Mar. Drugs 2013, 11(6), 1800-1814; doi:10.3390/md11061800
A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
1
Biotechnological Institute of Chinese Materia Medica, Jinan University, Guangzhou 510632, China
2
College of Pharmacy, Jinan University, Guangzhou 510632, China
3
Guangdong Food and Drug Vocational-Technical School, Guangzhou 510663, China
†
These authors contributed equally to this work.
*
Author to whom correspondence should be addressed.
Received: 4 March 2013 / Revised: 22 April 2013 / Accepted: 8 May 2013 / Published: 24 May 2013
Abstract
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. View Full-Text
This is an open access article distributed under the Creative Commons Attribution License (CC BY 3.0).
Share & Cite This Article
MDPI and ACS Style
Chen, L.; Song, L.; Li, T.; Zhu, J.; Xu, J.; Zheng, Q.; Yu, R. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata. Mar. Drugs 2013, 11, 1800-1814.
Related Articles
Article Metrics
Comments
[Return to top]
Mar. Drugs
EISSN 1660-3397
Published by MDPI AG, Basel, Switzerland
RSS
E-Mail Table of Contents Alert