEIVNLNPEK.V N 70.79 1859.9993 17 1.1 931.0079 2 59.81 1 35636 BuCaMH03.raw 2.1478E6 1 1 221 237 PEAKS DB
K.LFEQAFLYK.D Y 64.24 1157.6121 9 0.0 579.8133 2 60.60 1 36224 BuCaMH03.raw 1.3908E7 1 1 91 99 PEAKS DB
R.PAQLLQC(+57.02)TR.N Y 53.90 1085.5652 9 -0.5 543.7896 2 25.13 1 8617 BuCaMH03.raw 3.9358E5 1 1 284 292 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TGHSIAQLR.E N 53.80 1141.5662 10 -0.1 381.5293 3 12.93 1 2105 BuCaMH03.raw 6.8899E4 1 1 257 266 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
T_158
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.DEVIPFMTVFER.S Y 62.24 1481.7224 12 0.6 741.8689 2 90.82 1 60896 BuCaMH03.raw 1.9077E7 1 1 38 49 PEAKS DB
Q.LDEVIPFMTVFER.S Y 60.82 1594.8065 13 0.7 798.4111 2 91.54 1 61776 BuCaMH03.raw 3.1721E8 1 1 37 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVEYIFKPSC(+57.02)VLLMK.C Y 58.94 4052.9282 33 0.5 1014.2398 4 90.87 1 61330 BuCaMH03.raw 5.2638E7 1 1 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
R.HFQSQHIHPMSFQQH.S Y 58.54 1887.8588 15 0.4 472.9721 4 22.46 1 7191 BuCaMH03.raw 7.9421E6 1 1 111 125 PEAKS DB
K.QLDEVIPFMTVFER.S Y 56.59 1722.8650 14 0.3 862.4401 2 98.36 1 67114 BuCaMH03.raw 9.7411E5 1 1 36 49 PEAKS DB
R.HFQSQHIHPMSFQQHSK.C Y 53.49 2102.9856 17 -0.1 421.6043 5 21.44 1 6424 BuCaMH03.raw 0 0 0 111 127 PEAKS DB
total 6 peptides
T_153
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.DEVIPFMTVFER.S Y 62.24 1481.7224 12 0.6 741.8689 2 90.82 1 60896 BuCaMH03.raw 1.9077E7 1 1 38 49 PEAKS DB
Q.LDEVIPFMTVFER.S Y 60.82 1594.8065 13 0.7 798.4111 2 91.54 1 61776 BuCaMH03.raw 3.1721E8 1 1 37 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVEYIFKPSC(+57.02)VLLMK.C Y 58.94 4052.9282 33 0.5 1014.2398 4 90.87 1 61330 BuCaMH03.raw 5.2638E7 1 1 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
R.HFQSQHIHPMSFQQH.S Y 58.54 1887.8588 15 0.4 472.9721 4 22.46 1 7191 BuCaMH03.raw 7.9421E6 1 1 111 125 PEAKS DB
K.QLDEVIPFMTVFER.S Y 56.59 1722.8650 14 0.3 862.4401 2 98.36 1 67114 BuCaMH03.raw 9.7411E5 1 1 36 49 PEAKS DB
R.HFQSQHIHPMSFQQHSK.C Y 53.49 2102.9856 17 -0.1 421.6043 5 21.44 1 6424 BuCaMH03.raw 0 0 0 111 127 PEAKS DB
total 6 peptides
T_157
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.DEVIPFMTVFER.S Y 62.24 1481.7224 12 0.6 741.8689 2 90.82 1 60896 BuCaMH03.raw 1.9077E7 1 1 38 49 PEAKS DB
Q.LDEVIPFMTVFER.S Y 60.82 1594.8065 13 0.7 798.4111 2 91.54 1 61776 BuCaMH03.raw 3.1721E8 1 1 37 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVEYIFKPSC(+57.02)VLLMK.C Y 58.94 4052.9282 33 0.5 1014.2398 4 90.87 1 61330 BuCaMH03.raw 5.2638E7 1 1 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
R.HFQSQHIHPMSFQQH.S Y 58.54 1887.8588 15 0.4 472.9721 4 22.46 1 7191 BuCaMH03.raw 7.9421E6 1 1 111 125 PEAKS DB
K.QLDEVIPFMTVFER.S Y 56.59 1722.8650 14 0.3 862.4401 2 98.36 1 67114 BuCaMH03.raw 9.7411E5 1 1 36 49 PEAKS DB
R.HFQSQHIHPMSFQQHSK.C Y 53.49 2102.9856 17 -0.1 421.6043 5 21.44 1 6424 BuCaMH03.raw 0 0 0 111 127 PEAKS DB
total 6 peptides
T_151
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.DEVIPFMTVFER.S Y 62.24 1481.7224 12 0.6 741.8689 2 90.82 1 60896 BuCaMH03.raw 1.9077E7 1 1 38 49 PEAKS DB
Q.LDEVIPFMTVFER.S Y 60.82 1594.8065 13 0.7 798.4111 2 91.54 1 61776 BuCaMH03.raw 3.1721E8 1 1 37 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVEYIFKPSC(+57.02)VLLMK.C Y 58.94 4052.9282 33 0.5 1014.2398 4 90.87 1 61330 BuCaMH03.raw 5.2638E7 1 1 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
R.HFQSQHIHPMSFQQH.S Y 58.54 1887.8588 15 0.4 472.9721 4 22.46 1 7191 BuCaMH03.raw 7.9421E6 1 1 111 125 PEAKS DB
K.QLDEVIPFMTVFER.S Y 56.59 1722.8650 14 0.3 862.4401 2 98.36 1 67114 BuCaMH03.raw 9.7411E5 1 1 36 49 PEAKS DB
R.HFQSQHIHPMSFQQHSK.C Y 53.49 2102.9856 17 -0.1 421.6043 5 21.44 1 6424 BuCaMH03.raw 0 0 0 111 127 PEAKS DB
total 6 peptides
T_152
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.DEVIPFMTVFER.S Y 62.24 1481.7224 12 0.6 741.8689 2 90.82 1 60896 BuCaMH03.raw 1.9077E7 1 1 38 49 PEAKS DB
Q.LDEVIPFMTVFER.S Y 60.82 1594.8065 13 0.7 798.4111 2 91.54 1 61776 BuCaMH03.raw 3.1721E8 1 1 37 49 PEAKS DB
R.SSC(+57.02)RPIETMIDIYQEYPDEVEYIFKPSC(+57.02)VLLMK.C Y 58.94 4052.9282 33 0.5 1014.2398 4 90.87 1 61330 BuCaMH03.raw 5.2638E7 1 1 50 82 Carbamidomethylation C3:Carbamidomethylation:1000.00;C28:Carbamidomethylation:1000.00 PEAKS DB
R.HFQSQHIHPMSFQQH.S Y 58.54 1887.8588 15 0.4 472.9721 4 22.46 1 7191 BuCaMH03.raw 7.9421E6 1 1 111 125 PEAKS DB
K.QLDEVIPFMTVFER.S Y 56.59 1722.8650 14 0.3 862.4401 2 98.36 1 67114 BuCaMH03.raw 9.7411E5 1 1 36 49 PEAKS DB
R.HFQSQHIHPMSFQQHSK.C Y 53.49 2102.9856 17 -0.1 421.6043 5 21.44 1 6424 BuCaMH03.raw 0 0 0 111 127 PEAKS DB
total 6 peptides
T_175
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DTYQTC(+57.02)EEGHVC(+57.02)YSFVTIEPPNR.F Y 118.75 2801.2061 23 0.4 934.7430 3 57.43 1 33838 BuCaMH03.raw 2.3921E8 3 3 30 52 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SFVTIEPPNR.F Y 63.76 1158.6033 10 0.9 580.3094 2 43.97 1 22414 BuCaMH03.raw 2.2714E6 1 1 43 52 PEAKS DB
total 2 peptides
AHJ80886.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VPTYVPLEMEK.T N 71.52 1304.6686 11 0.5 653.3419 2 52.81 1 29825 BuCaMH03.raw 1.5662E6 1 1 316 326 PEAKS DB
R.VVSLNVLC(+57.02)TK.C Y 69.31 1131.6322 10 -0.5 566.8231 2 49.07 1 26714 BuCaMH03.raw 2.6873E6 1 1 304 313 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
T_132
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.RGC(+57.02)AATC(+57.02)PESSHMVNVEC(+57.02)C(+57.02)STDK.C Y 92.69 2655.0605 23 0.1 664.7725 4 20.35 1 5945 BuCaMH03.raw 5.5361E6 1 1 59 81 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.RGC(+57.02)AATC(+57.02)PESSHMVNVEC(+57.02)C(+57.02)STDKC(+57.02)NQ Y 72.98 3057.1926 26 -0.2 765.3053 4 21.07 1 6155 BuCaMH03.raw 2.1644E6 1 1 59 84 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
Q9W729.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
A.VIEQGC(+57.02)VATC(+57.02)PEFR.S Y 88.05 1664.7650 14 0.5 833.3902 2 40.11 1 19491 BuCaMH03.raw 3.2121E8 3 3 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)VATC(+57.02)PEFR.S Y 66.77 1565.6967 13 0.4 783.8559 2 35.92 1 16214 BuCaMH03.raw 1.0834E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
CAB46659.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
A.VIEQGC(+57.02)VATC(+57.02)PEFR.S Y 88.05 1664.7650 14 0.5 833.3902 2 40.11 1 19491 BuCaMH03.raw 3.2121E8 3 3 58 71 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
V.IEQGC(+57.02)VATC(+57.02)PEFR.S Y 66.77 1565.6967 13 0.4 783.8559 2 35.92 1 16214 BuCaMH03.raw 1.0834E7 1 1 59 71 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
T_102
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VFDYIDWIK.G N 72.95 1197.6069 9 0.6 599.8111 2 77.99 1 50633 BuCaMH03.raw 2.2549E6 1 1 270 278 PEAKS DB
K.GDSGGPLIC(+57.02)NGQIQGIVSWGR.F Y 66.04 2170.0588 21 0.0 1086.0367 2 71.90 1 45805 BuCaMH03.raw 8.7812E5 1 1 235 255 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.HIEPLSLPSRPPSMGSVC(+57.02)TVMGWGTITSPK.V Y 58.55 3221.6035 30 0.7 806.4088 4 70.11 1 44237 BuCaMH03.raw 1.0365E6 1 1 159 188 Carbamidomethylation C18:Carbamidomethylation:1000.00 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 57.74 1621.8174 14 0.6 811.9164 2 62.52 1 37982 BuCaMH03.raw 1.0252E6 1 1 256 269 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
ETE56933.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.ITC(+57.02)SAEETFC(+57.02)YK.W Y 94.26 1507.6323 12 0.1 754.8235 2 36.59 1 17633 BuCaMH03.raw 3.3402E8 10 10 90 101 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YK.W Y 63.39 1293.5006 10 0.2 647.7577 2 29.89 1 12055 BuCaMH03.raw 5.743E7 1 1 92 101 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YK.W Y 62.90 1394.5482 11 0.4 698.2817 2 30.77 1 12810 BuCaMH03.raw 2.0593E8 1 1 91 101 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
1IJC
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.ITC(+57.02)SAEETFC(+57.02)YK.W Y 94.26 1507.6323 12 0.1 754.8235 2 36.59 1 17633 BuCaMH03.raw 3.3402E8 10 10 15 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YK.W Y 63.39 1293.5006 10 0.2 647.7577 2 29.89 1 12055 BuCaMH03.raw 5.743E7 1 1 17 26 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YK.W Y 62.90 1394.5482 11 0.4 698.2817 2 30.77 1 12810 BuCaMH03.raw 2.0593E8 1 1 16 26 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
1F94
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.ITC(+57.02)SAEETFC(+57.02)YK.W Y 94.26 1507.6323 12 0.1 754.8235 2 36.59 1 17633 BuCaMH03.raw 3.3402E8 10 10 15 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YK.W Y 63.39 1293.5006 10 0.2 647.7577 2 29.89 1 12055 BuCaMH03.raw 5.743E7 1 1 17 26 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YK.W Y 62.90 1394.5482 11 0.4 698.2817 2 30.77 1 12810 BuCaMH03.raw 2.0593E8 1 1 16 26 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
P81782.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.ITC(+57.02)SAEETFC(+57.02)YK.W Y 94.26 1507.6323 12 0.1 754.8235 2 36.59 1 17633 BuCaMH03.raw 3.3402E8 10 10 15 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)SAEETFC(+57.02)YK.W Y 63.39 1293.5006 10 0.2 647.7577 2 29.89 1 12055 BuCaMH03.raw 5.743E7 1 1 17 26 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.TC(+57.02)SAEETFC(+57.02)YK.W Y 62.90 1394.5482 11 0.4 698.2817 2 30.77 1 12810 BuCaMH03.raw 2.0593E8 1 1 16 26 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
ABN72545.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VFDYIDWIK.G N 72.95 1197.6069 9 0.6 599.8111 2 77.99 1 50633 BuCaMH03.raw 2.2549E6 1 1 268 276 PEAKS DB
K.GDSGGPLIC(+57.02)DGQIQGIVSWGR.F Y 68.41 2171.0430 21 0.3 1086.5291 2 74.18 1 47633 BuCaMH03.raw 7.7512E5 1 1 233 253 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 57.74 1621.8174 14 0.6 811.9164 2 62.52 1 37982 BuCaMH03.raw 1.0252E6 1 1 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
A8QL57.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VFDYIDWIK.G N 72.95 1197.6069 9 0.6 599.8111 2 77.99 1 50633 BuCaMH03.raw 2.2549E6 1 1 268 276 PEAKS DB
K.GDSGGPLIC(+57.02)DGQIQGIVSWGR.F Y 68.41 2171.0430 21 0.3 1086.5291 2 74.18 1 47633 BuCaMH03.raw 7.7512E5 1 1 233 253 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 57.74 1621.8174 14 0.6 811.9164 2 62.52 1 37982 BuCaMH03.raw 1.0252E6 1 1 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026555558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.C(+57.02)QNADVYGAEISENMFC(+57.02)AGYLDGR.S Y 75.99 2739.1362 24 1.5 914.0540 3 74.89 1 48289 BuCaMH03.raw 7.903E5 1 1 463 486 Carbamidomethylation C1:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
R.SDAC(+57.02)QGDSGGPLAC(+57.02)ER.D Y 69.39 1678.6675 16 0.2 840.3412 2 22.91 1 7194 BuCaMH03.raw 1.0147E6 1 1 487 502 Carbamidomethylation C4:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.SPDEDEQPWC(+57.02)YFIK.D N 68.05 1812.7665 14 0.4 907.3909 2 74.89 1 48131 BuCaMH03.raw 2.3067E6 1 1 235 248 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.IVGGSSALPGSHPWLASINVGR.N N 58.18 2174.1597 22 0.1 725.7272 3 59.37 1 35332 BuCaMH03.raw 7.2346E5 1 1 304 325 PEAKS DB
R.YSNVVQEALIPIIPDYK.C Y 53.12 1961.0509 17 0.3 654.6911 3 81.74 1 53784 BuCaMH03.raw 4.2127E5 1 1 446 462 PEAKS DB
total 5 peptides
T_54
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
I.C(+57.02)LTC(+57.02)PDKYC(+57.02)QTVHTC(+57.02)R.N Y 68.74 2097.8853 16 0.1 525.4786 4 20.10 1 5810 BuCaMH03.raw 6.404E7 2 2 24 39 Carbamidomethylation C1:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.FYDKNQLGWR.A Y 60.99 1325.6516 10 -0.4 442.8910 3 34.92 1 15387 BuCaMH03.raw 3.8137E6 2 2 49 58 PEAKS DB
F.YDKNQLGWR.A Y 58.79 1178.5833 9 -0.4 590.2986 2 25.14 1 8823 BuCaMH03.raw 1.1845E8 2 2 50 58 PEAKS DB
total 3 peptides
Q8AY42.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.FTYGGC(+57.02)GGNANNFK.S Y 88.26 1505.6357 14 -2.1 753.8235 2 31.75 1 13356 BuCaMH03.raw 4.3845E8 2 2 59 72 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
F.TYGGC(+57.02)GGNANNFK.S Y 87.23 1358.5674 13 0.3 680.2911 2 16.91 1 3953 BuCaMH03.raw 3.1257E7 1 1 60 72 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
Q8AY43.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.FTYGGC(+57.02)GGNANNFK.S Y 88.26 1505.6357 14 -2.1 753.8235 2 31.75 1 13356 BuCaMH03.raw 4.3845E8 2 2 59 72 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
F.TYGGC(+57.02)GGNANNFK.S Y 87.23 1358.5674 13 0.3 680.2911 2 16.91 1 3953 BuCaMH03.raw 3.1257E7 1 1 60 72 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAL30069.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.FTYGGC(+57.02)GGNANNFK.S Y 88.26 1505.6357 14 -2.1 753.8235 2 31.75 1 13356 BuCaMH03.raw 4.3845E8 2 2 64 77 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
F.TYGGC(+57.02)GGNANNFK.S Y 87.23 1358.5674 13 0.3 680.2911 2 16.91 1 3953 BuCaMH03.raw 3.1257E7 1 1 65 77 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 66 77 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAL30068.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.FTYGGC(+57.02)GGNANNFK.S Y 88.26 1505.6357 14 -2.1 753.8235 2 31.75 1 13356 BuCaMH03.raw 4.3845E8 2 2 64 77 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
F.TYGGC(+57.02)GGNANNFK.S Y 87.23 1358.5674 13 0.3 680.2911 2 16.91 1 3953 BuCaMH03.raw 3.1257E7 1 1 65 77 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
T.YGGC(+57.02)GGNANNFK.S N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 66 77 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026544110.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.YIMHPDYSVFNPTENDIVLIK.L Y 97.27 2507.2407 21 0.8 836.7549 3 72.89 1 46619 BuCaMH03.raw 6.3406E6 1 1 378 398 PEAKS DB
R.SPDEDEQPWC(+57.02)YFIK.D N 68.05 1812.7665 14 0.4 907.3909 2 74.89 1 48131 BuCaMH03.raw 2.3067E6 1 1 235 248 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.IVGGSSALPGSHPWLASINVGR.N N 58.18 2174.1597 22 0.1 725.7272 3 59.37 1 35332 BuCaMH03.raw 7.2346E5 1 1 304 325 PEAKS DB
total 3 peptides
P41331.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIDALTEAVNNLDDVAGALSK.L N 92.44 2127.1060 21 0.4 710.0428 3 94.16 1 63594 BuCaMH03.raw 4.2072E6 2 2 62 82 PEAKS DB
K.KVIDALTEAVNNLDDVAGALSK.L N 61.22 2255.2009 22 -0.2 1128.6075 2 87.59 1 58386 BuCaMH03.raw 3.6124E5 1 1 61 82 PEAKS DB
K.TYFPHFDLSPGSNDLK.V Y 58.62 1836.8682 16 -0.4 613.2964 3 59.18 1 35091 BuCaMH03.raw 6.0532E5 1 1 41 56 PEAKS DB
total 3 peptides
ETE59912.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 307 324 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 327 336 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 186 197 PEAKS DB
total 3 peptides
XP_034262421.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 272 289 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 292 301 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 151 162 PEAKS DB
total 3 peptides
JAG67806.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
XP_025022112.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 305 322 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 325 334 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 184 195 PEAKS DB
total 3 peptides
JAB54174.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 307 324 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 327 336 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 186 197 PEAKS DB
total 3 peptides
XP_026568326.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 307 324 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 327 336 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 186 197 PEAKS DB
total 3 peptides
XP_026542482.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 307 324 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 327 336 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 186 197 PEAKS DB
total 3 peptides
JAV50419.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
JAG44540.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
JAI13107.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
XP_015681610.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
AFJ50327.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
JAG46692.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
JAA96909.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
AFJ50239.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.IEIESFFEGEDFSETLTR.A Y 65.88 2147.9897 18 0.5 1075.0027 2 85.86 1 56881 BuCaMH03.raw 3.5489E5 1 1 306 323 PEAKS DB
K.FEELNMDLFR.S Y 63.72 1312.6122 10 0.3 657.3135 2 71.75 1 45607 BuCaMH03.raw 1.0935E6 1 1 326 335 PEAKS DB
K.DAGTIAGLNVMR.I Y 60.58 1216.6234 12 0.1 609.3190 2 54.94 1 31734 BuCaMH03.raw 4.5409E5 1 1 185 196 PEAKS DB
total 3 peptides
ABH05181.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DADSADLAEYISDYLK.V Y 64.89 1787.8101 16 0.7 894.9130 2 92.01 1 61834 BuCaMH03.raw 1.5378E6 1 1 69 84 PEAKS DB
total 1 peptides
A1XXJ9.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.DADSADLAEYISDYLK.V Y 64.89 1787.8101 16 0.7 894.9130 2 92.01 1 61834 BuCaMH03.raw 1.5378E6 1 1 69 84 PEAKS DB
total 1 peptides
ABU68503.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
V.AAIC(+57.02)FAR.A N 64.40 807.4061 7 0.3 404.7105 2 30.53 1 12209 BuCaMH03.raw 2.029E7 1 1 129 135 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.VAAIC(+57.02)FAR.A Y 62.11 906.4745 8 2.3 454.2456 2 38.73 1 18474 BuCaMH03.raw 8.6156E5 1 1 128 135 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GYGGSGTPVDELDR.C N 61.33 1744.7362 16 0.7 873.3760 2 48.17 1 25865 BuCaMH03.raw 3.7552E6 1 1 55 70 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
T_84
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.ADVTFDSNTAFESLVVSPDKK.T Y 68.94 2269.1113 21 1.1 757.3785 3 63.88 1 39147 BuCaMH03.raw 6.4817E5 1 1 57 77 PEAKS DB
K.IVVFLDYNEEK.V Y 64.72 1367.6973 11 1.0 684.8566 2 59.94 1 35768 BuCaMH03.raw 9.7449E5 1 1 172 182 PEAKS DB
total 2 peptides
CAM11302.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
T.C(+57.02)PSGENLC(+57.02)YTK.M Y 68.81 1327.5537 11 0.1 664.7842 2 21.67 1 6555 BuCaMH03.raw 3.4853E6 1 1 18 28 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
T.VTC(+57.02)PSGENLC(+57.02)YTK.M Y 64.79 1527.6698 13 0.0 764.8422 2 28.21 1 10563 BuCaMH03.raw 3.8765E7 1 1 16 28 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
D2N116.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
T.C(+57.02)PSGENLC(+57.02)YTK.M Y 68.81 1327.5537 11 0.1 664.7842 2 21.67 1 6555 BuCaMH03.raw 3.4853E6 1 1 18 28 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
T.VTC(+57.02)PSGENLC(+57.02)YTK.M Y 64.79 1527.6698 13 0.0 764.8422 2 28.21 1 10563 BuCaMH03.raw 3.8765E7 1 1 16 28 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ACY68722.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.YLYVC(+57.02)QYC(+57.02)PAGNIKR.L Y 70.72 1903.9072 15 -0.3 635.6428 3 38.93 1 18668 BuCaMH03.raw 9.8406E5 1 1 158 172 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAB25729.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.QYFFETK.C Y 53.56 961.4545 7 0.9 481.7349 2 41.53 1 20492 BuCaMH03.raw 7.1214E6 1 1 175 181 PEAKS DB
total 1 peptides
P34128.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.QYFFETK.C Y 53.56 961.4545 7 0.9 481.7349 2 41.53 1 20492 BuCaMH03.raw 7.1214E6 1 1 175 181 PEAKS DB
total 1 peptides
B4ESA3.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.YGGC(+57.02)GGNANNFK.T N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AFYYNSR.P Y 56.83 919.4188 7 -1.0 460.7162 2 24.64 1 8266 BuCaMH03.raw 6.4804E7 1 1 46 52 PEAKS DB
total 2 peptides
Q8AY41.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.YGGC(+57.02)GGNANNFK.T N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AFYYNSR.L Y 56.83 919.4188 7 -1.0 460.7162 2 24.64 1 8266 BuCaMH03.raw 6.4804E7 1 1 46 52 PEAKS DB
total 2 peptides
CAP74382.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.YGGC(+57.02)GGNANNFK.T N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 61 72 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AFYYNSR.P Y 56.83 919.4188 7 -1.0 460.7162 2 24.64 1 8266 BuCaMH03.raw 6.4804E7 1 1 46 52 PEAKS DB
total 2 peptides
AAL30070.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
P.YGGC(+57.02)GGNANNFK.T N 75.97 1257.5197 12 0.4 629.7673 2 13.72 1 2615 BuCaMH03.raw 8.8737E6 1 1 66 77 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.AFYYNSR.L Y 56.83 919.4188 7 -1.0 460.7162 2 24.64 1 8266 BuCaMH03.raw 6.4804E7 1 1 51 57 PEAKS DB
total 2 peptides
JAA74768.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TWC(+57.02)DAWC(+57.02)TSR.G Y 62.45 1341.5231 10 0.5 671.7692 2 45.01 1 23310 BuCaMH03.raw 9.3226E6 1 1 46 55 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74767.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TWC(+57.02)DAWC(+57.02)TSR.G Y 62.45 1341.5231 10 0.5 671.7692 2 45.01 1 23310 BuCaMH03.raw 9.3226E6 1 1 46 55 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P01387.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.TWC(+57.02)DAWC(+57.02)TSR.G Y 62.45 1341.5231 10 0.5 671.7692 2 45.01 1 23310 BuCaMH03.raw 9.3226E6 1 1 25 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q53B58.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.TWC(+57.02)DAWC(+57.02)TSR.G Y 62.45 1341.5231 10 0.5 671.7692 2 45.01 1 23310 BuCaMH03.raw 9.3226E6 1 1 46 55 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAT97250.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
E.TWC(+57.02)DAWC(+57.02)TSR.G Y 62.45 1341.5231 10 0.5 671.7692 2 45.01 1 23310 BuCaMH03.raw 9.3226E6 1 1 46 55 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
BAC77656.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VAAIC(+57.02)FAGAPYNDKNFM(+15.99)INT.E Y 59.60 2232.0344 20 -0.7 1117.0237 2 68.70 1 44155 BuCaMH03.raw 1.0036E8 2 2 123 142 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;M17:Oxidation (M):1000.00 PEAKS DB
total 1 peptides
ADF50035.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VAAIC(+57.02)FAGAPYNDKNFM(+15.99)INT.E Y 59.60 2232.0344 20 -0.7 1117.0237 2 68.70 1 44155 BuCaMH03.raw 1.0036E8 2 2 123 142 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;M17:Oxidation (M):1000.00 PEAKS DB
total 1 peptides
Q7T2Q4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VAAIC(+57.02)FAGAPYNDKNFM(+15.99)INT.E Y 59.60 2232.0344 20 -0.7 1117.0237 2 68.70 1 44155 BuCaMH03.raw 1.0036E8 2 2 123 142 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;M17:Oxidation (M):1000.00 PEAKS DB
total 1 peptides
ACY68711.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
L.NLIQFSYLIQC(+57.02)ANHGR.R Y 61.51 1932.9628 16 0.3 645.3284 3 66.34 1 41154 BuCaMH03.raw 2.4189E6 1 1 28 43 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAC94986.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.DGSILEVNVTPC(+57.02)PTLPC(+57.02)ILHK.G Y 82.18 2362.2024 21 0.9 788.4088 3 74.40 1 47822 BuCaMH03.raw 2.3001E6 1 1 35 55 Carbamidomethylation C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA97769.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
JAI10286.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
JAG47471.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
JAB54690.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
JAG45828.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
JAV51253.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 89 104 PEAKS DB
total 1 peptides
XP_007439873.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 90 105 PEAKS DB
total 1 peptides
LAB40267.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 97 112 PEAKS DB
total 1 peptides
ETE59687.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SALSGHLEAVILGLLK.T Y 81.97 1619.9609 16 0.2 540.9944 3 86.74 1 57625 BuCaMH03.raw 6.5848E5 1 1 34 49 PEAKS DB
total 1 peptides
ETE61271.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 366 378 PEAKS DB
total 1 peptides
AFJ51008.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
XP_032088229.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
XP_013923763.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
XP_013923762.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_032088228.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_015669101.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
BAN82088.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_034291658.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_034291656.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 367 379 PEAKS DB
total 1 peptides
XP_034291657.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 368 380 PEAKS DB
total 1 peptides
XP_034291655.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 368 380 PEAKS DB
total 1 peptides
XP_026569354.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
XP_026569353.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_026528620.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 362 374 PEAKS DB
total 1 peptides
XP_026528619.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SILDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 365 377 PEAKS DB
total 1 peptides
XP_007441356.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.SIIDMLLEATSPK.M Y 80.26 1416.7534 13 0.8 709.3845 2 97.63 1 66659 BuCaMH03.raw 1.2447E7 1 1 227 239 PEAKS DB
total 1 peptides
1MR6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 5 21 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA06885.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9YGJ0.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAD41806.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA72941.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAD01082.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
O12963.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.TC(+57.02)SFYTC(+57.02)PNSETC(+57.02)PDGK.N Y 57.17 2022.7758 17 4.4 675.2688 3 19.76 1 5449 BuCaMH03.raw 1.6747E6 1 1 26 42 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAB19298.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 388 404 PEAKS DB
total 1 peptides
LAB19293.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 388 404 PEAKS DB
total 1 peptides
LAB19285.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 398 414 PEAKS DB
total 1 peptides
LAB19295.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 398 414 PEAKS DB
total 1 peptides
LAB19282.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 439 455 PEAKS DB
total 1 peptides
LAB19291.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 458 474 PEAKS DB
total 1 peptides
LAB19280.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.WLQNEQPVSESAYFTSK.A Y 54.48 2012.9479 17 0.8 1007.4821 2 55.17 1 31835 BuCaMH03.raw 1.0705E6 1 1 465 481 PEAKS DB
total 1 peptides
XP_026576367.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026577747.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015675791.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
V.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 13 25 PEAKS DB
total 1 peptides
XP_015672174.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026539722.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
LAA79020.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026569519.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026576364.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015678744.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026545427.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026529646.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_013925621.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026529644.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_025022125.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026576334.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026576366.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015672062.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026576365.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026536969.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_007429385.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026545426.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015681932.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026547833.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026539701.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026580816.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015681933.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026548170.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_026569640.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
ETE56555.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_015678747.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
M.SIMNSFVNDIFER.I Y 64.67 1570.7450 13 0.4 786.3801 2 81.33 1 53458 BuCaMH03.raw 2.2177E5 1 1 61 73 PEAKS DB
total 1 peptides
XP_007434930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.AAADAHVGFC(+57.02)K.A Y 62.11 1145.5287 11 0.4 573.7719 2 12.81 1 2030 BuCaMH03.raw 3.3371E5 2 2 220 230 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034281839.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 157 165 PEAKS DB
total 1 peptides
XP_013925207.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 155 163 PEAKS DB
total 1 peptides
XP_026542555.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 152 160 PEAKS DB
total 1 peptides
XP_026575692.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 155 163 PEAKS DB
total 1 peptides
XP_026542553.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 152 160 PEAKS DB
total 1 peptides
XP_029139434.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 154 162 PEAKS DB
total 1 peptides
XP_026575691.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 155 163 PEAKS DB
total 1 peptides
XP_032087784.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 160 168 PEAKS DB
total 1 peptides
XP_015746961.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.FPSLLAPGR.R Y 59.37 956.5443 9 -0.5 479.2792 2 53.64 1 30634 BuCaMH03.raw 3.2482E5 1 1 12 20 PEAKS DB
total 1 peptides
JAB52761.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 121 128 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS04986.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS04987.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS04982.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS04985.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI08996.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI08997.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI08998.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI08993.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAB52775.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAB52776.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05103.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05108.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05109.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05107.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05106.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05111.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05101.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05102.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05104.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05105.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05110.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.TAALC(+57.02)FGK.A Y 55.04 866.4320 8 -0.2 434.2232 2 30.55 1 12370 BuCaMH03.raw 4.7538E5 1 1 123 130 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78492.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78484.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
F8J2F2.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78483.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78488.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74738.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78486.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
F8J2E6.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ACR78491.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74652.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.K Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74651.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.K Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA74655.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.K Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABK63538.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.S Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
A8HDK4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
R.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.S Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58163.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58162.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58156.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58159.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58160.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58161.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABX58158.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.VIELGC(+57.02)AATC(+57.02)PPAEPKKDI.T Y 54.81 2068.0332 19 5.8 518.0186 4 24.32 1 8213 BuCaMH03.raw 1.474E7 1 1 58 76 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P01397.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.IVELGC(+57.02)AATC(+57.02)PK.V Y 54.53 1317.6421 12 0.9 659.8289 2 35.23 1 15670 BuCaMH03.raw 2.0197E6 1 1 37 48 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P25667.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area BuCaMH03_B17 #Feature #Feature BuCaMH03_B17 Start End PTM AScore Found By
K.IVELGC(+57.02)AATC(+57.02)PK.V Y 54.53 1317.6421 12 0.9 659.8289 2 35.23 1 15670 BuCaMH03.raw 2.0197E6 1 1 37 48 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Peptide List


 


Prepared with PEAKS ™ (bioinfor.com)